pairwise sequence alignment. pairwise alignment: protein sequences can be more informative than dna...

Pairwise sequence alignment

Pairwise alignment: protein sequencescan be more informative than DNA

• protein is more informative (20 vs 4 characters); many amino acids share related biophysical properties

• codons are degenerate: changes in the third position often do not alter the amino acid that is specified

• protein sequences offer a longer “look-back” time

• DNA sequences can be translated into protein, and then used in pairwise alignments

Pairwise alignment: protein sequencescan be more informative than DNA

• Many times, DNA alignments are appropriate--to confirm the identity of a cDNA--to study noncoding regions of DNA--to study DNA polymorphisms--example: Neanderthal vs modern human DNA

Query: 181 catcaactacaactccaaagacacccttacacccactaggatatcaacaaacctacccac 240 |||||||| |||| |||||| ||||| | ||||||||||||||||||||||||||||||| Sbjct: 189 catcaactgcaaccccaaagccacccct-cacccactaggatatcaacaaacctacccac 247

SimilarityThe extent to which nucleotide or protein sequences are related. It is based upon identity plus conservation.

IdentityThe extent to which two sequences are invariant.

Conservation Changes at a specific position of an amino acid or (less commonly, DNA) sequence that preserve the physico-chemical properties of the original residue.

Definitions

1 MKWVWALLLLAAWAAAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEG 50 RBP . ||| | . |. . . | : .||||.:| : 1 ...MKCLLLALALTCGAQALIVT..QTMKGLDIQKVAGTWYSLAMAASD. 44 lactoglobulin

51 LFLQDNIVAEFSVDETGQMSATAKGRVR.LLNNWD..VCADMVGTFTDTE 97 RBP : | | | | :: | .| . || |: || |. 45 ISLLDAQSAPLRV.YVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTK 93 lactoglobulin

98 DPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAV...........QYSC 136 RBP || ||. | :.|||| | . .| 94 IPAVFKIDALNENKVL........VLDTDYKKYLLFCMENSAEPEQSLAC 135 lactoglobulin

137 RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQ.EELCLARQYRLIV 185 RBP . | | | : || . | || | 136 QCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI....... 178 lactoglobulin

Pairwise alignment of retinol-binding protein and -lactoglobulin

• Positions at which a letter is paired with a null are called gaps.

• Gap scores are typically negative.

• Since a single mutational event may cause the insertion or deletion of more than one residue, the presence of a gap is ascribed more significance than the length of the gap. Thus there are separate penalties for gap creation and gap extension.

• In BLAST, it is rarely necessary to change gap values from the default.

Outline: pairwise alignment

• Overview and examples• Definitions: homologs, paralogs, orthologs• Assigning scores to aligned amino acids: Dayhoff’s PAM matrices• Alignment algorithms: Needleman-Wunsch, Smith-Waterman• Statistical significance of pairwise alignments

General approach to pairwise alignment

• Choose two sequences• Select an algorithm that generates a score• Allow gaps (insertions, deletions)• Score reflects degree of similarity• Alignments can be global or local• Estimate probability that the alignment occurred by chance

Calculation of an alignment score

Source: http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/Alignment_Scores2.html

A 2 R -2 6 N 0 0 2 D 0 -1 2 4 C -2 -4 -4 -5 12 Q 0 1 1 2 -5 4 E 0 -1 1 3 -5 2 4 G 1 -3 0 1 -3 -1 0 5 H -1 2 2 1 -3 3 1 -2 6 I -1 -2 -2 -2 -2 -2 -2 -3 -2 5 L -2 -3 -3 -4 -6 -2 -3 -4 -2 -2 6 K -1 3 1 0 -5 1 0 -2 0 -2 -3 5 M -1 0 -2 -3 -5 -1 -2 -3 -2 2 4 0 6 F -3 -4 -3 -6 -4 -5 -5 -5 -2 1 2 -5 0 9 P 1 0 0 -1 -3 0 -1 0 0 -2 -3 -1 -2 -5 6 S 1 0 1 0 0 -1 0 1 -1 -1 -3 0 -2 -3 1 2 T 1 -1 0 0 -2 -1 0 0 -1 0 -2 0 -1 -3 0 1 3 W -6 2 -4 -7 -8 -5 -7 -7 -3 -5 -2 -3 -4 0 -6 -2 -5 17 Y -3 -4 -2 -4 0 -4 -4 -5 0 -1 -1 -4 -2 7 -5 -3 -3 0 10 V 0 -2 -2 -2 -2 -2 -2 -1 -2 4 2 -2 2 -1 -1 -1 0 -6 -2 4 A R N D C Q E G H I L K M F P S T W Y V

