5th grade assessment 1 - elementary language arts...
TRANSCRIPT
![Page 1: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/1.jpg)
5th Grade
Assessment 1
Table of Contents
Assessment Guide ……………………………………………..…………………………………………………………. Pages 2-11
Assessment Rubric.……………………………………………………………………………….………………………. Pages 12-15
Life Span of Female African Elephants…………………………………………………………………………... Page 16
The Swazi Eleven……………………………………………………………………………………………………………. Pages 17-18
Zoochosis……………………………………………………………………………………………………………………….. Pages 19-20
Alternate Text – Zoos, The Historical Debate…………………………………………………………………. Pages 21-24
![Page 2: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/2.jpg)
5th Grade Informational Reading/Argument Writing Performance Assessment –
Draft – 2013-2014
1
GRADE: Fifth
NAME OF ASSESSMENT:
Nonfiction Reading and Research-Based Argument Essay Writing Performance Assessment
STANDARDS ASSESSED:
Students will quote accurately from a text when explaining what the text says explicitly
and when drawing inferences from the text. (RI.5.1)
By the end of the year, students will read and comprehend informational texts, including
history/social studies, science, and technical texts, at the high end of the grades 4-5 text
complexity band independently and proficiently. (RI.5.10)
Students will write opinion pieces on topics or texts, supporting a point of view with
reasons and information. (W.5.1)
Depth of Knowledge Level of task: Levels 2-4
Duration of administration: Two class periods
Materials needed:
Video clip and video projection
―Phoenix Zoo Helps Save Endangered Species http://www.youtube.com/watch?v=nGns4ER0L_c
Zoochosis by Stephanie Santana and Shauwn Lukose
from the book Should There Be Zoos: A Persuasive Text, by Tony Stead and Judy
Ballester. (FAMIS order#: 59255)
The Swazi Eleven, adapted by Kelly Boland
Life Span of Female African Elephants chart
Alternate text: “Zoos: The Historical Debate,‖ adapted from globalanimal.org (this could
be used either as a pre-assessment, or substituted for either of the other texts/tasks in the
post-assessment)
Booklets for student responses
Important Note:
Here are three options for assessment plans using these texts and tasks. The same rubrics
will apply across any of these assessment plans.
Plan 1)
Give the same two texts and tasks as a pre-assessment and post-assessment.
Plan 2)
Give two of the texts and tasks as a pre-assessment, and substitute the alternate text (with
its reading task) for one text/task in the post-assessment.
Plan 3)
Have students read one of the texts only as a pre-assessment, using the related reading
task and the same writing task.
![Page 3: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/3.jpg)
5th Grade Informational Reading/Argument Writing Performance Assessment –
Draft – 2013-2014
2
Explanation of Standards Alignment:
RI.5.1. Quote accurately from a text when explaining what the text says explicitly and when
drawing inferences from the text.
Students will write in response to prompts to quote accurately while explaining explicit
and implicit information from the text. They will also quote accurately from sources
when supporting their position in an argument essay.
RI.5.10: By the end of the year, read and comprehend informational texts, including
history/social studies, science, and technical texts, at the high end of the grades 4-5 text
complexity band independently and proficiently. (RI.5.10)
Students will summarize the main idea of a written grade level text in paragraph form.
They will state the main ideas, and show how those are supported by key ideas and
details.
W.5.1: Write opinion pieces on topics or texts, supporting a point of view with reasons and
information.
Students will write an argument essay.
![Page 4: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/4.jpg)
5th Grade Informational Reading/Argument Writing Performance Assessment –
Draft – 2013-2014
3
Overview of Assessment
**Note: Suggested teacher prompts follow – please alter and make note of alterations based on
your own conversational style and the ways in which you’ve talked about reading and writing
nonfiction in your own classroom. The tasks below could be administered in many different
ways.**
Preparation for the Assessment:
o Make copies of booklets – (see student booklet template at the end of this document)
o Have loose leaf paper available for essay writing and if students need more writing space
for their summary writing.
