complement activation in chromosome 13 dementias: similarities … · 2002. 10. 17. · abstract...
Post on 24-Aug-2020
1 Views
Preview:
TRANSCRIPT
Complement activation in chromosome 13 dementias: Similarities with
Alzheimer’s disease
Agueda Rostagno1, Tamas Revesz3, Tammaryn Lashley3, Yasushi Tomidokoro1, Laura
Magnotti1, Hans Braendgaard4, Gordon Plant5, Marie Bojsen-Moller6, Janice Holton3,
Blas Frangione1, 2, and Jorge Ghiso1, 2.
Departments of 1Pathology and 2Psychiatry, New York University School of Medicine,
New York, U.S.A; 3Queen Square Brain Bank and Department of Molecular
Pathogenesis, Division of Neuropathology, Institute of Neurology, UCL, London, U.K.;
Departments of 4Neurology and 6Neuropathology, Århus University Hospital, Århus,
Denmark; and 5National Hospital for Neurology and Neurosurgery, London, U.K.
Running title: Chromosome 13 dementia and complement activation
Keywords: amyloidosis, ABri, ADan, familial British dementia, familial Danish
dementia, classical complement pathway, alternative complement pathway
Corresponding author: Agueda Rostagno, Ph.D. Department of Pathology New York University School of Medicine 550 First Avenue, TH-435 New York, NY 10016 rostaa02@popmail.med.nyu.edu
- 1 -
Copyright 2002 by The American Society for Biochemistry and Molecular Biology, Inc.
JBC Papers in Press. Published on October 17, 2002 as Manuscript M206448200 by guest on D
ecember 11, 2020
http://ww
w.jbc.org/
Dow
nloaded from
ABSTRACT
Chromosome 13 dementias - Familial British Dementia (FBD), and Familial Danish
Dementia (FDD) - are associated with neurodegeneration and cerebro-vascular
amyloidosis, with striking neuropathological similarities to Alzheimer’s disease (AD). In
spite of the structural differences among the amyloid subunits (ABri in FBD, ADan in
FDD, and A in AD), these disorders are all characterized by the presence of
neurofibrillary tangles and parenchymal and vascular amyloid deposits co-localizing with
markers of glial activation, suggestive of local inflammation. Proteins of the complement
system and their pro-inflammatory activation products are among the inflammation
markers associated with AD lesions. Immunohistochemistry of FBD and FDD brain
sections demonstrated the presence of complement activation components of the classical
and alternative pathways as well as the neo-epitope of the membrane attack complex.
Hemolytic experiments and ELISAs specific for the activation products iC3b, C4d, Bb
and C5b-9 indicated that ABri and ADan are able to fully activate the complement
cascade at levels comparable to those generated by A 1-42. ABri and ADan specifically
bound C1q with high affinity and formed stable complexes in physiological conditions.
Activation proceeds ~70-75% through the classical pathway while only ~25-30% seems
to occur through the alternative pathway. The data suggest that the chronic inflammatory
response generated by the amyloid peptides in vivo might be a contributing factor for the
pathogenesis of FBD and FDD and, in more general terms, to other neurodegenerative
conditions.
- 2 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
INTRODUCTION
The classical hallmark lesions of Alzheimer’s disease (AD)1, cerebral senile plaques and
neurofibrillary tangles (NFTs), have been known for nearly a century. During the past
two decades, a wide range of inflammatory markers - typically absent or significantly
reduced in the normal elderly population - were reported in AD brains (1), and
accumulating evidence suggests that sustained brain inflammation might be an essential
co-factor in AD pathogenesis (2,3). In this sense, immunologic factors and inflammation
mediators, including complement proteins and pro-inflammatory peptides generated at
different stages of complement activation (4) as well as various cytokines (5) have been
implicated in accelerating the progression of AD.
The complement system is a highly regulated, powerful effector mechanism of the
immune system that destroys and clears deleterious substances. It is composed of more
than twenty proteins that become sequentially activated in a proteolytic cascade.
Originally, activation of the complement system was thought to occur only by binding of
immune complexes to C1q, the recognition component of the classical pathway.
However, it became then evident that the complement system can directly be activated, in
the absence of antibody, by interaction of certain foreign molecules with C3 (alternative
activation pathway), C1q (antibody-independent classical activation pathway) or by
specific lectins on the surface of certain microorganisms (lectin activation pathway)
(3,6,7).
The first step in the classical complement pathway involves the binding of an
activator to C1q resulting in the subsequent conversion of the serine proesterases C1r and
C1s to their active forms and, in turn, in the activation of C4, C2 and then C3. The
alternative pathway differs from the classical pathway in that activation begins at the
level of C3 and involves factors B, D, and Properdin. Proteolytic modification of C3 by
either pathway leads to the cleavage of C5 and the incorporation of C6, C7, C8, and
multiple molecules of C9 resulting in the formation of the membrane attack complex
(MAC), C5b-9, a transmembrane channel capable to produce cell lysis (8).
1 AD, Alzheimer’s disease; CVF, cobra venom factor; ELISA, enzyme-linked immunosorbent assay; FBD, familial British dementia; FDD, familial Danish dementia; HPLC, high performance liquid chromatography; MAC, membrane attack complex; NFTs, neurofibrillary tangles; NHS, normal human serum
- 3 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
Activation-derived proteins of both the classical and alternative pathways have
been demonstrated in association with AD lesions by numerous groups (3). We
investigated the complement activation cascade in chromosome 13 dementias, two
hereditary conditions - Familial British Dementia (FBD) and Familial Danish Dementia
(FDD) - also associated with neurodegeneration and amyloid deposition in the central
nervous system. FBD has been described in members of three British pedigrees and is
characterized clinically by dementia, cerebellar ataxia and spastic paraparesis with the
disease onset typically in the fourth to fifth decade of life and death occurring some ten
years later (9). FDD is a disease associated with a single Danish family with the onset of
cataracts in patients before the age of thirty. Affected family members subsequently
develop sensory hearing loss, cerebellar ataxia, psychosis and dementia leading to death
between the ages of fifty and sixty years (10). The neuropathology in both diseases is
remarkably similar to that seen in AD, including cerebral amyloid angiopathy, pre-
amyloid lesions, amyloid plaques of various types and NFTs, ultrastructurally composed
of paired helical filaments with an electrophoretic pattern of abnormal
hyperphosphorilated tau indistinguishable from that observed in AD. Activated
microglia expressing the major histocompatibility class II antigens that are characteristic
of inflammatory processes, can be demonstrated around amyloid plaques and dystrophic
neurites but not in preamyloid lesions in both FBD and FDD (10,11) in a topographical
distribution similar to that found in AD. In these disorders the deposited amyloid
proteins, ABri in FBD and ADan in FDD, are proteolytic fragments of a larger precursor
molecule BriPP codified by a multiexonic gene BRI2 (also known as ITM2B) located on
the long arm of chromosome 13 (12-14). The amyloid peptides originate as a result of
two different genetic defects namely a Stop-to-Arg mutation in FBD and a ten-nucleotide
duplication-insertion immediately before the stop codon in FDD. Regardless of the
nucleotide changes, the final outcome is common to both diseases: the ordinarily
occurring stop codon is not in frame causing the genesis of an extended precursor
featuring a C-terminal piece that does not exist in normal conditions. These de novo
created amyloid peptides, with no sequence identity to any known amyloid protein, are
both 34-residues long, share 100% homology of the first 22 residues and have a
completely different 12 amino acid C-terminus. When deposited, both ABri and ADan
- 4 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
feature pyroglutamate at their N-terminus, a post-translational modification also
identified in some truncated amyloid species isolated from Alzheimer’s disease brains,
i.e. A pE3 and A pE11. (15-17).
The results presented here show i) the co-localization of complement activation
products with amyloid plaques and cerebrovascular amyloid deposits in FBD and FDD
and ii) the activation of both the classical and the alternative pathways of the complement
system by synthetic peptides representing the main species deposited in both disorders,
activation that proceeds to the terminal stages with the generation of C5b-9. The data
suggest that chronic inflammation driven by in vivo complement activation may be a
contributing factor to disease progression and pathogenesis in both FBD and FDD.