PAM250 log oddsscoring matrix

R -10 9

N -7 -9 9

D -6 -17 -1 8

C -10 -11 -17 -21 10

Q -7 -4 -7 -6 -20 9

E -5 -15 -5 0 -20 -1 8

G -4 -13 -6 -6 -13 -10 -7 7

H -11 -4 -2 -7 -10 -2 -9 -13 10

I -8 -8 -8 -11 -9 -11 -8 -17 -13 9

L -9 -12 -10 -19 -21 -8 -13 -14 -9 -4 7

K -10 -2 -4 -8 -20 -6 -7 -10 -10 -9 -11 7

M -8 -7 -15 -17 -20 -7 -10 -12 -17 -3 -2 -4 12

F -12 -12 -12 -21 -19 -19 -20 -12 -9 -5 -5 -20 -7 9

P -4 -7 -9 -12 -11 -6 -9 -10 -7 -12 -10 -10 -11 -13 8

S -3 -6 -2 -7 -6 -8 -7 -4 -9 -10 -12 -7 -8 -9 -4 7

T -3 -10 -5 -8 -11 -9 -9 -10 -11 -5 -10 -6 -7 -12 -7 -2 8

W -20 -5 -11 -21 -22 -19 -23 -21 -10 -20 -9 -18 -19 -7 -20 -8 -19 13

Y -11 -14 -7 -17 -7 -18 -11 -20 -6 -9 -10 -12 -17 -1 -20 -10 -9 -8 10

V -5 -11 -12 -11 -9 -10 -10 -9 -9 -1 -5 -13 -4 -12 -9 -10 -6 -22 -10 8

A R N D C Q E G H I L K M F P S T W Y V

N 109 17

D 154 0 532

C 33 10 0 0

Q 93 120 50 76 0

E 266 0 94 831 0 422

G 579 10 156 162 10 30 112

H 21 103 226 43 10 243 23 10

Dayhoff’s numbers of “accepted point mutations”:what amino acid substitutions occur in proteins?

Dayhoff’s mutation probability matrixfor the evolutionary distance of 1 PAM

We have considered three kinds of information:• a table of number of accepted point mutations (PAMs)• relative mutabilities of the amino acids• normalized frequencies of the amino acids in PAM data

This information can be combined into a “mutation probability matrix” in which each element Mij gives the probability that the amino acid in column j will be replaced by the amino acid in row i after a given evolutionary interval (e.g. 1 PAM).

Dayhoff’s PAM1 mutation probability matrix

A 9867 2 9 10 3 8 17 21 2 6

R 1 9913 1 0 1 10 0 0 10 3

N 4 1 9822 36 0 4 6 6 21 3

D 6 0 42 9859 0 6 53 6 4 1

C 1 1 0 0 9973 0 0 0 1 1

Q 3 9 4 5 0 9876 27 1 23 1

E 10 0 7 56 0 35 9865 4 2 3

G 21 1 12 11 1 3 7 9935 1 0

H 1 8 18 3 1 20 1 0 9912 0

I 2 2 3 1 2 1 2 0 0 9872

Original amino acid

Dayhoff’s PAM1 mutation probability matrix

A 9867 2 9 10 3 8 17 21 2 6

R 1 9913 1 0 1 10 0 0 10 3

N 4 1 9822 36 0 4 6 6 21 3

D 6 0 42 9859 0 6 53 6 4 1

C 1 1 0 0 9973 0 0 0 1 1

Q 3 9 4 5 0 9876 27 1 23 1

E 10 0 7 56 0 35 9865 4 2 3

G 21 1 12 11 1 3 7 9935 1 0

H 1 8 18 3 1 20 1 0 9912 0

I 2 2 3 1 2 1 2 0 0 9872

Each element of the matrix shows the probability that an originalamino acid (top) will be replaced by another amino acid (side)

A substitution matrix contains values proportional to the probability that amino acid i mutates into amino acid j for all pairs of amino acids.

Substitution matrices are constructed by assembling a large and diverse sample of verified pairwise alignments(or multiple sequence alignments) of amino acids. Substitution matrices should reflect the true probabilities of mutations occurring through a period of evolution.

The two major types of substitution matrices arePAM and BLOSUM.

Substitution Matrix

PAM matrices are based on global alignments of closely related proteins.

The PAM1 is the matrix calculated from comparisons of sequences with no more than 1% divergence. At an evolutionary interval of PAM1, one change has occurred over a length of 100 amino acids.

Other PAM matrices are extrapolated from PAM1. For PAM250, 250 changes have occurred for two proteins over a length of 100 amino acids.

All the PAM data come from closely related proteins(>85% amino acid identity).

PAM matrices:Point-accepted mutations

Why do we go from a mutation probabilitymatrix to a log odds matrix?

• We want a scoring matrix so that when we do a pairwise alignment (or a BLAST search) we know what score to assign to two aligned amino acid residues.

• Logarithms are easier to use for a scoring system. They allow us to sum the scores of aligned residues (rather than having to multiply them).

How do we go from a mutation probabilitymatrix to a log odds matrix?