o Cue the video “Phoenix Zoo Helps Save Endangered Species”:
http://www.youtube.com/watch?v=nGns4ER0L_c
o Make copies of the three articles for students:
o “Zoochosis‖
o ―The Swazi Eleven‖
o ―Life Span of Female African Elephants‖
o Chart expectations for opinion writing:
Quickly plan how your essay will go:
how your reasons and evidence will be grouped and organized
Introduce the topic
State your claim:
Take a clear position on whether zoos help or harm animals
Create body paragraphs to organize your reasons
Include relevant facts and details from the sources you’ve read and watched
Use transition words to link information and ideas
Write a conclusion
Introduction:
Take a few minutes to introduce the whole of the assessment to the kids. It might sound
something like:
―You’re going to have a chance over these two days to show off your powers as researchers,
critical thinkers, and writers. Here’s how it’s going to go – we are going to immerse ourselves in
a mini-research project on something fascinating – zoos and whether they are good or bad for
animals. You’ll get a chance to watch a video and to read some articles. Each text will give you
some more information about this issue – Your reading will set you up to figure out what’s your
stance, or position on this issue. Should zoos even exist? After you’ve done some research,
you’ll have a chance to decide which side of this issue is most supported by the information you
have, and to write an argument essay to persuade others to take your side.‖
―We’ll have three periods of class-time to work on this. In the first period, you’ll watch the
video and read an article. Each time you view or read a text, your task will be to summarize that
text by writing more than one main idea and explaining how key details in the text support those
ideas.
![Page 5: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/5.jpg)
5th Grade Informational Reading/Argument Writing Performance Assessment –
Draft – 2013-2014
4
During the second period, you’ll read another article and a chart and learn more information.
You will be asked to summarize the main ideas and key details from these texts as well.
In the third period, you’ll have time to write your essay. As you write, remember everything you
know about writing essays. Your essays should be convincing because you’ll be writing them
based on the evidence you found in the video, the articles and the chart. You’ll want to quote
experts and reference important facts and details that will convince your readers. During the
research periods, when you’re watching the video and reading the articles, use what you know
about underlining and taking notes to get all the detailed information and specific references you
want to use in your essay.‖
Task 1
Video text: ―Phoenix Zoo Helps Save Endangered Species.‖
Show the video twice or three times.
―You’re about to watch a video that was aired on the news in Phoenix. It’s only a couple minutes
long, so let me tell you about it first. It’s a news report on how a zoo in Phoenix is interacting
with endangered animals. The information in the report comes from people who work at the zoo.
You’ll have a chance to watch the video more than once. You may want to just watch it first, and
then be ready to write down information that you may want to use later in your essay. In your
booklet, you should see a box-and-bullets outline for you to fill in with details from the video
that support the idea that the Phoenix Zoo is helping endangered species.‖
―Don’t forget to listen closely, and, when you hear important information, write down exact
quotes to fill in the box-and-bullets outline, and also to use later in your essay.‖
Task 2
Text: ―Zoochosis,‖ by Stephanie Santana and Shauwn Lukose
―I saw that you gathered some really important ideas and information from your first research
text. Now you’ll have a chance to read an article written by two fourth graders. Remember the
big question to keep in mind is this: What stance should I take about zoos based on what I’m
learning? You may underline or jot in the margins as you read. When you finish reading, answer
the question in your booklet. Be sure to include more than one detail in your response.‖
Task 3
Text: ―The Swazi Eleven‖ by Kelly Boland Hohne
―Researchers, you now will have the opportunity to read another article and add to your thinking
about the pros and cons of zoos. This one is called ―The Swazi Eleven,‖ and it’s based on
research by Tom French, a prize-winning journalist who spent six years studying zoos. After you
finish reading, fill in the table with details from the text that help us understand why it’s hard for
elephants to live in their natural habitat. Again, make sure to quote directly when you find
important details that you want to include.‖
![Page 6: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/6.jpg)
5th Grade Informational Reading/Argument Writing Performance Assessment –
Draft – 2013-2014
5
Text: ―Life Span of Female African Elephants in Zoos and the Wild‖ bar graph
―Finally, you’ll have a chance to read a chart to use in your essay. This chart is based on
scientific research that looked at hundreds of elephants over forty years. Your notes on this chart
are for you – I will not be scoring these, but you may want to jot down ideas and evidence from
this chart that you could use in your argument essay.‖
Task 4
―Researchers, this is it! You know the task: write a research-based argument essay to clearly
state a position on whether zoos help or harm endangered animals, and to support that position
persuasively with evidence from the texts you’ve watched and read. Use everything you know
about essay writing — taking a side and stating your claim clearly, and using information and
quotations from your research to back up your ideas—to write a convincing essay. You’ll have a
class period to write this important essay that will show everything you know about writing an
argument essay and incorporating research.‖
![Page 7: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/7.jpg)
Name: ____________________________________________ Class: _______________
1
Fifth Grade Informational Reading/Argument Writing Performance Assessment
Student Packet
Task 1: Response to “Phoenix Zoo Helps Save Endangered Animals”
The title of this video gives us an idea about the Phoenix Zoo. Write down quotes or
other specific details from the video that help us understand how the zoo helps to save
endangered animals.