- 5 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
MATERIALS AND METHODS
Materials
Synthetic peptides: The following peptides were synthesized at the W. M. Keck facility at
Yale University and further purified by high-performance liquid chromatography
(HPLC): ABri1-34 (EASNCFAIRHFENKFAVETLICSRTVKKNIIEEN), ADan1-34
(EASNCFAIRHFENKFAVETLICFNLFLNSQEKHY), ABri1-23 (EASNCFAIRHFEN
KFAVETLICS), ABri24-34 (RTVKKNIIEEN), ADan23-34 (FNLFLNSQEKHY), as
well as full length variants containing N-terminal pyroglutamate, oxidized cysteines at
positions 5 and 22, and serine residues replacing the wild type cysteines at both positions.
Peptide A 1-42, DEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVVGGVVIA,
used as a control in all the experiments, was also synthesized at the same facility, purified
and characterized as described (18).
Complement Reagents: Pooled normal human serum (NHS), C1q-depleted serum,
purified C1q protein, polyclonal goat anti-C1q antiserum, and ELISA kits for the
quantitation of the activation products C4d, Bb, iC3b, and SC5b-9 were purchased from
Quidel, Inc., Mountain View, CA. EZ diagnostic kit for the assay of total complement
activity (CH50) was obtained from Diamedix Corporation, Miami, FA.
Immunohistochemistry reagents: Antibodies immunoreactive with ABri (Ab 338) and
ADan (Ab 5282) molecules were raised in New Zealand white rabbits by immunization
with synthetic peptides comprising positions 22-34 of the respective amyloid molecules,
as previously described (12,14). Polyclonal rabbit anti-C1q was purchased from Dako
(Carpinteria, CA), polyclonal anti-C5b-9 (neo-epitope) and monoclonals anti-C4d, and
anti-Bb were obtained from Quidel, Inc.
Immunohistochemical Studies
Sequential paraffin sections from the hippocampus including the dentate fascia were used
for C1q immunostaining in 5 cases with FBD (mean age at death 62.4 years, range 59-68
years) and 3 cases with FDD (mean age at death 53.7 years, range 43-60 years). For the
immunohistochemical detection of C4d, C5b-9, and Bb sequential frozen sections, fixed
in acetone, were used. Sections from 4 controls (mean age at death 64.3 years, range 33-
- 6 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
88 years) without a neurological disease and also 7 cases with Alzheimer’s disease (mean
age at death 78.2 years, range 63-92 years) were also stained in a similar manner.
Depending on the antibody, a number of different pretreatments were employed for the
paraffin embedded tissues, which are detailed in Table I. After pretreatment, the tissue
sections were incubated with the pertinent primary antibodies, followed by sequential
incubations with either biotinylated anti-mouse or anti-rabbit secondary antibodies, as
appropriate, and the corresponding ABC complex (Dako, Denmark). Color was
developed using diaminobenzidine/ H2O2 followed by hematoxylin counterstaining.
Characterization of amyloid peptides
Structural analysis. Secondary structure was assessed by circular dichroism (CD)
spectrometry in the far UV (190-250 nm) at 24 oC using a Jasco J-720 spectropolarimeter
(Jasco, Tokyo, Japan) as previously described (19).
Peptide solubilization and aggregation. The different ABri and ADan peptides were
solubilized in 10 mM NaHCO3, pH 9.6, aliquoted and lyophilized. Before use, each
aliquot was dissolved in distilled water at a concentration of 1 mg/ml and immediately
used in the complement activation assays. A 1-42 was dissolved in distilled water, and
added of concentrated PBS to reach a final concentration of 150 mM NaCl. Solutions of
1mg/ml were allowed to aggregate for 7 days at 37 oC, as described (19).
HPLC purification. Fractions enriched in ABri and ADan monomers were obtained via
reverse-phase HPLC (Applied Biosystems 130A Separation system) on a 0.21 x 25 cm
Vydac C4 TP52 microbore column (Vydac, Hesperia, CA), using isocratic conditions at
25% acetonitrile in 0.1% trifluoroacetic acid for 10 minutes followed by a 30 minutes
linear gradient of 25 to 40 % acetonitrile in 0.1% trifluoroacetic acid at a flow-rate of 200
µl/min. Fractions were collected in accordance to the absorbance at 220 nm.
Western Blot analysis. The degree of oligomerization of the various peptides was
assessed by western blot. Aliquots of 100 – 150 ng of each peptide freshly dissolved or
after 1 h incubation in either PBS pH 7.4 or Tris-HCl pH 7.4 containing 2.5 mM Ca+2, 1
- 7 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
mM Mg+2, 75 mM NaCl were separated in 16% tris-tricine SDS-PAGE gels and
transferred for 45 min at 400 mA to polyvinylidene difluoride (PVDF) membranes
(Immobilon-P, Millipore, Bedford, MA) using CAPS (3-cycloexylamino-1-
propanesulfonic acid, Sigma, St Louis, MO) buffer pH 11, containing 10 % methanol.
After transference, membranes were blocked with 5% non-fat milk in PBS pH 7.4,
containing 0.1 % Tween 20 and incubated with the corresponding primary antibody [anti-
ABri, antibody 338 (1 µg/ml IgG); anti-ADan, antibody 5282 (2 µg/ml IgG)] for 3 h at
room temperature followed by horse-radish peroxidase conjugated anti-rabbit
immunoglobulins [Amersham Pharmacia Biotech, Piscataway, NJ (1:3000)].
Immunoreactivity was assessed by enhanced chemiluminescence (ECL) after developing
with ECL western blotting detection reagent (Amersham Pharmacia Biotech) according
to the manufacturer’s specifications.
Assays for Complement activation/consumption
1) Hemolytic Assays. Total functional activity of the classical pathway (CH50). The
assay relies on the lysis of sensitized sheep erythrocytes by human serum following
activation of the Ca+2- and Mg+2
-dependent classical pathway. Briefly, in order to induce
complement activation, constant volumes (10 µl) of NHS were separately incubated for
45 min at 37oC with ten µl of ABri, ADan and A 1-42 solutions containing increasing
concentrations [0-1000 µg/ml in Tris-buffered saline pH 7.4 containing 5 mM CaCl2 and
2 mM MgCl2 (TBS)] of the amyloid peptides. The reaction was stopped on ice and
immediately analyzed for total complement activity (CH50) employing EZ diagnostic kit
in accordance to the manufacturer’s specifications. Results were expressed as percentage
of lysis compared to controls of 100% complement activity (no complement
consumption) in which NHS was incubated with buffer in the absence of amyloid
peptides.
2) Quantitation of activation products by ELISA. NHS was incubated with identical
volumes of the different amyloid peptides in increasing concentrations (0-1000 µg/ml in
TBS) as described above, and the reaction stopped by the addition of EDTA to a 5 mM
final concentration. The generation of complement activation products was analyzed by
- 8 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
capture-ELISA employing C4d, iC3b, Bb, and SC5b-9 kits from Quidel in accordance to
the manufacturer’s instructions. Samples were diluted of 1:100 for the quantitation of
C4d and Bb, 1:300 for iC3b, and 1:200 for SC5b-9 prior to the analysis by ELISA.
In order to estimate the contribution of the alternative complement pathway to the
total activation of the system, in a separated set of experiments and using identical
conditions as above, the amyloid peptides were incubated with C1q depleted serum
(reconstituted with Ca+2 and Mg+2 ions to a 10 mM final concentration) instead of NHS,
and the generation of SC5b-9 assessed by ELISA. Confirmation of the contribution of the
alternative pathway to the total activation was achieved by quantitating the SC5b-9
generated by incubation of the amyloid peptides with NHS in the presence of
Mg+2/EGTA.
3) Controls of complement activation.
a) Aggregated IgG: As positive control for classical pathway activation in both, CH50
and ELISA tests, NHS was separately added of identical volumes of aggregated IgG
solutions of increasing concentrations (0-1000 µg/ml) and incubated at 37oC for 45
minutes. The NHS was subsequently analyzed for total remaining complement hemolytic
activity (CH50) and generation of complement activation products by ELISA as
described above. Aggregated IgG was prepared by incubating a 5 mg/ml solution of
human polyclonal IgG (Cohn fraction II; Miles Laboratories, Inc., Kaukakee, IL) at 63 C
for 15 minutes as described (20,21). Following centrifugation at 2,000 x g for 10 minutes,
the pelleted larger aggregates were discarded and the soluble IgG aggregates aliquoted
and stored at –70 oC.
b) Cobra Venom Factor (CVF). Positive control for the generation of activation products
by the alternative pathway consisted of NHS incubated for 1 hr at 37 oC with cobra
venom factor (CVF, naja naja kaouthia; Sigma Chem. Co., St. Louis, MO) at a ratio of
2µg/100 µl serum (22). The reaction was stopped by cooling on ice to 4 oC, and the serum
immediately analyzed for the presence of complement activation products by ELISA, as
described above.
