expression and characterization of hiv type 1 envelope protein associated with a broadly reactive...
Post on 30-Mar-2017
212 Views
Preview:
TRANSCRIPT
AIDS RESEARCH AND HUMAN RETROVIRUSESVolume 15, Number 6, 1999, pp. 561± 570Mary Ann Liebert, Inc.
Expression and Characterization of HIV Type 1 EnvelopeProtein Associated with a Broadly Reactive Neutralizing
Antibody Response
GERALD V. QUINNAN, JR.,1 PENG FEI ZHANG,1 DA WEI FU,1,2 MING DONG,1
HARVEY J. ALTER,3 and INTERNATIONAL COLLABORATORS4
ABSTRACT
We have studied envelope protein from a donor with nonprogressive HIV-1 infection whose serum containsbroadly cross-reactive, primary virus NA. DNA was extracted from lymphocytes, which had been collectedapproximately 6 and 12 months prior to the time of collection of the cross-reactive serum, and env genes weresynthesized, cloned, expressed on pseudoviruses, and phenotyped in NA assays. Two clones from each timepoint had identical V3 region nucleotide sequences, utilized CCR5 but not CXCR4 for cell entry, and hadsimilar reactivities with reference sera. Analysis of the full nucleotide sequence of one clone (R2) demonstratedit to be subtype B and have normal predicted glycosylation. R2 pseudovirus was compared with others ex-pressing env genes of various clades for neutralization by sera from U.S. donors (presumed or known sub-type B infections), and from individuals infected with subtypes A, C, D, E, and F viruses. Neutralization bythe U.S. sera of R2 and other clade B pseudoviruses was low to moderate, although R2 was uniquely neu-tralized by all. R2 was neutralized by 3/3, 3/3, 2/5, 5/8, and 3/4 clade A, C, D, E, and F sera, respectively. R2and a clade E pseudovirus were neutralized by largely complementary groups of sera, potentially definingtwo antigenic subgroups of HIV-1. The results suggest that the epitope(s) that induced the cross-clade reac-tive NA in donor 2 may be expressed on the R2 envelope.
561
INTRODUCTION
THE TARGET OF HIV-1 neutralizing antibodies (NAs) is the
envelope glycoprotein complex. This complex is a multi-
meric structure composed of three or four copies each of the
gp120 surface and gp41 transmembrane glycoproteins.1 There
are a number of neutralization domains on each of the three or
four heterodimeric components of the complex.2±9 The amino
acid compositions of the proteins vary substantially from strain
to strain. Some of the neutralization domains are in regions that
tend to vary greatly, while others are in regions that tend to be
highly conserved. The variable neutralization domains include
those in variable (V) regions 1, 2, and 3 of gp120, while the
conserved domains include the primary receptor-binding site,
and other epitopes in gp120 and gp41. Amino acid sequence
variation is undoubtedly the explanation for the variation that
is seen in specificity of neutralization sensitivity among virus
strains. However, it has not been possible to classify antigenic
subtypes of HIV-1 based on genetic analyses, and various re-
gions of the envelope complex even outside of the neutraliza-
tion domains have been shown to contribute to antigenic vari-
ability.10,11 Findings indicate that the neutralization of primary
isolates of HIV may be mediated primarily by antibodies
directed against non-V3 region epitopes expressed on the
1Division of Tropical Public Health, Department of Preventive Medicine and Biometrics, Uniformed Services University of the Health Sci-ences, Bethesda, Maryland 20814.
2Present address: National Vaccine and Serum Institute, Beijing, China.3Department of Transfusion Medicine, Clinical Center, National Institutes of Health, Bethesda, Maryland 20892.4International Collaborators who contributed to this study included the following: J. Mascola, U.S. Military HIV Research Program; HIVNET
Investigators S. Allen (Birmingham, AL), J. Ellner (Cleveland, OH), K. Nelson (Baltimore, MD), and H. Sheppard (Berkeley, CA); and G. Fran-cis, UNAIDS Program, London, England.
oligomeric complex but not on monomeric gp120, while labo-
ratory-adapted strains are more readily neutralized by antibod-
ies directed against V3.12,13 The identity of the non-V3 epitopes
recognized on primary isolates is not established. The presence
of antibodies that have broadly neutralizing activity against pri-
mary isolates of many subtypes of HIV-1 in sera from infected
people is unusual, but the nature of the envelope proteins in in-
dividuals with such antibodies may be of interest for defining
the epitopes that may be broadly immunogenic in vaccines. This
article describes the cloning of envelope genes from such an
individual and the characterization of the envelope protein ex-
pressed.14,15
MATERIALS AND METHODS
Reference serum donor envelope gene cloning
The donor of the HIV-1 Neutralizing Serum (2) (Reference
2), available through the National Institutes of Health (NIH)
AIDS Research and Reference Reagent Program (Bethesda,
MD; Catalog No. 1983; provided by L. Vujcic and G. Quin-
nan), is a participant in a long-term cohort study at the Clini-
cal Center of the NIH (this serum has been referred to as
ª FDA2º ).14 The blood used to prepare Reference 2 had been
collected in the spring of 1989. Peripheral blood mononuclear
cells that had been cryopreserved from donations obtained ap-
proximately 6 months and 1 year prior to the time of Reference
2 collections were used as sources of DNA for env gene cloning.