Text detail: _______________________________________________________
__________________________________________________________________
__________________________________________________________________
Text detail:
__________________________________________________________________
__________________________________________________________________
The Phoenix Zoo helps save endangered animals.
![Page 8: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/8.jpg)
Name: ____________________________________________ Class: _______________
2
Task 2: Response to “Zoochosis”
This article takes a clear position on whether or not zoos are good for animals. Write their
position, or what side they’re on, in the box below. Then write details from the text that
help us understand that position and that support the authors’ argument. Be sure to quote
accurately from the text. You may use some of these details later in your own argument
essay.
Do the authors of ―Zoochosis‖ think zoos are good or bad for animals?
____________________________________________________________________________________________________
____________________________________________________________________________________________________
Text details or evidence that supports this position:
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
![Page 9: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/9.jpg)
Name: ____________________________________________ Class: _______________
3
Task 3: Response to “The Swazi Eleven”
In this article, we learn about elephants in Swaziland. There are problems for the
elephants in their natural habitat. According to the article, why is it a problem for
elephants to stay in Swaziland? What are some details from the text that help us
understand this problem?
According to this article, why is it a problem for elephants to stay in Swaziland?
____________________________________________________________________________________________________
____________________________________________________________________________________________________
Text details or evidence that supports this position:
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
_________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________
![Page 10: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/10.jpg)
Name: ____________________________________________ Class: _______________
4
Task 4: Summary of “Life Span of Female African Elephants”
*This note-taking is for your research only. Your response to this chart will not be
scored, but you may want to summarize main ideas and key details for your own
research. You may want to use some of this information in your argument essay.
If you choose to, use the space below to write down main ideas and key details that this
chart offers on the topic of zoos and endangered animals.
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
![Page 11: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/11.jpg)
Name: ____________________________________________ Class: _______________
5
Task 5: (use loose leaf paper for this)
Research-Based Argument Essay:
Do Zoos Help or Harm Animals?
Think about everything you’ve learned today and yesterday. Write a research-based
argument essay, convincing readers that zoos either help or harm animals. Be sure to use
what you know about writing essays to take a position on the topic and back it up with
evidence from your research. As you write, use information and quotations from the
video and any or all of the texts you read to support your claim.
Be sure to:
Make a quick plan for your essay using boxes and bullets or another
organizational tool
Introduce the topic
Take a position:
make clear whether you believe zoos help or harm animals
Create body paragraphs to organize your reasons
Include relevant facts and details from the sources you’ve read and watched
Use transition words to link information and ideas
Write a conclusion
Plan for Argument Essay:
![Page 12: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/12.jpg)
Teachers College Reading and Writing Project: Fifth Grade Informational Reading/Argument Writing Performance Assessment Rubric
1
TCRWP – Draft – 2013-2014
Reading Rubric Scoring Guide:
You may decide to score all of the responses to text (video response, text#1 and text#2). If so, average the score points for a final reading score.
You may decide to score only the response to the last text (text#2) as this is the grade level text. If so, use the score for this response as a final reading score.
In a post-assessment, use the same approach to achieve comparable results.
5th Reading
Rubric
Level 1-
Novice
1.5 Level 2-
Developing
2.5 Level 3-
Effective
3.5 Level 4
Highly Effective
R. Standard 5.1
Quote accurately when explaining what the text says explicitly and when drawing inferences from the text. Score
Attempts to reference source
material, but includes very few
references to details or examples
from the text.
References to source material
demonstrate inaccurate
understandings of the details or
the ideas in the text.