- 9 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
Solid-phase binding assays. Binding of C1q to immobilized amyloid peptides
ELISA microtiter wells were coated for 2 h at 37 oC with ABri1-34, ADan1-34, ABri1-23
and A 1-42 peptides at a concentration of 400 ng/0.1 ml of 0.1M NaHCO3, pH 8.6. After
blocking with 1% bovine serum albumin for one hour at room temperature, variable
concentrations (0-20 nM in TBS) of C1q were incubated with the peptide-coated wells
for one hour at room temperature. Bound C1q was detected with goat polyclonal anti-C1q
antiserum (1:1000 in TBS containing 0.1% Tween 20 and 0.1% BSA [TBST]) followed
by alkaline phosphatase-labeled swine anti-goat IgG (1:5000 in TBST; BioSource
International, Camarillo, CA). The reaction was developed with p-nitrophenyl phosphate
in diethanolamine buffer (BioRad, Richmond, CA) stopped with 0.4 M NaOH and the
absorbance at 405 nm quantitated in a Spectracount ELISA microplate photometer
(Packard, Meriden, CT). Binding data were analyzed by non-linear regression using
GraphPad Prism (GraphPad Software, Inc., San Diego, CA).
ABri-C1q and ADan-C1q Complex formation
The formation of the ABri/ADan-C1q complexes was assessed via amino acid sequence
analysis. Ten µg of C1q in TBS were incubated with 20 µg of either ABri or ADan
peptides for 1 h at 37 oC. The resulting complexes were separated by electrophoresis on
1% agarose gels in 75 mM veronal buffer, pH 8.6 containing 2 mM sodium lactate and
contact-transferred to PVDF membranes. Transferred proteins were stained for 1 minute
with 0.125% Coomassie Blue R-250 in 47% methanol, membranes distained, extensively
washed with water and the bands of interest excised and subjected to N-terminal
sequencing on a Procise 494 protein sequencer (Applied Biosystems, Foster City, CA).
- 10 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
RESULTS
Immunohistochemistry
Figure 1 (Panel A) shows that antibody 338 specific for the carboxyl-terminal region of
ABri strongly labels amyloid plaques and amyloid laden blood vessels, including affected
small arteries, arterioles and capillaries in FBD. Both the vascular and parenchymal
amyloid lesions were strongly labeled with anti-C1q (Panel B), anti-C4d (Panel C), anti-
C5b-9 (neoepitope) (Panel D), and anti-Bb (Panel E) in a staining pattern similar to that
seen for ABri immunohistochemistry. Diffuse deposits, defined as Congo red and
Thioflavin S negative or weakly positive ABri parenchymal lesions (11), were only
faintly stained (not shown). The FDD lesions, mainly vascular amyloid and parenchymal
preamyloid plaques were highlighted by antibody 5282 recognizing the carboxyl-terminal
end of ADan (Panel F). The anti-complement antibodies (anti-C1q (panel G), anti-C4d
(Panel H), anti-C5b-9 (neoepitope) (Panel I), and anti-Bb (Panel J) labeled amyloid
primarily deposited in small arteries, arterioles and capillaries. The immunoreactivity
with these antibodies was weak or absent in the parenchymal lesions which have been
shown to be composed primarily of protein in preamyloid conformation (Congo red and
Thioflavin S negative or weakly positive deposits) (10). Immunohistochemical analysis
of AD cases, which were used as positive controls, showed labeling of both vascular A
amyloid deposits and parenchymal A -positive plaques by anti-C1q, anti-C4d and anti-
C5b-9 antibodies. Smaller numbers of the A -positive lesions were also stained with anti-
Bb antibody (not shown). Two of the normal controls were entirely negative for
complement proteins, while in the two normal control cases with age at 81 and 88 years,
occasional A -positive plaques immunoreacted only with the anti-C1q antibody (not
shown).
Classical pathway of Complement activation
In view of the presence of complement activation products in the amyloid lesions of FBD
and FDD, we investigated whether their co-localization reflected a secondary
phenomenon or a specific interaction between complement proteins and the deposited
peptides. As an initial step, we tested in hemolytic assays the ability of ABri and ADan
- 11 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
peptides to activate the classical pathway. As shown in Figure 2A, incubation of NHS
with increasing concentrations of ABri1-34 and ADan1-34 resulted in a concomitant
decrease in the remaining complement activity (CH50) compared with NHS incubated
under the same conditions in the absence of the amyloid peptides. Under our
experimental conditions, both peptides consumed complement to approximately the same
extent, with remaining complement values that reached a minimum of 18% for ABri1-34
and 23% for ADan1-34 at the maximal concentration tested (final concentration: 500
µg/ml; ~ 120 nmol/ml). The consumption of complement induced by the ABri and ADan
peptides was also similar to that of 7-days aggregated A 1-42 that, under the conditions
tested, reduced the complement activity to 23% of the values obtained in the absence of
peptide, in agreement with previously published data (23). As a positive control for the
classical pathway activation, Figure 2A also depicts the decrease in complement activity
induced by incubating NHS with aggregated IgG, a known activator of the classical
pathway. As it can be deduced from the data, aggregated IgG is a more potent activator of
the complement system than ABri and ADan, achieving similar levels (~ 30% of the
original complement activity) at a much lower molar ratio (500 µg/ml; 3.3 nmol/ml), as
described (24). No differences in activation were observed among ABri or ADan
peptides bearing different post-translational modifications, i.e. N-terminal glutamate or
pyroglutamate, oxidized cysteines 5 and 22, or peptides containing serine residues
replacing cysteines 5 and 22 (not shown).
In view of the values obtained in the CH50 hemolytic assay, we quantitated the in vitro
formation of the activation products C4d, iC3b, and SC5b-9 via specific capture ELISAs
employing specific monoclonal antibodies directed against neo-epitopes originated in the
activation-derived fragments (8). The C4d levels generated by incubation of NHS with
ABri and ADan peptides are shown in Figure 2B. C4d, together with C4c, are the
physiological degradation products of C4b as a result of proteolytic cleavage by the
complement regulatory protein Factor I in the presence of either C4-binding protein or
complement receptor 1 (CR1) (25,26). The ability of both amyloid peptides to generate
C4d in a dose response manner indicates that activation of the complement system
occurred through C1 activation since the conversion of the proenzyme C1s is solely
- 12 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
needed to produce the C4 cleavage. Proteolytic fragments of C3 (Figure 2C) and the
soluble terminal complex SC5b-9 (Figure 2D), on the other hand, may originate by
activation of both the classical and the alternative pathways. Quantitation of iC3b was
used to estimate C3b generation since, once produced, C3b is rapidly inactivated by
Factor I in conjunction with either Factor H or CR1 as cofactors (26,27). As indicated in
Figure 2C, both ABri and ADan were able to generate iC3b in a dose-dependent manner.
The assembling of SC5b-9 shown in Figure 2D, determined by a widely used standard
method to assess complement activation (24,28), confirmed the ability of ABri and ADan
to in vitro trigger the complement cascade to full completion, including the terminal
stages. The terminal cytolytic C5b-9 complex generated by the assembly of C5b, C6, C7,
C8 and multiple C9 molecules in the absence of a target membrane (as in the case of
these experiments) binds to the naturally occurring serum S protein (vitronectin) resulting
in the formation of the soluble, non-lytic form of the MAC, SC5b-9. The data in Figure 2
also indicates that incubation of NHS with ABri and ADan peptides results in the
production of activation-generated fragments of the complement proteins C4 and C3 as
well as the complex SC5b-9 to levels comparable to those induced by incubation with
aggregated A 1-42, in agreement with the CH50 findings (Figure 2A). In addition, the
levels of SC5b-9 produced by incubation of A 1-42 with NHS confirm previously
reported data acquired under similar experimental conditions (29). Similarly to the results
obtained using the hemolytic assay, aggregated IgG produced a comparable level of
activation-generated fragments at a lower molar ratio. In the presence of EDTA, a
chelator of both Ca+2 and Mg+2 ions essential for the activation of the complement
cascade, none of the activation products C4d, iC3b and SC5b-9 were generated, as
expected (not shown).