The cells had not been stored to maintain viability. DNA was
extracted using phenol±chloroform from approximately 1±3 3106 cells from each donation.16 The DNA was used as template
in a nested polymerase chain reaction, similar to that described
previously, except that rTth was used as the DNA polymerase,
following the manufacturer instructions.17,18 The DNA was
cloned into the expression vector pSV7d, as previously de-
scribed.16,19
Other env gene clones and virus pools
The following HIV-1 env clones in the expression vector
pSV3 were obtained from the AIDS Research and Reference
Reagent Program, to which they had been provided by F. Gao
and B. Hahn: 93MW965.26 (clade C), 92RW020.5 (clade A),
92UG975.10 (clade G), and 93TH966.8 (clade E).20 The pro-
duction of env clones from the molecular virus clones NL4-
3, AD8, and SF162 has been previously described.16,21±23 env
gene of the Z2Z6 strain was cloned similarly, using molecu-
lar virus clone plasmid as template in the polymerase chain
reaction, and cloning the genes into the plasmid pSV7d.24
The production of primary isolate env clones from partici-
pants in the Multicenter AIDS Cohort Study, designated here
P9 and P10, has also been previously described.16 P9 and P10
virus pools were prepared by single subpassages of the cell
culture medium from primary cultures in phytohemagglutinin
(PHA)-stimulated blasts.16 The use of molecular virus clones
for preparation of virus pools of NL4-3 in H9 cells, and of
NL(SF162) and AD8 in PHA blasts, has also been previously
described.16
Cell cultures
The H9 cell line was obtained from R. Gallo.25 The Molt 3
cell line was obtained from the American Type Culture Col-
lection (ATCC, Rockville, MD).26 The HOS cell lines ex-
pressing CD4 and various coreceptors for HIV-1 were obtained
from the NIH AIDS Research and Reference Reagent Program
(provided by N. Landau), as was the PM1 cell line (provided
by P. Lusso and M. Reitz).27±29 The 293T cell line was ob-
tained from the ATCC, with permission from the Rockefeller
Institute.30 The H9, Molt 3, and PM1 cell cultures were main-
tained in RPMI 1640 medium supplemented with 10% fetal
bovine serum and antibiotics (GIBCO, Grand Island, NY). The
HOS and 293T cells were maintained in Dulbecco’s minimal
essential medium (GIBCO), with similar supplements, except
that the HOS cell medium was supplemented with puromycin
for maintenance of plasmid stability. Cryopreserved human pe-
ripheral blood lymphocytes were stimulated with PHA and used
for virus infections.16,31 Reverse transcriptase activity was as-
sayed as previously described.32
QUINNAN ET AL.562
TABLE 1. COMPARATIVE NEUTRALIZATION OF PSEUDOVIRUSES
EXPRESSING MULTIPLE ENVELOPE CLONES
Neutralization titer against clonea
Serum 10.1 10.2 3.1 3.2
Reference 1 1:32 1:64 1:32 1:64Reference 2 1:128 1:128 1:128 1:128
aClones 10.1 and 10.2 were obtained from the October 1988sample, and clones 3.1 and 3.2 were obtained from the March1988 sample.
TABLE 2. CORECEPTOR DEPENDENCY OF R2 PSEUDOVIRUS ENTRY INTO HOS-CD4 CELLS
Infectivity titer
In HOS-CD4 cells expressing:In PM1
Pseudovirus CCR1 CCR2b CCR3 CCR4 CCR5 CXCR4 cells
R2 , 1:4 , 1:4 , 1:4 , 1:4 1:64 , 1:4 1:32P9 , 1:4 , 1:4 , 1:4 , 1:4 1:256 , 1:4 1:8NL4-3 , 1:4 , 1:4 , 1:4 , 1:4 1:32 . 1:256 1:8AD8 , 1:4 , 1:4 , 1:4 , 1:4 1:256 , 1:4 1:32
Virus neutralization assays
The virus NL4-3 was used in neutralization assays, which
employed Molt 3 cells as target cells and used giant cell for-
mation for end-point determination, as previously de-
scribed.14 The amounts of virus used were sufficient to re-
sult in the formation of 30±50 giant cells per well.14,33 The
viruses NL(SF162) and AD8, and P9 and P10 were tested for
neutralization in PHA-stimulated human lymphoblasts in the
presence of interleukin 2 (IL-2).16,31 In the latter assays 10%
of the cell suspension was removed each week, 50% of the
medium was changed each week, and medium was sampled
twice weekly from each well for reverse transcriptase assay.
The reverse transcriptase assays were performed on the test
samples from the first sampling date at which the nonneu-
tralized control wells had reverse transcriptase activity about
10±20 times that of background, generally on day 14 or 17
of the assay. The neutralization end point was considered to
be the highest dilution of serum at which reverse transcrip-
tase activity was reduced at least 50%. The References 1 and
2 and the Negative Reference Serum were used as positive
and negative controls (NIH AIDS Reagent Program, provided
by L. Vujcic and G. Quinnan).14
Pseudovirus construction and assays of pseudovirusesfor infectivity and neutralization
Pseudoviruses were constructed and assayed using methods
similar to those described previously.16,27,32 pSV7d-env plas-
mid DNA and pNL4-3.Luc.E2 R 2 were cotransfected into
70±80% confluent 293T cell cultures using the calcium phos-
phate±HEPES buffer technique, following the manufacturer in-
structions (Promega, Madison, WI) in 24-well plastic tissue cul-
ture trays or 25-cm2 flasks.16,27,32 After 24 hr the medium was
replaced with medium containing 1 mM sodium butyrate.16,32
Two days after transfection medium was harvested, passed
through a 45-m m pore size sterile filter (Millipore, Bedford,
MA), supplemented with additional fetal bovine serum to a fi-
nal concentration of 20% and stored at 2 80°C.