Refers details or examples from
the provided source(s). These
details are mostly relevant to the
idea or position the student is
discussing.
References to source material
demonstrate mostly accurate
understanding of literal and
inferential details from the text.
Quotes accurately when referring
to relevant details from the
provided source(s).
Demonstrates an accurate
understanding of literal and
inferential details from the text.
Provides citations for the source
material, helping the reader see
how particular passages from the
reading support (or counter) an
idea in the text.
5th Writing
Rubric
Level 1-
Novice
1.5 Level 2-
Developing
2.5 Level 3-
Effective
3.5 Level 4
Highly Effective
W. Standard 5.1
Introduce a topic or text clearly, state an opinion, and create an organizational structure in which ideas are logically grouped to support the writer’s purpose. Score:
Po
siti
on
Attempts to take a position on
the topic; position is unclear or
the writing is almost totally
informational..
Position on the topic is mostly
clear, though some parts of the
essay may veer from the stated
stance in ways that make it clear
this was not intended.
Makes a claim that takes a clear
position; maintains the position
throughout.
Establishes and maintains a
position while indicating an
understanding of the complexity
of the topic. This may be through
mentioning a possible counter-
argument or through making a
nuanced claim.
Str
uct
ure
:
Intr
od
uce
s to
pic
;
Pro
vid
es a
co
ncl
ud
ing
sta
tem
ent
Provides a very brief
introduction, which may not
connect closely to the claim.
Gestures towards a conclusion.
Provides an introduction to the
claim. Attempts to inspire readers
to care about the topic and/or
claim.
Provides a conclusion that
connects to the writer’s main
claim. May reflect on the original
claim.
Provides an introduction that
orients the reader to what is most
important in the argument.
Concludes the essay with a
section that highlights important
points and facts from across the
rest of the piece or brings in new,
effective evidence.
Orients the reader to what’s most
important in the argument and
offers some context.
Provides a conclusion that
strengthens or adds to the whole
of the argument through new
phrasing or insights.
![Page 13: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/13.jpg)
Teachers College Reading and Writing Project: Fifth Grade Informational Reading/Argument Writing Performance Assessment Rubric
2
TCRWP – Draft – 2013-2014
5th Writing
Rubric
Level 1-
Novice
1.5 Level 2-
Developing
2.5 Level 3-
Effective
3.5 Level 4
Highly Effective
W. Standard 5.1
Introduce a topic or text clearly, state an opinion, and create an organizational structure in which ideas are logically grouped to support the writer’s purpose.
Str
uct
ure
:
Cre
ate
s a
n o
rga
niz
ati
on
al
stru
ctu
re
Attempts some organization, but
this occurs mostly within a part
of the text – overall organization
is lacking.
Uses paragraphing to group
supporting ideas and their
relevant evidence.
It’s clear how most sections have
been organized.
Orders paragraphs in a structure
that demonstrates some planning:
may demonstrate least to most
importance; chronological order;
or follow the flow of the research
text.
Organizes evidence to support
each reason, making it clear
which evidence supports which
reasons.
Within supporting paragraphs or
sections, organizes evidence in an
order that reads well and makes
sense.
Str
uct
ure
: T
ran
siti
on
s
Some basic transitions are in
place: (for example, because.)
Reasons are connected to each
other using simple linking words
also, another)
Uses words and phrases to
connect different parts of the
piece together: to demonstrate
shifting from reasons to evidence
(e.g. “for instance”) or to
introduce a new point (e.g. “in
addition”).
Uses transition words and phrases
to connect evidence to reasons
using phrases like this shows
that...
Helps the reader move through
the essay with phrases such as
another reason, the most
important reason.*
To demonstrate cause and effect,
uses terms like consequently,
because of.
Uses a variety of transitional
phrases to help the reader
understand the flow of the
argument and the connection
between evidence, reasons, and
the writer’s position.
Dev
elo
pm
ent:
Ela
bo
rati
on
The writer provides reasons for
the claim.
Some information or explanation
is provided..
Writes 2-3 sentences about each
reason, including relevant
examples and information.
Most information supports the
claim.
Includes a variety of evidence to
support each reason (facts,
examples, quotations, micro-
stories, information). Discusses/explains some
evidence.
Includes a variety of evidence
from reliable sources to support
each reason.