Alternative pathway of Complement activation
The ability of the ABri and ADan peptides to trigger the alternative pathway was
assessed by measuring the generation of Bb by ELISA, a method that provides a direct,
specific indication of alternative pathway activation (30). As shown in Figure 3A both
ABri and ADan are able to induce the production of Bb to similar levels as A 1-42
following incubation with NHS. These values are significantly different from those
- 13 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
originated spontaneously by incubation of NHS with buffer in the absence of amyloid
peptides that are also shown in the figure for comparison purposes. Although the Bb
levels that result from incubation with the amyloid peptides are similar to those reported
in certain infectious pathological conditions that take place with activation of the
alternative pathway (31), they are significantly lower that those induced by incubation of
NHS with CVF, a potent activator of the pathway. CVF, a functional analog of human
C3b, forms stable C3/C5 convertases that are not inactivated by the plasma regulatory
proteins factor H and factor I. It binds factor B rendering it available for cleavage by
factor D and initiating in this way a potent alternative pathway activation.
To estimate the contribution of the alternative pathway to the total activation of
the complement system, we quantitated the levels of SC5b-generated by incubation of the
peptides with NHS under conditions in which both pathways are activated (presence of
Ca+2 and Mg+2 ions) and compared them with those originated by activation of the AP
only (presence of Mg+2/ EGTA or substitution of NHS by C1q depleted serum). As
shown in Figure 3B, whereas addition of EDTA resulted in complete absence of SC5b-9
corroborating that activation of the system is required to produce SC5b-9, the incubation
with Mg+2/EGTA reduced the levels to an average of 25%, 32%, and 31% of the total
values of SC5b-9 for ABri, ADan, and A 1-42, respectively. Corroborating these results,
incubation with C1q depleted serum reduced SC5b-9 levels to similar values (an average
of 35% for ABri, 24% for ADan, and 28% for A 1-42). Therefore, the classical pathway
appears to be the major route of activation of the complement system for all the amyloid
peptides tested here, representing 70-75% of the total activation while the alternative
pathway accounts for the remaining ~25-30%.
Complex formation with C1q
All the above data strongly suggested that the trigger of the complement cascade by ABri
and ADan mainly proceeds through the classical activation pathway, most likely through
a direct binding interaction of the peptides to C1q. In a set of solid phase binding
experiments, incubation of either ABri-, ADan-, or A 1-42-coated microtiter wells with
increasing concentrations of C1q (0-20 nM) resulted in a dose-response relationship that
reached saturation (Figure 4A). Non-linear regression analysis of the binding data
- 14 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
estimated the dissociation constants for ABri and ADan as 1.9 ± 0.4 nM and 1.2 ± 0.3
nM, respectively, within the same range to that of A 1-42 (Kd: 2.4 ± 0.5 nM). These
high affinity interactions correlated well with the pronounced capability of the amyloid
peptides to activate the classical complement cascade in hemolytic assays (Figure 2A). In
addition, these high affinity values suggested that the ABri or ADan peptides likely form
complexes with C1q. In vitro complex formation was performed in a 50-fold molar
excess of the peptides, to assure that most (if not all) the C1q was part of the complex.
To visualize the final product, we took advantage of the characteristic cathodic
electrophoretic mobility of C1q in agarose gels and the mostly anodic migration of the
peptides in the same system. As indicated in Figure 4B, Coomassie blue staining of the
PVDF-transferred material shows C1q (lane 2) with its characteristic cathodic migration,
matching the very end of the gamma region in the human serum profile shown for
comparison purposes (lane 1). When complexed with ABri or ADan, the electrophoretic
mobility shifted noticeable towards more anodic positions (lanes 3 and 4, respectively).
To corroborate the formation of the complexes, the bands were excised and subjected to
limited N-terminal sequence analysis. Three identifiable sequences were recovered in
each case (see Figure 4B for details); two sequences corresponded to the A and C chains
of C1q while the other matched the N-terminus of the ABri or the ADan peptides. No
sequence was retrieved for the B chain of C1q known to contain a blocked N-terminal
glutamine residue (pyrrolidone carboxylic acid) [Protein ID: P02746; Swiss-Prot
database of the Swiss Institute of Bioinformatics; http://www.expasy.org].
Mapping the complement-activation activity of ABri and ADan
In order to map the complement activating activity to a specific region of the ABri
and ADan molecules we employed synthetic peptides representing different regions of
the amyloid subunits in the CH50 hemolytic assay. The peptides tested consisted of the
common N-terminal region of the amyloid subunits (ABri /ADan1-23), as well as the C-
terminal fragments from both molecules ABri24-34 and ADan23-34. Since the molecular
mass of the peptides corresponding to different regions of the molecules differ
significantly, identical molar concentrations of the peptides were used in the experiments.
For comparison purposes, the molar concentrations of the full-length ABri and ADan
- 15 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
peptides used were equivalent to the peptide concentrations displayed in Figure 2 (e.g. 12
nmol/ml, 48 nmol/ml, and 120 nmol/ml, corresponding to 50, 200 and 500 µg/ml,
respectively). As indicated in Figure 5, both C-terminal fragments lack ability to activate
and consume complement proteins whereas the common N-terminal region of the
amyloid molecules retains the functional activity (27% at a concentration of 120 nmol/ml
for ABri/ADan1-23 compared to 18% for ABri and 23% for ADan). The localization of
the complement-activating site to the common N-terminal fragment correlates with the
similar behavior of both ABri and ADan peptides in inducing almost identical levels of
complement activation. In addition, the mapping of the complement-activating activity to
the ABri/ADan1-23 region correlates with the capacity of the N-terminal peptide to bind
C1q with almost identical affinity as the full-length peptides (ABri1-23 Kd: 1.45 ± 0.3
nM).
Peptide oligomerization and complement activation
An important element in the activation of the complement system by amyloid
peptides seems to be directly related to their degree of oligomerization. In our
experimental conditions, the activation of the classical pathway takes place with freshly
solubilized peptides, reaching complement activation values similar to those obtained
with 7-day aggregated A 1-42. In order to clarify this issue, we examined the secondary
structure and the oligomerization state of ABri and ADan peptides immediately after
solubilization and after 45-minutes incubation at 37oC, the incubation time required for
the hemolytic assays and the ELISA experiments. As shown in Figure 6A, full-length
ABri and ADan rendered CD spectra compatible with high -sheet content whereas the
respective C-terminal fragments (ABri24-34 and ADan23-34) showed a random coil
configuration suggesting a role for -sheet structure in the complement activating ability
of the peptides. Both peptides were already heavily aggregated at the starting conditions
(Figure 6 panels B and C, lanes 1) although the oligomerization was even more evident
after the incubation required for all the complement assays (panels B and C, lanes 2).
Similar results were observed with the N-terminal peptide ABri/ADan1-23 (not shown).
These findings indicate that the ABri/ADan peptides have a higher tendency to form
oligomers than A 1-42 and suggest a faster aggregation kinetics. Of note, although both
- 16 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
peptides share a similarly high -sheet content, ABri (panel B) seems to aggregate even
faster than ADan (panel C) as indicated by the presence of higher molecular mass
oligomers under the same experimental conditions. In spite of this apparently different
aggregation kinetics, both full-length peptides trigger complement activation to
practically the same extent suggesting that other factors besides the degree of
oligomerization (i.e. the secondary structure) play a role in the activation mechanism.
- 17 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
DISCUSSION
Although viewed for many years as an immune-privileged organ, the CNS
contains many immune system components among them proteins of the complement
system that are synthesized by astrocytes, microglia and neurons. Whereas the pathogenic
role of complement is well recognized in systemic disorders its contribution to
neurodegenerative diseases has only recently emerged. One of these pathologic entities in
which the activation of the complement system was studied in more detail is Alzheimer’s
disease, the most common form of human dementia. Proteins of the classical pathway
and their activation fragments - namely C1q, C3b, and C4b - as well as the terminal MAC
have all been identified in senile plaques, cerebrovascular amyloid deposits, and in
association with dystrophic neurites and neurofibrillary tangles, indicating that the
complete cascade can be fully triggered in vivo (4,5,23,32-35). Of note, the presence of
C5b-9 was demonstrated in AD but not in non-demented elderly control cortices (36),
suggesting that complement-induced injury and the chronic inflammation resulting from
the system activation may be at least partially responsible for the progression of the
disease. Although originally not described, both mRNA and proteins of the alternative
pathway have more recently been demonstrated in AD brains together with their specific
activation fragments (37). Our data demonstrates that in other unrelated
neurodegenerative disorders resulting in dementia – namely FBD and FDD - complement
proteins of both the classical and alternative pathways co-localize with parenchymal
plaques and cerebrovascular amyloid deposits, closely resembling the findings in AD.