Pseudovirus infectivity was assayed in PM1 or HOS-CD4
cells expressing various coreceptors. Transfection supernatants
were serially diluted and inoculated into cells in 96-well plates,
pseudovirus was allowed to adsorb to cells, and then the cul-
tures were incubated for 4 days. Assays were routinely per-
formed in triplicate. The cells were washed twice with phos-
phate-buffered saline, and lysed with 5 m l of cell culture lysing
reagent (Promega) for 15 min. The cells were then triturated
BROADLY NEUTRALIZING HIV ANTIBODIES AND ANTIGEN 563
TABLE 3. INFERRED AMINO ACID SEQUENCE OF THE R2 ENVELOPE CLONE FROM DONOR 2
Amino acid residuea Residue No.
aAmino acid residues are identified by standard single-letter designations. Boldface lettersindicate predicted N-linked glycosylation sites.
into the medium, and 10-m l aliquots of the suspensions were
transferred to wells of 96-well luminometry plates. Substrate
was added in 50-m l volumes automatically, and the lumines-
cence read using a MicroLumatPlus luminometer (EG&G
Berthold, Hercules, CA). Mock pseudovirus controls were used
in each assay, consisting of medium harvested from 293T cell
cultures transfected with pSV7d (without an env insert) and
pNL4-3.Luc.E2 R 2 , and processed in the same way as cultures
for pseudovirus preparations. Infectivity end points were de-
termined by a modified Reed±Muench method; an individual
well was considered positive if the luminescence was at least
10-fold greater than that of the mock control, and the end point
was considered to be the highest dilution at which the calcu-
lated frequency of positivity was $ 50%.16,32,33 Luminescence
resulting from infection with minimally diluted samples was
generally about 10,000-fold greater than background.
Neutralization tests were performed using PM1 or HOS-CD4
cells. Aliquots of 25 m l of two-fold serial serum dilutions were
mixed with equal volumes of diluted pseudovirus in wells of
96-well plates. The pseudovirus dilutions were selected so as
to expect luminescence in the presence of nonneutralizing
serum of about 100 times background. Assays were performed
in triplicate. The virus±serum mixtures were incubated for 60
min at 4°C, after which 150-m l aliquots of PM1 cell suspen-
sions containing 1.5 3 104 cells were added, or the suspensions
were transferred to wells containing HOS-CD4 cells. The as-
says were then processed similarly to the infectivity assays. The
neutralization end points were calculated by a modified Reed-
Muench method in which the end point was considered to be
the highest serum dilution calculated to have a frequency of
$ 50% for reducing luminescence by $ 90% compared with the
nonneutralized control. This method of end-point determination
yields good test-to-test consistency, and results that are com-
parable to results obtained in our virus neutralization assays,
described above.16 Pseudovirus titrations were conducted in du-
plicate in parallel with each neutralization assay.
Human sera
All studies were done in compliance with applicable regu-
lations for the protection of human subjects. The sera used
were References 1 and 2; sera from Thai donors with subtype
B or E infections (provided by J. Mascola, Walter Reed Army
Institute of Research, Rockville, MD); sera from Zambian,
Ugandan, and Thai donors with subtype A, C, and E infec-
tions, respectively (provided by H. Shepard, S. Allen, J. Ell-
ner, and K. Nelson of the HIVNET project); and sera from
Ugandan and Brazilian donors with subtype D and F infec-
tions, respectively (provided by G. Francis of the UNAIDS
program). In addition, sera from HIV-1-infected residents of
the Washington, D.C. and Baltimore, Maryland metropolitan
areas collected in the time period of 1985±1990 (presumed
QUINNAN ET AL.564
FIG. 1. Phylogenetic analyses of the gp120 and gp41 nucleotide coding sequences of clone R2. Alignments were performedusing the Clustal algorithm of Higgins and Sharp in the program DNA Star.34,36,37 The graphs at the bottom of the two figuresindicate the percent similarity distances represented by the dendrograms. GenBank accession numbers for the sequences repre-sented are as follows: MW959, U08453; MW960, U08454; D747, X65638; BR020, U27401; BR029, U27413; RU131, U30312;UG975, U27426; AD8, M60472; HXB, K03455; NDK, M27323; Z2Z6, M22639; UG021, U27399; CM235, L03698; TH022,U09139; TH006, U08810; UG275, L22951; SF1703, M66533; RW020, U08794; RW009, U08793; U455, M62320; and Z321,M15896.
subtype B infections), and available in our laboratory from
previous studies, were used.
Nucleic acid sequencing
Nucleotide sequence analysis was performed using the
dideoxy cycle sequencing technique and AmpliTaq FS DNA
polymerase, according to the manufacturer directions (Applied
Biosystems, Foster City, CA). After the sequencing reaction the
DNA was purified using Centriflex gel-filtration cartridges (Ad-
vanced Genetic Technologies, Gaithersburg, MD). Sequencing
gels were run and analyzed using an Applied Biosystems Prism,
model 377 DNA sequencer. Sequencing was performed on both
strands. Sequence alignment was performed using the Editseq
and Megalign programs in DNA Star according to the method
of Higgins and Sharp.34
RESULTS
Comparability of clones isolated at different time points
From the samples of patient cells from each of the two time
points, env clones were recovered that encoded proteins that
were capable of mediating pseudovirus entry into target cells.
Two such clones from each time point were further character-
ized. As shown in Table 1, the envelopes of all four clones me-
diated infection for PM1 cells and were neutralized compara-
bly by References 1 and 2. Pseudoviruses carrying envelopes
corresponding to each clone were also tested for infectivity for
HOS-CD4 cells expressing either CXCR4 or CCR5, and all four
were infectious only for the cells expressing CCR5, as shown
in Table 2. Nucleotide sequences including the V3 regions were
analyzed for each clone, with more than 300 bases assigned for
each, and no differences between the clones were found (re-
sults not shown). Based on the absence of a demonstration of
differences in these assays, a single clone from the March sam-
ple was selected for use in subsequent assays (clone 3.1 in Table
1), and is designated R2 hereafter.