Discusses/explains evidence and
how it supports the claim.
x 2:
![Page 14: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/14.jpg)
Teachers College Reading and Writing Project: Fifth Grade Informational Reading/Argument Writing Performance Assessment Rubric
3
TCRWP – Draft – 2013-2014
5th Writing
Rubric
Level 1-
Novice
1.5 Level 2-
Developing
2.5 Level 3-
Effective
3.5 Level 4
Highly Effective
W. Standard 5.1
Introduce a topic or text clearly, state an opinion, and create an organizational structure in which ideas are logically grouped to support the writer’s purpose. Score
La
ngu
ag
e C
on
ven
tion
s
Most words are spelled
conventionally, including some
domain-specific vocabulary
relevant to the topic.
Capitalization, ending
punctuation and use of commas
in lists is mostly accurate.
The writer uses a variety of
sentences lengths.
High-frequency words and many
Tier II and domain-specific
vocabulary words are spelled
conventionally.
Some complex sentences are
punctuated correctly with internal
commas.
Uses commas to set off
introductory parts of sentences (At
this time in history, it was common
to...)
Approximates correct punctuation
when quoting from sources.
Uses punctuation such as dashes,
colons, parentheses, and
semicolons to help include or
connect extra information in some
sentences.
Uses correct punctuation when
quoting from sources.
R. Standard 5.1
Quote accurately when explaining what the text says explicitly and when drawing inferences from the text.
Dev
elo
pm
ent:
Rea
din
g/R
esea
rch
Refers to more than one detail or
example from the provided
source(s).
References to source material
demonstrate a literal and
inferential understanding of the
details included.
Refers to multiple relevant,
important details or examples
from the provided source(s).
References to source material
demonstrate an accurate
understanding of literal and
inferential details from the text.
Quotes accurately when referring
to the most relevant details from
the provided source(s) to support
the
main claim.
Demonstrates insightful
understanding of literal and
inferential details from the text.
Uses accurate citations to
demonstrate an analytic reading of
the source material, helping the
reader see how particular passages
from the reading support (or
counter) the writer’s position on
the topic.
![Page 15: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/15.jpg)
Teachers College Reading and Writing Project: Fifth Grade Informational Reading/Argument Writing Performance Assessment Rubric
4
TCRWP – Draft – 2013-2014
Writing Rubric Scoring Instructions:
Circle the descriptor in each row that best describes the student’s work in this category. If the work falls between two descriptors, check a mid-point box to indicate this.
Use the scoring box to the right of the table to record the score for each category.
For the category “Development: Elaboration,” double the points and record in the box to the right, as indicated by the “x 2.” This is because elaboration counts more
towards the overall success of the piece than other individual categories.
Finding an overall Reading/Writing Scaled Score:
Add the total points from the reading and writing rubrics to come up with a raw score.
Use the following table to calculate a scaled score:
To look closely at growth between pre- and post-assessments, keep this rubric with the circled descriptors.
You will want to track growth across sub-sections, not just in the scaled score.
Total Points Scaled Score
1-9 1
9.5-13.5 1.5
14-18 2
18.5-22.5 2.5
23-27 3
27.5-31.5 3.5
32-36 4
![Page 16: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/16.jpg)
This chart shows the results of a study by scientists around the world. These scientists looked at 40 years of information from zoos, about 800 elephants. They also looked at information about hundreds of elephants in the wild for about the same number of years.
0
10
20
30
40
50
60
Life Span of African Elephants Life Span of Asian Elephants
Ye
ars
Live
d
Life Span of Female Elephants in Zoos and the Wild
In Zoos
In the Wild
![Page 17: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/17.jpg)
The Swazi Eleven
Tom French, Pulitzer Prize-winning journalist, spent six years studying zoos and wrote
about his experiences in his book Zoo Story. His book opens with the story of eleven elephants
who were taken from Swaziland in Africa and flown to zoos in San Diego and Tampa.
It was August 21, 2003 on a Thursday morning. The elephants were in the hold of the
plane in crates. Some of them were sleeping on their sides; others were awake and drinking
water. Mick Reilly was with them. He and his father ran the Mkhaya and Hlane Game Reserves
in Africa where the elephants had lived. Mick had grown up with these elephants. “It’s not so
bad,” Mick told the elephants as he refilled their water.