Complement immunoreactivity in FBD and FDD was mainly associated with Congo
Red/Thioflavin positive amyloid deposits rather than Congo Red/Thioflavin negative
parenchymal pre-amyloid lesions.
Activation of the classical complement pathway in an antibody independent
manner was demonstrated for various non-immune substances such as C-reactive protein,
serum amyloid P component, DNA (38-40), amyloid A (23), and neurofibrillary tangles
(24). Aggregated A peptides in vitro are able to directly activate the classical
complement system both in fluid phase and immobilized onto solid matrices by binding
to the recognition component C1q (23,28,29,41). Our results indicate that both ABri and
ADan peptides are also able to induce activation of the classical complement system
- 18 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
through a similar mechanism. The data from the hemolytic assays, the quantitation of
activation fragments by ELISA, and the immunohistochemical analysis demonstrate that
both amyloid molecules can trigger the activation of the classical pathway and proceed to
the terminal stages with the in vitro and in vivo generation of the terminal MAC. Their
direct high affinity binding to C1q and the corresponding complexes formation achieved
under physiologic conditions strongly suggest that both peptides trigger the classical
pathway of complement activation mainly through direct interaction with the recognition
protein C1q.
Activation of the alternative pathway may be initiated by a variety of elements or
cellular surfaces including pathogenic bacteria, parasites, viruses and virus infected cells.
Different studies demonstrated some degree of in vitro activation of this pathway by A
aggregates leading to the production of the activation fragments C3b, which remained
covalently bound to the fibrillar A , as well as of the alternative pathway-specific Bb
fragment (29,42,43). The results presented here demonstrate that ABri and ADan are also
able to trigger the alternative pathway resulting in the production of Bb in comparable
levels to A 1-42. However, the classical pathway appears to be the major route of
activation of the complement system accounting for ~70-75% of the total activation as
indicated by the concentration of SC5b-9 generated under specific conditions for
alternative pathway activation. These findings coincide with previous reports for A
peptides in which 70% of the C3 convertase activity formed by incubation of aggregated
A 1-42 with NHS originated from the classical pathway (42).
The degree of oligomerization of the amyloid peptides represents an important
element in the activation of the complement system. In the case of AD, fibrillar or
aggregated A species activate complement in vitro while non-aggregated peptides do
not (28,43). Although both A 1-40 and A 1-42 are able to trigger the activation, on a
molar basis A 1-42 was found to be a more potent activator (41,43), a difference that
most likely reflects the ability of A 1-42 to aggregate more readily and at lower
concentrations than A 1-40 (44). In vivo, complement activation components co-localize
with parenchymal and vascular A amyloid deposits and are almost absent in the non-
fibrillar (pre-amyloid) lesions (3,45) and in “cotton wool” plaques seen in a variant form
of Alzheimer’s disease due to a deletion of exon 9 of presenilin 1 (46). In the case of
- 19 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
FBD and FDD, components of the complement activation cascade also co-localize with
fibrillar but not with non-fibrillar deposits in vivo. In vitro, ABri and ADan peptides
form spontaneous -sheet-rich structures that exhibit very fast aggregation kinetics,
modifying their degree of oligomerization even after the short incubation time required
for the various assays. Under these conditions, both peptides achieve complement
activation values similar to those obtained with 7-day aggregated A 1-42. Although both
ABri and ADan are able to activate complement in vitro to practically the same extent,
the in vivo accumulation of activation components in FDD parenchymal lesions is
significantly lower than in FBD parenchymal deposits. This most likely reflects the fact
that FDD parenchymal lesions are mainly of pre-amyloid, non-fibrillar nature (Congo-
Red negative) and thus unable to achieve high levels of complement activation, as
demonstrated by the in vitro studies. In spite of their similarities FBD and FDD present
striking differences in their respective CNS pathology including the more severe
neocortical involvement in FDD and the nature of most of the hippocampal and
neocortical lesions showing features of amyloid in FBD (11) and of preamyloid in FDD
(10). The difference in the aggregation/fibrillization state between these two types of
lesions with the concomitant difference in their ability to activate the complement system
most likely accounts for the different topographical distribution of associated
complement proteins. Aggregated/fibrillar deposits translate in the presence of activation
derived components in association with vascular amyloid in both diseases and with FBD
parenchymal amyloid plaques, and in their absence in non-fibrillar lesions. However, the
paucity of complement-derived proteins observed in the parenchymal, preamyloid lesions
in FDD suggests that activation of the complement system may not be the only critical
factor in neurodegeneration. This is also supported by similar observations in the cotton
wool variant of familial AD, in which the characteristic morphological feature is the
presence of plaques largely composed of Congo red negative preamyloid A species
unassociated with complement activation (46-48).
The importance of inflammation in neurodegenerative processes, in particular in
Alzheimer’s disease, has become clear over the last years. The presence of dementia
invariably correlates with the detection of inflammatory markers, activated microglia and
reactive astrocytes, and increased levels of cytokines and complement products around
- 20 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
amyloid plaques and dystrophic neurites (3). Epidemiological studies have found that
anti-inflammatory drugs reduce the risk of AD (49) while animal models of sustained
CNS inflammation loose cholinergic nerve cells in the hippocampus and exhibit memory
and learning impairments (50,51). These findings, together with the in vitro
demonstration that complement activation can lead to cell death in both rat hippocampal
and neuronal cell lines (52,53) point to the importance of chronic inflammation in the
pathogenesis of AD dementia. Supporting this notion, complement activation products
and inflammatory mediators have also been found in Down’s syndrome in association
with A amyloid deposits (54) and in animal models of AD (55). Immune and
inflammatory responses in the CNS are also observed in other chronic and acute
neurological conditions among them multiple sclerosis, myasthenia gravis, head trauma
and stroke, as well as in animal models of some of these disorders (3,7,56,57).
Complement activation proteins have been also demonstrated in association with Lewy
and Pick bodies in Parkinson and Pick’s disease, respectively (58,59), with dystrophic
neurites and early stage extracellular neurofibrillary tangles in the Parkinsonism-
dementia complex of Guam (60), with clusters of degenerating axons in amyotrophic
lateral sclerosis (61) as well as around AL and TTR amyloid deposits in peripheral nerves
in both acquired and hereditary neuropathy (51,62). In Creutzfeldt-Jacob and Gerstmann-
Straussler-Scheinker diseases (63), complement activation products have been found
associated with amyloid plaques, and it has been recently demonstrated that the
complement system plays a role in the early prion pathogenesis in transmissible
spongiform encephalopathies (64,65). In this case, follicular dendritic cells participate in
the prion replication before the infective agent moves through the nerves into the spinal
cord or brain stem, and finally into the brain. Mice bearing deficiencies of either one of
the early complement factors or complement receptors present significant delays in both
the onset of disease symptoms and the splenic accumulation of the pathological prion
protein following injection of infective scrapie strains indicating that activation of
complement is most likely involved in the initial trapping of prions in lymphoreticular
organs.
The activation of the complement system demonstrated in all these neurological
diseases and the concomitant generation of opsonins and anaphylotoxins that drive
- 21 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
numerous inflammatory mechanisms, including scavenger cell activation, chemotaxis,
frustrated phagocytosis, and the secretion of cytokines, chemokines and reactive oxygen
and nitrogen species (1) may contribute to some of the neuropathological features of the
different disorders. Our studies suggest that the chronic inflammatory response generated
by the amyloid peptides in vivo might be a contributing (although not the solely
responsible) factor to the pathogenesis of FBD and FDD and, in more general terms, to
other neurodegenerative disorders. Therapeutics directed toward controlling complement
activation to prevent or ameliorate the course of the disease may provide a useful
approach in the management of these pathological entities.
- 22 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
ACKNOWLEDGEMENTS
Supported by National Institute of Health grants AG05891, AG08721, NS38777, the
Alzheimer’s Association, the Brain Research Trust and CRDC of RF and NCMS-UCLH.