Clone R2 genotype and host range phenotype
The complete nucleotide sequence of the env gene clone
R2 was determined, and found to have an open reading frame
of 2598 bases (Genbank accession number AF 128126). The
amino acid sequence deduced from this sequence is shown
in Table 3. There are 30 predicted N-linked glycosylation
sites, compared with 29 in the consensus clade B sequence;
4 consensus N-linked glycosylation sites are lacking in R2,
including those at residues 146, 215, 270, and 368 (number-
ing according to the Human Retroviruses and AIDS Database
clade B consensus sequence), in the V2, C2, C2, and V4 re-
BROADLY NEUTRALIZING HIV ANTIBODIES AND ANTIGEN 565
FIG. 2. Neutralization of clade B viruses and pseudoviruses by sera from 10 subjects infected with HIV-1 strains presumed tobe clade B. The P9 and P10 viruses (P9-V and P10-V) are primary isolates from two of the serum donors.16 The virus andpseudovirus neutralization assays were performed as described in Materials and Methods. Each point represents the results ob-tained with an individual serum. The open bars represent the standard deviations about the geometric means, indicated by the midlines. The numbers above the results obtained using pseudoviruses indicate the probabilities obtained from testing the nullhypothesis by paired t testing comparing the individual pseudoviruses to R2. The results obtained with the SF162 pseudoviruswere also significantly greater than those obtained with P10 (p 5 0.02) and NL4-3 (p 5 0.02), but not P9 and AD8 pseudoviruses.
gions of gp120, respectively.35 The consensus glycosylation
sequences at residues 215 and 270 are highly and moderately
variable, respectively.
Genotypic analyses conducted included evaluation of the
gp120 and gp41 nucleotide coding sequences in comparison with
those of a number of strains of clades A through G, as shown in
Fig. 1.36,37 Both coding regions were more closely related to clade
B than non-clade B sequences. Comparative analyses of smaller
regions of the predicted gp120 and gp41 amino acid sequences
were also performed (results not shown). The regions analyzed
included the following: each constant and variable region of
gp120; the proximal gp41 ectodomain, including the fusion do-
main and the leucine zipper region; the part of gp41 extending
from the end of the leucine zipper to the second dysteine; the re-
maining gp41 ectodomain, the transmembrane region; and the cy-
toplasmic region. R2 consistently related more closely with the
clade B sequences than the others.
Comparative sensitivity of R2 and other clade Bviruses and pseudoviruses to neutralization by serafrom individuals with clade B infections
The neutralization of R2 pseudovirus was compared to other
clade B viruses and pseudoviruses as shown in Fig. 2. Of
the five virus/pseudovirus comparisons made (P9, P10, NL4-3,
AD8, and SF162 V and PV), there were no significant differ-
ences in the neutralization of matched viruses and pseudo-
viruses by paired t test (statistical results not shown). Each of
the pseudovirus preparations was neutralized by seven, eight,
or nine of the sera tested, and the geometric mean titers ranged
from 1:13.9 to 1:56, while the R2-PV was neutralized by all 10
of the sera tested, with a geometric mean titer of 1:73.5. Al-
though the neutralization titers of each of the different sera
against R2 and the other pseudoviruses were frequently within
fourfold, the neutralization of R2-PV was significantly greater
by paired t test comparing log-transformed titers than four of
the other pseudovirus preparations.
Comparative neutralization of pseudovirusesexpressing R2 and other envelopes of diverse subtypesby sera from diverse subtype infections
The results of comparative neutralization testing using sera
from individuals infected with HIV-1 strains of subtypes A, C,
D, E, and F, Reference 1 and 2, and one Thai clade B serum
are shown in Table 4. Reference 2 neutralized the pseudovirus
expressing the homologous R2 envelope at the modest titer of
1:64 in the experiment shown and within twofold of this titer
QUINNAN ET AL.566
TABLE 4. NEUTRALIZATION OF PSEUDOVIRUSES EXPRESSING ENVELOPES OF VARIOUS CLADES BY SERA FROM
PEOPLE INFECTED WITH VARIOUS CLADES OF HIV-1
NA titer against pseudovirus (clade)a
R2 P9 P10 BR020 MW965 Z2Z6 TH966 UG975Clade Serumb (B) (B) (B) (A) (C) (D) (E) (G)
B Ref 1 32 16 32 , 10 256 10 , 8 , 10Ref 2 64 32 64 10 128 40 8 10WR465 20 NTc 80 , 10 640 10 , 10 10
A 7570 320 160 20 80 2560 , 10 , 10 , 105374 40 , 10 , 10 , 10 640 , 10 , 10 , 105837 40 20 , 10 80 2560 , 10 , 10 , 10
C ZAM107 40 10 , 10 10 1280 , 10 , 10 , 10ZAM708 10 , 10 , 10 , 10 320 , 10 , 10 , 10ZAM218 80 , 10 , 10 , 10 1280 , 10 , 10 , 10
D UG240 , 10 NT NT NT NT , 10 20 NTUG370 , 10 NT NT NT NT , 10 10 NTUG386 , 10 NT NT NT NT 20 10 NTUG097 10 NT NT NT NT 10 10 NTUG118 10 NT NT NT NT 40 20 NT
E WR659 10 , 10 , 10 , 10 20 , 10 40 , 10WR901 , 10 , 10 , 10 40 320 10 40 10WR177 , 10 , 10 , 10 40 640 10 80 , 10WR657 , 10 , 10 10 10 640 , 10 80 , 10WR593 , 10 , 10 , 10 , 10 160 10 40 , 10008 , 10 , 10 , 10 , 10 10 , 10 , 10 , 10053 20 , 10 , 10 , 10 40 , 10 20 , 10062 20 10 , 10 10 320 , 10 20 , 10
F BR318 , 10 NT NT NT NT , 10 , 10 NTBR019 10 NT NT NT NT , 10 , 10 NTBR020 20 NT NT NT NT , 10 , 10 NTBR029 10 NT NT NT NT 20 , 10 NT
aNeutralization titers are the dilutions at which 90% inhibition of luminescence was observed.bSera were the Reference Neutralizing Human Serum 1 and 2, or were provided by Dr. J. Mascola, HIVNET, or the UNAIDSProgram, as described in the text.cNT, not tested.