Mick was tired. It had been a long fight to get the elephants on this flight. Animal rights
activists had tried to stop the elephants from going to zoos. Groups like Born Free and PETA
(People for the Ethical Treatment of Animals) filed a lawsuit and wrote angry letters. The
government and even the local newspapers of Swaziland had blamed Mick and his father for
sending the elephants to zoos. Mick was upset. Didn’t people understand? The elephants
couldn’t stay on the land.
There were too many elephants living in the Mkhaya and Hlane Game Reserves. They
were ruining the land. Elephants eat for up to eighteen hours a day. When they eat they tear bark
off trees and even knock trees down. Elephants had destroyed so many trees that a big part of the
parks was now only black and dead trees.
Animals like eagles, owls and vultures had no place to nest. In addition, the black rhino,
one of Africa’s most endangered species, also needed the trees to eat. Now the rhino had no
food. If the situation continued many animals and plants would be wiped out.
![Page 18: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/18.jpg)
Mick and his father tried to find another park nearby, but South Africa was overrun with
elephants. No park could take any more. The Reillys looked in other places in Africa but there
was a threat of poaching. They did not want their elephants to be shot as trophies and have their
tusks sold on the black market.
In other parks rangers had killed elephants to make sure the population stayed low. Mick
didn’t want to kill his elephants.
Of course, none of this was the elephants’ fault in the first place. In Swaziland, as in other
parts of Africa, elephants have struggled to survive. Humans have taken so much land in Africa
and occupy so much space that most animals are confined inside game parks. Fifty years ago
there weren’t even any elephants in Swaziland. They had all died or been killed off by hunters.
Mick’s father, Ted, tried to help. He built three parks to protect endangered species. The
elephants arrived in 1987 and they survived so well in the parks, there were soon too many of
them.
Humans had created this problem. Now it was up to humans to fix it. Zoos were the only
option.
“On this plane I’m giving them a chance,” Mick thought.
Before his family had agreed to send the animals to zoos Mick had visited the zoos and
talked to the keepers. He saw that the elephants would be treated well and given as much space
as possible. He said the animal clinic at the San Diego Zoo was better than any hospital in
Swaziland.
The zoos offered to pay $12,000 for each elephant and Mick and his family would use the
money to protect the other animals in the park and buy more land for the animals.
![Page 19: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/19.jpg)
![Page 20: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/20.jpg)
![Page 21: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/21.jpg)
Zoos: The Historical Debate
Adapted from an article on Globalanimal.org
For hundreds of years, people have flocked to zoos to see wild animals up close. But many
believe that keeping an animal in a zoo is not in the best interest of the animal. Read on for both
sides of this debate, told from the perspective of an animal rights activist. — Global Animal
Humans have a fascination with wild animals. Every year, millions of people go on safaris, board
whale-watching cruises and watch Jeff Corwin get attacked by snakes on Animal Planet; others
drive to their local zoo for a full day of animal gazing.
Millions of people visit the thousands of zoos around the world. We never seem to get tired of
watching wildlife! Depending on your point of view, though, zoos are either places of education
and conservation or unnecessary prisons. While some people argue that zoos play an important
role in conservation of endangered animals, others say that zoos do more harm than good.
So which is it? Are zoos good or bad?
One Side of the Story: Education, Conservation, Entertainment
Zoos have improved a lot in the last 4,000 years. They are no longer filled with cages of cold
cement and steel bars. These days, most zoos create friendlier environment for animals. They
include moats or ditches to separate animals from people, and mini-habitats that look like the
animals’ natural environment.
The procedure for acquiring animals has also changed. Zoos used to capture most of their
animals directly from the wild. Now, however, they get their animals through captive breeding
programs and other zoos. Some breeding programs also help to restore threatened species. After
10 years of working to strengthen the population numbers of the endangered California condor, a
type of vulture, the Los Angeles and San Diego zoos were able to rebuild a population of fewer
than two dozen birds to around 170 birds!
Some zoos also take in abandoned animals that wouldn’t otherwise have a home. Both the
Baltimore Zoo and the Detroit Zoo have taken in polar bears rescued from a traveling circus, and
the Bronx Zoo took in an orphaned snow leopard from Pakistan in 2007. The cub, Leo, now
spends his time frolicking and chasing small animals that wander into his enclosure.