- 23 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
FIGURE LEGENDS
Figure 1: Immunohistochemical identification of complement activation products in
FBD (panels A-E) and FDD (Panels F-J). In the FBD case used for illustration the age
at death was 68 years preceded by an 11-year-long period of cognitive decline. The FDD
patient, whose case is demonstrated, died at age of 43 years and had dementia in the final
3 years of life. Deposition of ABri (antibody 338) and ADan (antibody 5282) in blood
vessels and parenchymal lesions in the hippocampus of FBD and FDD cases is shown in
panels A and F, respectively. In both FBD (panels B-E) and FDD (panels G-J) the anti-
C1q, anti-C4d, anti-C5b-9 neoepitope, and anti-Bb antibodies prominently label amyloid
depositing in blood vessels, including small arteries and arterioles (arrow) as well as
capillaries (double arrows) with a staining pattern similar to that seen in ABri and ADan
immunohistochemistry. While in FBD the parenchymal amyloid lesions are also strongly
labeled with the anti-complement antibodies, in FDD the primarily preamyloid deposits
(arrowhead) are either negative or much less intense stained. Scale bar represents 100
µm on panels A-D and F-I and inserts on panels B, C, D, E (top left) and G. On panels E
and J and in the inserts of panels E (bottom right), H and I it denotes 50 µm.
Figure 2: Classical complement pathway activation by ABri and ADan peptides.
Constant volumes (10 µl) of reference NHS were separately incubated for 45 min at 37oC
with 10 µl of ABri, ADan and A 1-42 solutions containing increasing concentrations (0-
1000 µg/ml TBS) of the amyloid peptides. The serum was immediately analyzed for total
hemolytic activity (EZ diagnostic kit; Diamedix Corporation, Miami, FA) and
quantitation of complement activation products by capture ELISA (Quidel, Inc.,
Mountain View, CA). In all cases, for comparison purposes, the complement activation
induced by incubation of NHS with identical concentrations of aggregated IgG is also
shown. Panel A: Remaining complement hemolytic activity (CH50). Results are
expressed as percentage of lysis compared to controls of 100% complement activity (no
complement consumption) in which NHS was incubated with Tris-buffered saline in the
absence of amyloid peptides. The data displayed represent the mean ± SD of seven
independent experiments. Panel B: Generation of C4d. Panel C: Generation of iC3b. D.
Generation of SC5b-9. In all the ELISA studies results represent mean ± SD of three
- 24 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
independent experiments. In all cases peptide final concentrations are: :0 µg/ml; : 50
µg/ml; : 200 µg/ml; :500 µg/ml
Figure 3. Activation of the alternative pathway by ABri and ADan peptides.
Panel A: Generation of Bb. To determine activation of the alternative pathway, NHS was
incubated for 45 min at 37 oC with ABri, ADan, and A 1-42 peptides at a concentration
that resulted in maximum classical pathway activation (final concentration: 500 µg/ml).
The concentration of Bb was subsequently assessed by ELISA employing Bb quantitation
kit (Quidel, Inc.) as described in Methods. For comparison purposes the levels of Bb
produced by incubation of NHS with CVF and in the absence of any activators, are also
indicated. Results show mean ± SD of three independent experiments. Panel B:
Generation of SC5b-9. To estimate the contribution of the classical and alternative
pathways to the total complement activation, ABri, ADan, and A 1-42 peptides (500
µg/ml) were incubated with NHS i) under conditions in which both pathways are active
(presence of Ca+2 and Mg+2 ions), ii) under conditions in which only the alternative
pathway may be activated (presence of Mg+2 ions/ EGTA), iii) in the presence of EDTA
in which no complement activation takes place. Additionally the peptides were incubated
in the presence Ca+2 and Mg+2 ions but substituting NHS with C1q depleted serum to
corroborate the activation induced by the alternative pathway. In all cases the
concentration of SC5b-9 produced was analyzed by ELISA. Results represent mean ± SD
of two independent experiments. : EDTA; : Ca+2 / Mg+2; : Mg+2/ EGTA; : C1q
depleted serum.
Figure 4: ABri- and ADan-C1q complexes formation. Panel A: Binding isotherm.
ELISA microtiter wells were coated with 400 ng of ABri1-34, ADan1-34 and A 1-42
peptides and incubated for 1 hour at room temperature with increasing concentrations (0-
20 nM in TBS) of C1q. Bound C1q was detected with goat polyclonal anti-C1q antiserum
(Quidel, Inc.; 1/1000 in TBST) followed by alkaline phosphatase labeled swine anti-goat
IgG (BioSource International; 1/5000 in TBST). The reaction was developed with p-
nitrophenyl phosphate and the Absorbance at 405 nm quantitated. Data represent the
- 25 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
means ± SD of three independent experiments performed in duplicate. Binding data were
analyzed by non-linear regression using GraphPad Prism (GraphPad Software, Inc.).
ABri; ADan; A . Panel B: ABri-C1q and ADan-C1q complex formation. C1q was
incubated with either ABri or ADan peptides in the presence of Ca+2 and Mg+2 as
described in Material and Methods. The resulting complexes were separated by
electrophoresis on 1% agarose gels, transferred to PVDF membranes, stained with
0.125% Coomassie Blue R-250, and the bands of interest were subjected to N-terminal
sequencing. Lane 1: NHS used as a control for the electrophoretic separation on agarose;
lane 2: purified C1q; lane 3: ABri-C1q complex; lane 4: ADan-C1q complex. The amino
acid sequences yielded by the different bands are shown in one letter code. In both ABri-
C1q and ADan-C1q complexes, the N-terminal sequences corresponded to those of the A
and C chains of the C1q in addition to the N-terminal of the ABri or ADan peptides,
respectively. No sequence information was retrieved for the B chain of C1q that begins
with a blocked N-terminal glutamine.
Figure 5: Localization of the complement-activating site within ABri and ADan
molecules. To promote complement activation, NHS was incubated with increasing
concentrations (0-120 nmol/ml in TBS) of the full-length ABri and ADan amyloid
peptides, the common N-terminal 1-23 peptide, and the C-terminal fragments of both
molecules ABri 24-34 and ADan 24-34. The remaining total complement lytic activity
(CH50) was assessed as described in Figure 2A. Since the molecular mass of the
peptides corresponding to different regions of the molecules differ significantly,
identical molar concentrations of the peptides were tested. For comparison purposes, the
molar concentrations of the full-length ABri and ADan peptides employed are
equivalent to those in Figure 2A (e.g. 12, 48, and 120 nmol/ml corresponds to 50, 200,
and 500 µg/ml, respectively. : 0 nmol/ml; : 12 nmol/ml; : 48 nmol/ml; :120
nmol/ml. Results represent the mean ± SD of three independent experiments.
Figure 6: Peptide oligomerization and complement activation. Panel A: Circular
dichroism spectrometry in the far u.v. (190 to 250 nm) of ABri and ADan peptides. Both
full-length peptides exhibit similar -sheet rich structure whereas the C-terminal
- 26 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
fragments ABri24-34 and ADan23-34 show random coil configuration. Dotted lines: C-
terminal fragments; solid lines: full-length peptides. Red color: ABri; Blue color: ADan.
Panels B and C: The degree of aggregation of ABri (Panel B) and ADan (Panel C)
peptides employed in the complement activation assays was assessed by Western Blot
analysis after SDS-PAGE. The synthetic peptides either immediately after solubilization
(lanes 1) or following incubation 45 min at 37oC under the same conditions employed to
determine their ability to activate the complement proteins (lanes 2) were loaded on 16%
Tris-tricine gels, transferred to Immobilon-P membranes and analyzed as described in
Methods. The fluorograms showed were developed by ECL.