in many other experiments. It neutralized the other seven
pseudoviruses tested at low to moderate titers, as well. The R2
pseudovirus was neutralized by 18 of 26 sera. The other two
clade B pseudoviruses were neutralized less often, and were
also neutralized infrequently by the clade E sera. The clade C
pseudovirus was substantially more sensitive, in general, to neu-
tralization than the others tested. Cross-reactivity of R2 with
clade A was suggested by moderate to high titers of all three
clade A sera tested, in spite of minimal neutralization of the
clade A pseudovirus, BR020. Cross-reactivity with clade C was
suggested by similarly efficient neutralization of R2 by clade
C sera and moderate neutralization of the clade C pseudovirus
MW065 by Reference 2. Some cross-reactivity of R2 with clade
D was suggested in that Reference 2 neutralized the clade D
pseudovirus at a moderate dilution; however, the neutralization
of R2 by clade D sera was seen at only the lowest serum dilu-
tion tested and in only three of five cases. Minor cross-reac-
tivity of R2 with clade E was suggested in that Reference 2
neutralized the clade E pseudovirus TH966, at only the lowest
dilution tested, and the three of eight clade sera that neutralized
R2 did so at low dilutions only. No clade F pseudovirus was
tested, but minor cross-reactivity of R2 with clade F was sug-
gested by the finding that three of four clade F sera neutralized
R2 at low dilutions. Reference 2 neutralized the clade G
pseudovirus UG975 at the lowest dilution tested and no clade
G sera were tested. Some of the results obtained using the other
clade B sera against clade A and C pseudoviruses, and clade A
and C sera against clade B pseudoviruses, also suggested cross-
reactivity, but R2 was more cross-reactive than the other two
clade B clones. Cross-reactivities among some of the other
serum±pseudovirus combinations were also observed.
To evaluate further the low cross-reactivity suggested be-
tween clades B and E, the sera used in the tests shown in Fig.
2 were tested for neutralization of the clade E pseudovirus.
None of them neutralized (results not shown).
DISCUSSION
We have cloned, expressed, and characterized envelope
genes from the donor of Reference 2, which is noted for its ca-
pacity to neutralize primary HIV isolates of varied subtypes.15
Clones obtained from samples collected at two different time
points were similar to each other. The envelope gene was sim-
ilar to other clade B envelopes in nucleotide and predicted
amino acid sequence, depended on CCR5 as a coreceptor for
cell entry, and was commonly neutralized by human sera. This
envelope protein was also found to express one or more neu-
tralization epitopes in common with at least some strains of
other clades of HIV-1, and may be useful for study of the po-
tential for induction of broadly cross-reactive immunity by vac-
cination.
The patient from whom the env genes described in this arti-
cle were cloned was selected as donor of the plasma that was
used to prepare Reference 2 on the basis of preliminary screen-
ing of sera from 10 participants in a long-term cohort study of
patients with HIV-1 infection conducted at the NIH Clinical
Center. This donor and the donor of Reference 1 had higher,
and more cross-reactive neutralizing antibodies in their sera
than did the other eight participants when tested against three
laboratory-adapted clade B strains of HIV-1. The donor of Ref-
erence 2 has since been observed to have continued in good
health as recently as approximately 1 year ago, 8 years after the
original serum donation. The nonprogressive nature of this
donor’s HIV infection is of interest in view of evidence that
neutralizing antibody levels correlate to some degree with non-
progressive HIV infection.38 However, in this case there is no
basis for judging whether the neutralizing antibody status is a
consequence of the donor’s nonprogressive infection status or
vice versa, or even if the two are related. The cross-reactivity
of the donor’s neutralizing antibodies could have resulted from
infection with a strain that expressed unusually cross-reactive
epitopes, or from maturation of the neutralizing antibody re-
sponse to a relatively high level of cross-reactivity as a result
of the donor’ s nonprogressive status.
Pseudovirus technology was used for study of the antigenic
characteristics of this envelope protein, since the approach is
not confounded by variables affecting different virus prepara-
tions unrelated to the envelope protein itself.16,39±41 Pseudo-
virus expressing the R2 envelope was modestly sensitive to neu-
tralization, with respect to the titers obtained from individuals
infected with strains of HIV-1 presumed to be clade B, and ho-
mologous sera (Reference 2). Various studies of neutralization
escape mutants of HIV-1 indicate that the sensitivity of virus
to neutralization can vary as a result of mutations that do not
affect the primary structure of the neutralization epitopes rec-
ognized by the antibodies tested.3,10,11,32 Thus, it is not unex-
pected that R2 might express highly cross-reactive neutraliza-
BROADLY NEUTRALIZING HIV ANTIBODIES AND ANTIGEN 567
TABLE 5. COMPARISON OF V3 REGION AMINO ACID
SEQUENCES OF CLONE R2 WITH PHENETIC SUBGROUP
CONSENSUS SEQUENCES 1 THROUGH 13 AND CLADE ATHROUGH E CONSENSUS SEQUENCESa
Clone, subgroupor clade V3 region amino acid sequence
R2 NNTR.KSIPMGPGRAFYTTGQIIGDIRQAHC
Phenetic 1 ----.---HI----------D----------
Phenetic 2 ----.---SI-------A--E----------
Phenetic 3 ----.---SI-------A--K----------
Phenetic 4 ----.---RI---Q---A--D----------
Phenetic 5 ----.---HI-------A--K----------
Phenetic 6 K--RRR-H.I---------K-----------
Phenetic 7 ----.T--TI---QV--R--K----------
Phenetic 8 KKM-.T-ARI----V-HK--D---S-TK-Y-
Phenetic 9 ----.Q-THI---Q-L---.D---K------
Phenetic 10 ----.QGTHI-----Y---.N----------
Phenetic 11 ----.QRTSI-Q-QAL---.E-R------A-
Phenetic 12 D-IKIQRT-I-Q-Q-L---RITGYI.G----
Phenetic 13 Q-K-.QGT-I-L-Q-L---R.-K----K---
Clade A ----.--VHI---Q---A--D----------
Clade B ----.---HI----------E----------
Clade C ----.---RI---QT-YA--D----------
Clade D ----.QRTHI---Q-L---.R----------
Clade E ----.T--TI---QV--R--D------K-Y-
aDashes indicate residues at which the individual sequencesare identical to R2. The periods indicate sites of insertions ordeletions.
tion epitope(s), but not necessarily be highly sensitive to neu-
tralization. Phylogenetic comparison of various regions of R2
and other HIV-1 envelope gene nucleic acid sequences demon-
strated that R2 is descended from a clade B progenitor strain
throughout its full length.