And although zoo animals aren’t treated quite like guests at a four-star hotel, their care has
improved a lot. Zookeepers now understand that many animals, such as monkeys, bears and
elephants, need engaging activities to prevent boredom. This is why you’ll often see chimps
playing with toys or tigers “hunting” for a meal.
![Page 22: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/22.jpg)
Zoos also give scientists a chance to conduct research. In 2002, zoos participated in 2,230
research and conservation projects in more than 80 countries. The information they gather helps
them to develop new medicines and techniques to improve animal health.
Beyond the positive impact zoos try to have on animals, they often affect the people visiting as
well. Zoos don’t just entertain, they also try to educate. With a variety of programs geared
toward children and adults, zoos teach people about the needs of animals and the importance of
conservation.
The fact that zoos impact people in a positive way is nice, but it’s not the people critics worry
about — it’s the animals.
Another Perspective: Wild Animals Are Meant to Be Wild
Maggie the elephant is a perfect example of why zoos are not good. For years, Maggie was
forced to spend her days in a small indoor enclosure because it was too cold for her to go outside.
The zoo put an elephant-sized treadmill in her cage so that she could exercise, but she refused to
use it.
It can be incredibly difficult to provide for the needs of animals like elephants. If Maggie and
other zoo elephants lived in the wild, they would wander as much as 30 miles a day in large
groups, grazing on leaves and stopping to splash in watering holes. In a zoo, they’re lucky to get
a few acres and a roommate or two.
Maggie’s story is just one of many. Zebras at the National Zoo in Washington D.C. starved to
death because of insufficient or incorrect food, and the same zoo’s red pandas died after eating
rat poison.
The Animal Welfare Act in the United States sets standards for zoos here, and some conditions
have improved—but some say it is still not good enough. Although natural-looking habitats are
more attractive, people like David Hancocks, a zoo consultant and former zoo director, describe
them as mere illusions. The animals’ homes look prettier, but they really aren’t any better than
they were before. Indeed, many captive animals exhibit signs of severe distress: People have
witnessed elephants bobbing their heads, bears pacing back and forth and wild cats obsessively
grooming themselves.
Zoos may not even benefit people as much as we once thought. According to one study, many
visitors don’t pay much attention to the animals — they’re actually talking to each other about
unrelated things and spending only a few minutes at each display.
It is unclear whether zoos are good or bad for animals. As you’ve seen, it depends a lot on what
zoo you’re talking about, and what the animals are experiencing. If you could talk to animals,
Leo the snow leopard would probably tell you that zoos are great; however Maggie the elephant
might respond by slapping you with her trunk.
![Page 23: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/23.jpg)
Response to: “Zoos: The Historical Debate”
This article presents some pros (positive sides) and cons (negative sides) of zoos. Use the chart
below to sort the reasons and evidence that the author gives us into these categories. Be sure to
find more than one text detail for each category. Then think about whether there is stronger
evidence for or against zoos, and write to explain your thinking.
Pros: Why Zoos Are Good Cons: Why Zoos Are Bad
Text Details:
Text Details:
Which side has the strongest evidence? Choose one piece of evidence and explain why it is a
strong piece of evidence in this debate.
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
![Page 24: 5th Grade Assessment 1 - Elementary Language Arts Helpbcpshelpdeskelementaryenglish.weebly.com/uploads/6/... · 5th Grade Informational Reading/Argument Writing Performance Assessment](https://reader036.vdocuments.net/reader036/viewer/2022081400/5f165cae0040cb1ca208adb2/html5/thumbnails/24.jpg)
On August 15th
the courts denied the lawsuit filed by animal rights groups. The elephants
would go to the zoos. Four would go to Tampa to the Lowry Park Zoo and the other seven were
headed to San Diego.
As the plane began its final descent toward Tampa, the elephants were restless. Mick
knew the trip could not be easy for them. Surely, they would wonder about the strange noises
and rumblings around them. Surely, they would be confused. He was certain the elephants were
hungry after the long flight. Mick went to the elephants and stroked each one. “Kunekudla
lukunengi,” he told them. “There’s lots of food where you’re going.”
Adapted from Zoo Story, by Thomas French
by Kelly Boland Hohne