- 27 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
REFERENCES
1. Akiyama, H., Barger, S., Barnum, S., Bradt, B., Bauer, J., Cole, G. M., Cooper, N. R., Eikelenboom, P., Emmerling, M. R., Fiebich, B. L., Finch, C., Frautschy, S., Griffin, W. S. T., Hampel, H., Hull, M., Landreth, G., Lue, L.-F., Mrak, R. E., Mackenzie, I. R., McGeer, E. G., O'Banion, M. K., Pachter, J., Pasinetti, G. M., Plata-Salaman, C., Rogers, J., Rydel, R., Shen, Y., Streit, W., Strohmeyer, R., Tooyama, I., Van Muiswinkel, F. L., Veerhuis, R., Walker, D. G., Webster, S., Wegrzyniak, B., Wenk, G., Wyss-, and Coray, T. (2000) Neurobiol. Aging 21, 383-421
2. Eikelenboom, P., Biewenga, J., Rozemuller, M., Kraal, G., Stam, F. C., McBride, P. A., Bruce, M. E., and Frazer, H. (1991) Virchows Arch. B Cell Pathol. 60, 329
3. Emmerling, M. R., Watson, M. D., Raby, C. A., and Spiegel, K. (2000) Biochim.
Byophys. Acta 1502, 158-171
4. Eikelenboom, P., and Stam, F. C. (1982) Acta neuropathol. 57, 239
5. Berkenbosch, F., Biewenga, J., Bouns, M., Rozemuller, M., Strijbos, P., and van Dam, A. (1992) Res. Immunol. 143, 657
6. Thiel, s., Vorup-Jensen, T., Stover, C. M., Schwaeble, W., Laursen, S. B., Poulsen, K., Willis, A. C., Eggleton, P., Hansen, S., Holmskov, U., Reid, K. B., and Jensenius, J. C. (1997) Nature 386, 506-510
7. Tenner, A. J. (2001) Neurobiol. Aging 22, 849-861
8. Morgan, B. P. (2000) Complement Methods and Protocols, 2000 Ed. Methods in Molecular Biology, Humana Press, Totowa, New Jersey
9. Mead, S., James-Galton, M., Revesz, T., Doshi, R. B., Harwood, G., Pan, E. L., Ghiso, J., Frangione, B., and Plant, G. (2000) Brain 123, 975-986
10. Holton, J., Lashley, T., Ghiso, J., Braendgaard, H., Vidal, R., Guerin, C., Gibb, G., Hanger, D. P., Rostagno, A., Anderton, B., Strand, C., Ayling, H., Plant, G., Frangione, B., Bojsen-Moller, M., and Revesz, T. (2002) J. Neuropathol. Exp.
Neurol. 61, 254-267
11. Holton, J., Ghiso, J., Lashley, T., Rostagno, A., Guerin, C., Gibb, G., Houlden, H., Ayling, H., Martinian, L., Anderton, B., Wood, N., Vidal, R., Plant, G., Frangione, B., and Revesz, T. (2001) Am. J. Pathology 158, 515-526
12. Vidal, R., Frangione, B., Rostagno, A., Mead, S., Revesz, T., Plant, G., and Ghiso, J. (1999) Nature 399, 776-781
13. Ghiso, J., Revesz, T., Holton, J., Rostagno, A., Lashley, T., Houlden, H., Gibb, G., Anderton, B., Bek, T., Bojsen-Moller, M., Wood, N., Vidal, R., Braendgaard, H., Plant, G., and Frangione, B. (2001) Amyloid: J. Protein Folding Disord. 8, 277-284
- 28 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
14. Vidal, R., Revesz, T., Rostagno, A., Kim, E., Holton, J., Bek, T., Bojsen-Moller, M., Braendgaard, H., Plant, G., and Frangione, B. (2000) Proc. Natl. Acad. Sci. USA 97, 4920-4925
15. Saido, T., Yamao-Harigaya, W., Iwatsubo, T., and Kawashima, S. (1996) Neuroscience Letters 13, 173-176
16. Mori, H., Takio, k., Ogawara, M., and Selkoe, D. (1992) J. Biol. Chem. 267, 17082-17086
17. Tekirian, T., Saido, T., Markesbery, W., Russell, M., Wekstein, D., Patel, E., and Geddes, J. (1998) J. Neuropathol. Exp. Neurol. 57, 76-94
18. Matsubara, E., Frangione, B., and Ghiso, J. (1995) J. Biol. Chem. 270, 7563-7567
19. Miravalle, L., Tokuda, T., Chiarle, R., Giaccone, G., Bugiani, O., Tagliavini, F., Frangione, B., and Ghiso, J. (2000) J. Biol. Chem. 275, 27110-27116
20. Salvarrey, M., and Rostagno, A. (1989) Clin. Exp. Immunol. 76, 92-96
21. Wener, M. H. (1997) in Manual of Clinical Laboratory Immunolology (Rose, N. R., Conway de Macario, E., Folds, J. D., Lane, H. C., and Nakamura, R. M., eds), 1997 Ed., pp. 208-216, American Society of Microbiology, Washington, D. C.
22. Parker, C. J. (1999) in Current Protocols in Immunology (Cologan, J. E., Kruisbeek, A. M., Margulies, D. H., Shevach, E. M., and Strober, W., eds) Vol. 3, pp. 13.15.17-13.15.10, 3 vols., John Wiley and Sons, Inc., New York, NY
23. Rogers, J., Cooper, N. R., Webster, S., Schultz, J., McGeer, P. L., Styren, S. D., Civin, W. H., Brachova, L., Bradt, B., Ward, P., and Lieberburg, I. (1992) Proc. Natl.
Acad. Sci. USA 89, 10016
24. Shen, Y., Lue, L.-F., Yang, L.-B., Roher, A., Kuo, Y.-M., Strohmeyer, R., Goux, W. J., Lee, V., johnson, G. V. W., Webster, S., Cooper, N. R., Bradt, B., and Rogers, J. (2001) Neuroscience Letters 305, 165-168
25. Nagasawa, S., Ichihara, D., and Stroud, R. M. (1980) J. Immunol. 125, 578
26. Ross, G. D., and Medof, M. E. (1985) Adv. Immunol. 37, 217
27. Weiler, J. M., Daha, M. R., Austen, K. F., and Fearon, D. T. (1976) Proc. Natl. Acad.
Sci. USA 73, 3268
28. Webster, S., Bradt, B., Rogers, J., and Cooper, N. (1997) J. Neurochem. 69, 388-398
29. Bradt, B., Kolb, W. P., and Cooper, N. R. (1998) J. Exp. Med. 188, 431-438
- 29 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
30. Rabson, A. R. (1997) in Manual of Clinical Laboratory Immunology (Rose, N. R., Conway de Macario, E., Folds, J. D., Lane, H. C., and Nakamura, R. M., eds), 1997 Ed., pp. 187-191, American Society of Microbiology, Washington, D. C.
31. Narkio-Makela, M., Hellwage, J., TAhkokallio, O., and Meri, S. (2001) Clin.
Immunol. 100, 118-126
32. Ishii, T., and Haga, S. (1984) Acta neuropathol. 63, 296
33. McGeer, P. L., Akiyama, H., Itagaki, S., and McGeer, E. G. (1989) Can. J. Neurol.
Sci. 16, 516
34. Rozemuller, M., Bots, G. T., Roos, R. A., and Eikelenboom, P. (1992) Neurosc. Lett. 140, 137-140
35. Verbeek, M. M., Otte-Holler, I., Veerhuis, R., and Ruiter, D. J. (1998) Acta
Neuropathol. 96, 628-636
36. Webster, S., Lue, L.-F., Brachova, L., Tenner, A. J., McGeer, E. G., Terai, K., Walker, D. G., Bradt, B., Cooper, N. R., and Rogers, J. (1997) Neurobiol. Aging 18, 415-421