The R2 pseudovirus was neutralized by sera from people
known to be infected with clade A, B, C, D, E, and F strains
of HIV-1. None of the sera tested neutralized all of the
pseudoviruses tested except Reference 2. Comparison with
other envelopes tested indicates that R2 may be more cross-re-
active with clade A and C strains than clade D and E strains.
Notably, the clade E pseudovirus was neutralized by 12 of 13
clade D and E sera and by 1 of 13 clade A, B, C, and F sera,
while R2 was neutralized by only 6 of 13 clade D and E sera,
but 12 of 13 of the clade A, B, C, and F sera. This distinction
between the two envelopes suggests that they may generally
distinguish two antigenic subgroups of HIV-1. That clade B and
E sera can be distinguished in neutralization assays has been
reported.31,42 Overall the results indicate that the R2 envelope
expresses neutralization epitope(s) that are common to varying
degrees among strains of different clades.
The loss of glycosylation sites in the HIV-1 envelope has
been associated with enhanced sensitivity to neutralizing anti-
bodies.43 Conversely, during the course of SIV infection there
is evolution of the V1 and V4 regions of the envelope gene re-
sulting in the extension of these regions with the addition of
glycosylation sites.44,45 These added glycosylation sites are as-
sociated with resistance to neutralization, probably as a result
of masking of neutralization epitopes by the sugar side
chains.44,45 The inferred amino acid sequence of the R2 enve-
lope glycoprotein has an overall number of N-linked glycosy-
lation sites similar to other strains of HIV-1. Moreover, in each
of the variable length regions of the V1 and V4 regions of this
protein corresponding to the segments between residues 132
and 159 and residues 396 and 415, respectively, there are three
predicted N-linked glycosylation sites, while in the vast ma-
jority of strains studied to date there are between one and three
predicted glycosylation sites in each of the corresponding seg-
ments.35
Genetic classification of strains of HIV has been useful in
efforts to understand the epidemiology of the virus, but has not
been highly predictive of antigenic relatedness among strains.46
Korber et al. have described a phenetic classification of strains
of HIV-1 into 13 subgroups based on similarities of V3 region
amino acid sequences, and Plantier et al. have presented evi-
dence that sera from infected patients can be grouped accord-
ing to their reactivity with peptides consisting of amino acid
sequences corresponding to consensus V3 sequences of the var-
ious phenetic subgroups.47,48 Since there are multiple neutral-
ization epitopes on the HIV envelope, it cannot be predicted
whether the antigenic grouping they describe will be reflected
in neutralization phenotypes of different virus strains. However,
to the extent that neutralization phenotype reflects dominance
of anti-V3 antibodies, such a grouping may be seen. The pre-
dicted V3 region amino acid sequence of the R2 envelope dif-
fers from the phenetic group 1 consensus sequence at three
residues, and from group 2, 3, and 5 consensus sequences at
four residues, as shown in Table 5. Two of these distinguish-
ing mutations, in residues 313 and 314, are at residues that were
found by Ghiara et al. to interact with anti-V3 antibody, and to
influence the interaction of the antibody with more apical
residues.49 The presence of a proline at residue 315, rather than
a basic residue, and of a glutamine at residue 329, rather than
an acidic residue, are additional unusual features of the V3 re-
gion of R2.35 Whether the V3 region or other regions of the en-
velope of this virus contributed to induction of the cross-
reactive antibody response seen in this patient and the cross-re-
activity of the R2 envelope will be the subject of additional
study.
ACKNOWLEDGMENTS
This research was supported by NIH Grant AI37438 and
USUHS Grant RO87EZ. The authors are grateful for technical
assistance provided by Dr. Xi Chen.
REFERENCES
1. Luciw PA. In: Fields Virology (Fields BN, Knipe DM, and How-
ley PM, eds.), 3rd Ed. Lippincott-Raven, Philadelphia, 1996, pp.
1881±1952.
2. Thali M, Furman C, Ho DD, Robinson J, Tilley S, Pinter A, and
Sodroski J: Discontinuous, conserved neutralization epitopes
overlapping the CD4-binding region of human immunodefi-
ciency virus type 1 gp120 envelope glycoprotein. J Virol 1992;
66:5635±5641.
3. Zwart G, Langedijk H, Van der Hoek L, de Jong JJ, Wolfs TF, Ra-
mautarsing C, Bakker M, De Ronde A, and Goudsmit J: Immun-
odominance and antigenic variation of the principal neutralization
domain of HIV-1. Virology 1991;181:481±489.
4. Moore JP, Sattentau QJ, Yoshiyama H, Thali M, Charles M, Sul-
livan N, Poon S-W, Fung MS, Traincard F, Pinkus M, Robey G,
Robinson JE, Ho DD, and Sodroski J: Probing the structure of the
V2 domain of human immunodeficiency virus type 1 surface gly-
coprotein gp120 with a panel of eight monoclonal antibodies: hu-
man immune response to the V1 and V2 domains. J Virol
1993;67:6136±6151.
5. Trkola A, Purtscher M, Muster T, Ballaun C, Buchacher A, Sulli-
van N, Srinivassan K, Sodroski J, Moore JP, and Katinger H: Hu-
man monoclonal antibody 2G12 defines a distinctive neutralization
epitope of human immunodeficiency virus type 1. J Virol 1996;70:
1100±1108.
6. Muster T, Stein F, Purtscher M, Trkola A, Klima A, Himmler G,
Ruker F, and Katinger H: A conserved neutralization epitope on
gp41 of human immunodeficiency virus type 1. J Virol 1993;
67:6642±6647.
7. Thali M, Moore JP, Furman C, Charles M, Ho DD, Robinson J,
and Sodroski J: Characterization of conserved human immunode-
ficiency virus type 1 gp120 neutralization epitopes exposed upon
gp120-CD4. J Virol 1993;67:3978±3988.