37. Strohmeyer, R., Shen, Y., and Rogers, J. (2000) Molec. Brain Res. 81, 7-18
38. Jiang, H., Cooper, B., Robey, F. S., and Gewurz, H. (1992) J. Biol. Chem. 267, 25597
39. Jiang, H., Robey, F. S., and Gewurz, H. (1992) J. Exp. Med. 175, 1373
40. Ying, S.-C., Gewurz, A. T., Jiang, H., and Gewurz, H. (1993) J. Immunol. 150, 169
41. Jiang, H., Burdick, D., Glabe, C. G., Cotman, C. W., and Tenner, A. J. (1994) J.
Immunol. 152
42. Emmerling, M. R., Spiegel, K., and Watson, M. D. (1997) Immunopharmacology 38, 101-109
43. Watson, M. D., Roher, A., Kim, K. S., Spiegel, K., and Emmerling, M. R. (1997) Amyloid: J. Protein Folding Disord. 4, 147-156
44. Jarrett, J. T., Berger, E. P., and Lansbury, P. T. (1993) Ann. New York Acad. Sci. 695, 144-148
45. Afgah, A., Cummings, B. J., Cribbs, D. H., Cotman, C. W., and Tenner, A. J. (1996) Exp. Neurol. 138, 22-32
46. Crook, R., Verkkoniemi, A., Perez-Tur, J., Mehta, N., Baker, M., Houlden, H., Farrer, M., Hutton, M., Lincoln, S., Hardy, J., Gwinn, K., Somer, M., Paetau, A., Kalimo, H., Ylikoski, R., Poyhonen, M., Kucera, S., and Haltia, M. (1998) Nature Med. 4, 452-455
- 30 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
47. Steiner, H., Revesz, T., Neumann, M., Romig, H., Grim, M. G., Pesold, B., Kretzschmar, H. A., Hardy, J., Holton, J., Baumeister, R., Houlden, H., and Haass, C. (2001) J. Biol. Chem. 276, 7233-7239
48. Houlden, H., Baker, M., McGowan, E., Lewis, P., Hutton, M., Crook, R., Wood, N., Kumar-Singh, S., Geddes, J., Swash, M., Scaravilli, F., Holton, J., Lashley, T., Tomita, M., Hashimoto, T., Verkkoniemi, A., Kalimo, H., Somer, M., Paetau, A., Martin, J. J., Van Broeckhoven, C., Golde, T. E., Hardy, J., Haltia, M., and Revesz, T. (2000) Ann. Neurol. 48, 806-808
49. Rogers, J., Kirby, L. C., Hempelman, S. R., Berry, D. L., McGeer, P. L., Kaszniak, A. W., Zalinski, J., Cofield, M., Mansukhani, L., and Willson, P. (1993) Neurology 43, 1609-1611
50. Hauss-Wegrzyniak, B., Dobrzanski, P., Stoehr, J. D., and Wenk, G. (1998) Brain Res. 780, 294-303
51. Heyser, C. J., Masliah, E., Samimi, A., Campbell, I. L., and Gold, L. H. (1997) Proc.
Natl. Acad. Sci. USA 94, 1500-1505
52. Schultz, J., Schaller, J., McKinley, M., Bradt, B., Cooper, N., May, P., and Rogers, J. (1994) Neurosc. Lett. 175, 99-102
53. Shen, Y., Halperin, J. A., and Lee, C.-M. (1995) Brain Res. 671, 282-292
54. Stoltzner, S. E., Grenfell, T. J., Mori, C., Wisniewski, K. E., Wisniewski, T. M., Selkoe, D., and Lemere, C. A. (2000) Am. J. Pathology 156, 489-499
55. Matsuoka, Y., Picciano, M., Malester, B., LaFrancois, J., Zehr, C., Daeschner, J.-A. M., Olschowka, J. A., Fonseca, M. I., O'Banion, M. K., Tenner, A. J., Lemere, C. A., and Duff, K. (2001) Am. J. Pathology 158, 1345-1354
56. Spiegel, K., Barnum, S., and Emmerling, M. R. (1997) (Wood, P. L., ed), pp. 129-176, Humana Press, Totowa, NJ
57. Gasque, P., Dean, Y. D., McGreal, E. P., VanBeek, J., and Morgan, B. P. (2000) Immunopharmacology 49, 171-186
58. Iseki, E., Marui, W., Akiyama, H., Ueda, K., and Kosaka, K. (2000) Neurosc. Lett. 286, 69-73
59. Yasuhara, O., Aimi, Y., McGeer, E. G., and McGeer, P. L. (1994) Brain Res. 652, 346-349
60. Schwab, C., Steele, J. C., and McGeer, P. L. (1997) Acta Neuropathol. 94, 486-492
61. Kawamata, T., Akiyama, H., Yamada, T., and McGeer, P. L. (1992) Am. J. Pathology 140, 691-707
- 31 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
62. Haffer-Macko, C., Dyck, P., and Koski, C. (2000) J. Peripheral Nervous System 5, 131-139
63. Ishii, T., Haga, S., Yagishita, S., and Tateishi, J. (1984) Appl. Pathol. 2, 370-379
64. Mabbott, N. A., Bruce, M. E., Botto, M., Walport, M. J., and Pepys, M. B. (2001) Nature Med. 7, 485-487
65. Klein, M. A., Kaeser, P. S., Schwarz, P., Weyd, H., Xenarios, I., Zinkernagel, R. M., Carroll, M. C., Verbeek, J. S., Botto, M., Walport, M. J., Molina, H., Kalinke, U., Acha-Orbea, H., and Aguzzi, A. (2001) Nature Medicine 7, 488-492
- 32 -
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
- 33 -
Table I: List of the antibodies used for immunohistochemical studies
Antibody Dilution Species Paraffin/frozen sections
& pretreatment
Source
5282 (anti-ADan) 1:1000 Rabbit anti-human
Paraffin Formic Acid 99% for 10 minutes
Reference 14
338 (anti-ABri) 1:2000 Rabbit anti-human
Paraffin Formic Acid 99% for 10 minutes
Reference 12
anti-C1q 1:100 Rabbit anti-human
Paraffin Trypsin 15 minutes
Dako
anti-C4d 1:1000 Mouse anti-human
Frozen section fixed in acetone Quidel
anti-C5b-9 1:50 Rabbit anti-human
Frozen section fixed in acetone Quidel
anti-Bb 1:50 Mouse anti-human
Frozen section fixed in acetone Quidel
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
F
G
A
B
C
D
E
H
I
J
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
0
20
40
60
80
100
ABri ADan A 42 aggIgG
Rem
ain
ing C
H50
(%
of
contr
ol)
A
0
10
20
30
ABri ADan A 42 aggIgGC
4d
ge
ne
rati
on
(g/m
l)
B
0
100
200
300
400
ABri ADan A 42 aggIgG
C3
bi
ge
ne
rati
on
(g/m
l)
C
0
5
10
15
20
ABri ADan A 42 aggIgG
SC
5b
-9 g
en
era
tio
n(
g/m
l)
D
Figure 2
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
A
B
ABri ADan Aβ1−420
5
10
SC
5b
-9 g
e
(g
/ml)
15
20
ne
rate
d
50
100
150
200B
b g
en
era
ted
(g
/ml)
0ADan Aβ1-42Buffer ABri CVF
Figure 3
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
A
0 5 10 15 200.0
0.2
0.4
0.6
0.8
1.0
Kd ABri = 1.9± 0.4 nΜKd ADan = 1.2± 0.3nΜKd Aβ42 = 2.4± 0.5 nΜ
C1q added (nM)
A 4
05 n
m
B
EDLXRAPDGK
NTGXYGIPGM
EASNXFAIXX ABri
1
1
C1q (A and C chains)
EDLXRAPDGK
NTGXYGIPGM
EASNXFAIRX ADan
1
1
1 2 3 4
C1q (A and C chains)
Figure 4
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
������������������������������������������������
������������������������������������������������
������������������������������������������������������
�����������������������������������������������������������������
������������������������������������������������������������������������
������������������������������������������������������������������
������������������������������������������������������������
������������������������������������������������������������������������
������������������������������������������������������������������������
������������������������������������������������������������������������
ABri ADan ABri1-23ABri-Ct ADan-Ct
0
20
40
60
80
100
120
Rem
ain
ing C
H50
(%
of contr
ol)
Figure 5
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
A
-50
20
-40
-20
0
190 250200 220 240
CD
[m
deg
]
Wavelength [nm]
1 2
3
6.5
14
21.5
30
46
B1 2
3
6.5
14
21.5
30
46
C
Figure 6
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
C1q
C4d
Alzheimer
C5b-9
Bb
Aβ
C1q
Normal
C4d
C5b-9
Bb
Antibodies to C1q, C4d, C5b-9 and Bb label Aβ-positive lesions in Alzheimer’s disease, but not in normal controls. Scale bar on panels A, B and E-H represents 100µm, while on panels C, D and I it represent 200 µm.
A
B
C
D
E
F
G
H
I
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
Frangione and Jorge GhisoMagnotti, Hans Braendgaard, Gordon Plant, Marie Bojsen-Moller, Janice Holton, Blas
Agueda Rostagno, Tamas Revesz, Tammaryn Lashley, Yasushi Tomidokoro, Lauradisease
Complement activation in chromosome 13 dementias: Similarities with Alzheimer's
published online October 17, 2002J. Biol. Chem.
10.1074/jbc.M206448200Access the most updated version of this article at doi:
Alerts:
When a correction for this article is posted•
When this article is cited•
to choose from all of JBC's e-mail alertsClick here
by guest on Decem
ber 11, 2020http://w
ww
.jbc.org/D
ownloaded from
top related