8. Cotropia J, Ugen KE, Kliks S, Broliden K, Broliden PA, Hoxie JA,
Srikantan V, Williams WV, and Weiner DB: A human monoclonal
antibody to HIV-1 gp41 with neutralizing activity against diverse
laboratory isolates. J Acquir Immune Defic Syndr Hum Retrovirol
1996;12:221±232.
9. Sabri F, Chiodi F, and Fenyö EM: Lack of correlation between V3
amino acid sequence and syncytium-inducing capacity of some
HIV type 1 isolates. AIDS Res Hum Retroviruses 1996;12:
855±858.
10. Thali M, Charles M, Furman C, Cavacini L, Posner M, Robinson
J, and Sodroski J: Resistance to neutralization by broadly reactive
antibodies to the human immunodeficiency virus type 1 gp120 gly-
QUINNAN ET AL.568
coprotein conferred by a gp41 amino acid change. J Virol 1994;
68:674±680.
11. Back NKT, Smit L, Schutten M, Nara PL, Tersmette M, and
Goudsmit J: Mutations in human immunodeficiency virus type 1
gp41 affect sensitivity to neutralization by gp120 antibodies. J Vi-
rol 1993;67:6897±6902.
12. Hioe CE, Xu S, Chigurupati P, Burda S, Williams C, Gorny MK,
and Zolla-Pazner S: Neutralization of HIV-1 primary isolates by
polyclonal and monoclonal human antibodies. Int Immunol
1997;9:1281±1290.
13. VanCott TC, Mascola JR, Kaminski RW, Kalyanaraman V, Hall-
berg PL, Burnett PR, Ulrich JT, Rechtman DJ, and Birx DL: An-
tibodies with specificity to native gp120 and neutralization activ-
ity against primary human immunodeficiency virus type 1 isolates
elicited by immunization with oligomeric gp160. J Virol 1997;
71:4319±4330.
14. Vujcic LK and Quinnan GV Jr: Preparation and characterization
of human HIV type 1 neutralizing reference sera. AIDS Res Hum
Retroviruses 1995;11:783±787.
15. D’ Souza MP, Durda P, Hanson CV, Milman G, and collaborating
investigators: Evaluation of monoclonal antibodies to HIV-1 by
neutralization and serological assays: An international collabora-
tion. AIDS 1991;5:1061±1070.
16. Quinnan G, Zhang P, Fu D, Dong M, and Margolick J: Evolution
of neutralizing antibody response against HIV-1 virions and
pseudovirions in Multicenter AIDS Cohort Study participants.
AIDS Res Hum Retroviruses 1998;14:939±949.
17. Barnes WM: The fidelity of Taq polymerase catalyzing PCR is im-
proved by an N-terminal deletion. Gene 1992;112:29±35.
18. Cariello NF, Swenberg JA, and Skopek TR: Fidelity of Thermo-
coccus litoralis DNA polymerase (Vent) in PCR determined by
denaturing gradient gel electrophoresis. Nucleic Acids Res 1991;
19:4193±4198.
19. Stuve LL, Brown-Shimer S, Pachl C, Naharian R, Diaz D, and
Burke RL: Structure and expression of the herpes simplex virus
type 2 glycoprotein gB gene. J Virol 1987;61:326±335.
20. Gao F, Yue L, Craig S, Thornton CL, Robertson DL, McCutchan
FE, Bradac JA, Sharp PM, and Hahn BH: Genetic variation of HIV
type 1 in four World Health Organization-sponsored vaccine eval-
uation sites: Generation of functional envelope (glycoprotein 160)
clones representative of sequence subtypes A, B, C, and E. WHO
Network for HIV Isolation and Characterization. AIDS Res Hum
Retroviruses 1994;10:1359±1368.
21. Adachi A, Gendelman HE, Koenig S, Folks T, Willey R, Rabson
A, and Martin MA: Production of acquired immunodeficiency
syndrome-associated retrovirus in human and nonhuman cells
transfected with an infectious molecular clone. J Virol 1986;
59:284±291.
22. Theodore TS, Englund G, Buckler-White A, Buckler CE, Martin
MA, and Peden KW: Construction and characterization of a stable
full-length macrophage-tropic HIV type 1 molecular clone that di-
rects the production of high titers of progeny virions. AIDS Res
Hum Retroviruses 1996;12:191±194.
23. Englund G, Theodore TS, Freed EO, Engleman A, and Martin MA:
Integration is required for productive infection of monocyte-de-
rived macrophages by human immunodeficiency virus type 1. J Vi-
rol 1995;69:3216±3219.
24. Seth A, Hodge DR, Thompson DM, Robinson L, Panayiotakis A,
Watson DK, and Papas TS: ETS family proteins activate tran-
scription from HIV-1 long terminal repeat. AIDS Res Hum Retro-
viruses 1993;9:1017±1023.
25. Mann DL, O’ Brien SJ, Gilbert DA, Reid Y, Popovic M, Read-Con-
nole E, Gallo RC, and Gazdar AF: Origin of the HIV-susceptible
human CD4 1 cell line H9. AIDS Res Hum Retroviruses
1989;5:253±255.
26. Daniel MD, Li Y, Naidu YM, Durda PJ, Schmidt DK, Troup CD,
Silva DP, MacKey JJ, Kestler HW III, Sehgal PK, King NW, Ohta
Y, Hayami M, and Desrosiers RC: Simian immunodeficiency virus
from African green monkeys. J Virol 1988;62:4123±4128.
27. Deng H, Liu R, Ellmeier W, Choe S, Unutmaz D, Burkhart M, Di
Marzio P, Marmon S, Sutton RE, Hill CM, Davis CB, Peiper SC,
Schall TJ, Littman DR, and Landau NL: Identification of a major
co-receptor for primary isolates of HIV. Nature (London) 1996;
381:661±666.
28. Landau NR and Littman DR: Packaging system for rapid produc-
tion of murine leukemia virus vectors with variable tropism. J Vi-
rol 1992;66:5110±5113.
29. Lusso P, Cocchi F, Balotta C, Markham PD, Louie A, Farci P, Pal
R, Gallo RC, and Reitz MS Jr: Growth of macrophage-tropic and
primary human immunodeficiency virus type 1 (HIV-1) isolates
in a unique CD4 1 T-cell clone (PM1): Failure to downregulate
CD4 and to interfere with cell-line-tropic HIV-1. J Virol 1995;
69:3712±3720.
30. Liou HC, Sha WC, Scott ML, and Baltimore D: Sequential induc-
tion of NF-kappa B/Rel family proteins during B-cell terminal dif-
ferentiation. Mol Cell Biol 1994;14:5349±5359.
31. Mascola J, Louwagie J, McCutchan FE, Fischer CL, Hegerich PA,
Wagner KF, Fowler AK, McNeil JG, and Burke DS: Two anti-
genically distinct subtypes of human immunodeficiency virus type
1: Viral genotype predicts neutralization serotype. J Infect Dis
1994;169:48±54.
32. Park EJ, Vujcic LJ, Anand R, Theodore TS, and Quinnan GV: Mu-
tations in both gp120 and gp41 are responsible for the broad neu-
tralization resistance of variant HIV-1 MN to antibodies directed
at V3 and non-V3 epitopes. J Virol 1998;72:7099±7107.
33. Lennette EH: General principles underlying laboratory diagnosis
of viral and rickettsial infections. In: Diagnostic Procedures of Vi-
ral and Rickettsial Disease (Lennette EH and Schmidt MJ, eds.).
American Public Health Association, New York, 1964, p. 45.
34. Higgins DG and Sharp PM: Fast and sensitive multiple sequence
alignments on a microcomputer. Comput Appl Biosci 1989;
5:151±153.
35. Myers G, Berzofsky JA, Korber B, Smith RF, and Pavlakis GN:
Human Retroviruses and AIDS 1992. Los Alamos National Labo-
ratory, Los Alamos, New Mexico, 1993.
36. Saitou N and Nei M: The neighbor-joining method: A new method
for reconstructing phylogenetic trees. Mol Biol Evol 1987;
4:406±425.
37. Myers EW and Miller W: Optimal alignments in linear space. Com-
put Appl Biosci 1988;4:11±17.
38. Montefiori DC, Pantaleo G, Fink LM, Zhou JT, Zhou JY, Bilska
M, Miralles GD, and Fauci AS: Neutralizing and infection-en-
hancing antibody responses to human immunodeficiency virus type
1 in long-term nonprogressors. J Infect Dis 1996;173:60±67.
39. Wrin T, Loh TP, Vennari JC, Schuitemaker H, and Nunberg JH:
Adaptation to persistent growth in the H9 cell line renders a pri-
mary isolate of human immunodeficiency virus type 1 sensitive to
neutralization by vaccine sera. J Virol 1995;69:39±48.
40. Fortin JF, Cantin R, and Tremblay MJ: T cells expressing activated
LFA-1 are more susceptible to infection with human immunodefi-
ciency virus type 1 particles bearing host-encoded ICAM. J Virol
1998;72:2105±2112.
41. Zolla-Pazner S and Sharpe S: A resting cell assay for improved de-
tection of antibody-mediated neutralization of HIV type 1 primary
isolates. AIDs Res Hum Retroviruses 1995;11:1449±1458.
42. Porter KR, Mascola JR, Hupudio H, Ewing D, VanCott TC, An-
thony RL, Corwin AL, Widodo S, Ertono S, McCutchan FE, Burke
DS, Hayes CG, Wignall FS, and Graham RR: Genetic, antigenic
and serologic characterization of human immunodeficiency virus
type 1 from Indonesia. J Acquir Immune Defic Syndr Hum Retro-
virol 1997;14:1±6.
43. Schonning K, Jansson B, Olofsson S, Nielsen JO, and Hansen JS:
BROADLY NEUTRALIZING HIV ANTIBODIES AND ANTIGEN 569
Resistance to V3-directed neutralization caused by an N-linked
oligosaccharide depends on the quaternary structure of the HIV-1
envelope oligomer. Virology 1996;218:134±140.
44. Overbaugh J and Rudensey LM: Alterations in potential sites for
glycosylation predominate during evolution of the simian immun-
odeficiency virus envelope gene in macaques. J Virol 1992;
66:5937±5948.
45. Chackerian B, Rudensey LM, and Overbaugh J: Specific N-linked
and O-linked glycosylation modifications in the envelope V1 do-
main of simian immunodeficiency virus variants that evolve in the
host alter recognition by neutralizing antibodies. J Virol 1997;
71:7719±7727.
46. Moore JP, Cao Y, Leu J, Qin L, Korber B, and Ho DD: Inter- and
intraclade neutralization of human immunodeficiency virus type 1:
Genetic clades do not correspond to neutralization serotypes but
partially correspond to gp120 antigenic serotypes. J Virol 1996;
70:427±444.
47. Korber BT, MacInnes K, Smith RF, and Myers G: Mutational
trends in V3 loop protein sequences observed in different genetic
lineages of human immunodeficiency virus type 1. J Virol
1994;68:6730±6744.
48. Plantier JC, Le Pogam S, Poisson F, Buzelay L, Lejeune B, and
Barin F: Extent of antigenic diversity in the V3 region of the sur-
face glycoprotein, gp120, of human immunodeficiency virus type
1 group M and consequences for serotyping. J Virol 1998;72:
677±683.
49. Ghiara JB, Stura EA, Stanfield RL, Profy AT, and Wilson IA: Crys-
tal structure of the principal neutralization site of HIV. Science
1994;264:82±85.
Address reprint requests to:
Gerald V. Quinnan, Jr.
Department of Preventive Medicine and Biometrics
Uniformed Services University of the Health Sciences
4301 Jones Bridge Road
Bethesda, Maryland 20814
QUINNAN ET AL.570
top related