• The cells in a log odds matrix consist of an “odds ratio”:

the probability that an alignment is authenticthe probability that the alignment was random

The score S for an alignment of residues a,b is given by:

S(a,b) = 10 log10 (Mab/pb)

As an example, for tryptophan,

S(a,tryptophan) = 10 log10 (0.55/0.010) = 17.4 Page 57

Normalized frequencies of amino acids

Arg 4.1%Asn 4.0%Phe 4.0%Gln 3.8%Ile 3.7%His 3.4%Cys 3.3%Tyr 3.0%Met 1.5%Trp 1.0%

A R N D C Q E G H I L K M F P S T W Y V A 13 6 9 9 5 8 9 12 6 8 6 7 7 4 11 11 11 2 4 9

R 3 17 4 3 2 5 3 2 6 3 2 9 4 1 4 4 3 7 2 2

N 4 4 6 7 2 5 6 4 6 3 2 5 3 2 4 5 4 2 3 3

D 5 4 8 11 1 7 10 5 6 3 2 5 3 1 4 5 5 1 2 3

C 2 1 1 1 52 1 1 2 2 2 1 1 1 1 2 3 2 1 4 2

Q 3 5 5 6 1 10 7 3 7 2 3 5 3 1 4 3 3 1 2 3

E 5 4 7 11 1 9 12 5 6 3 2 5 3 1 4 5 5 1 2 3

G 12 5 10 10 4 7 9 27 5 5 4 6 5 3 8 11 9 2 3 7

H 2 5 5 4 2 7 4 2 15 2 2 3 2 2 3 3 2 2 3 2

I 3 2 2 2 2 2 2 2 2 10 6 2 6 5 2 3 4 1 3 9

L 6 4 4 3 2 6 4 3 5 15 34 4 20 13 5 4 6 6 7 13

K 6 18 10 8 2 10 8 5 8 5 4 24 9 2 6 8 8 4 3 5

M 1 1 1 1 0 1 1 1 1 2 3 2 6 2 1 1 1 1 1 2

F 2 1 2 1 1 1 1 1 3 5 6 1 4 32 1 2 2 4 20 3

P 7 5 5 4 3 5 4 5 5 3 3 4 3 2 20 6 5 1 2 4

S 9 6 8 7 7 6 7 9 6 5 4 7 5 3 9 10 9 4 4 6

T 8 5 6 6 4 5 5 6 4 6 4 6 5 3 6 8 11 2 3 6

W 0 2 0 0 0 0 0 0 1 0 1 0 0 1 0 1 0 55 1 0

Y 1 1 2 1 3 1 1 1 3 2 2 1 2 15 1 2 2 3 31 2

V 7 4 4 4 4 4 4 5 4 15 10 4 10 5 5 5 7 2 4 17

What do the numbers meanin a log odds matrix?

S(a,tryptophan) = 10 log10 (0.55/0.010) = 17.4

A score of +17 for tryptophan means that this alignmentis 50 times more likely than a chance alignment of twoTrp residues.

S(a,b) = 17Probability of replacement (Mab/pb) = xThen17 = 10 log10 x1.7 = log10 x101.7 = x = 50 Page 58

What do the numbers meanin a log odds matrix?

A score of +2 indicates that the amino acid replacementoccurs 1.6 times as frequently as expected by chance.

A score of 0 is neutral.

A score of –10 indicates that the correspondence of two amino acids in an alignment that accurately representshomology (evolutionary descent) is one tenth as frequentas the chance alignment of these amino acids.

A 2 R -2 6 N 0 0 2 D 0 -1 2 4 C -2 -4 -4 -5 12 Q 0 1 1 2 -5 4 E 0 -1 1 3 -5 2 4 G 1 -3 0 1 -3 -1 0 5 H -1 2 2 1 -3 3 1 -2 6 I -1 -2 -2 -2 -2 -2 -2 -3 -2 5 L -2 -3 -3 -4 -6 -2 -3 -4 -2 -2 6 K -1 3 1 0 -5 1 0 -2 0 -2 -3 5 M -1 0 -2 -3 -5 -1 -2 -3 -2 2 4 0 6 F -3 -4 -3 -6 -4 -5 -5 -5 -2 1 2 -5 0 9 P 1 0 0 -1 -3 0 -1 0 0 -2 -3 -1 -2 -5 6 S 1 0 1 0 0 -1 0 1 -1 -1 -3 0 -2 -3 1 2 T 1 -1 0 0 -2 -1 0 0 -1 0 -2 0 -1 -3 0 1 3 W -6 2 -4 -7 -8 -5 -7 -7 -3 -5 -2 -3 -4 0 -6 -2 -5 17 Y -3 -4 -2 -4 0 -4 -4 -5 0 -1 -1 -4 -2 7 -5 -3 -3 0 10 V 0 -2 -2 -2 -2 -2 -2 -1 -2 4 2 -2 2 -1 -1 -1 0 -6 -2 4 A R N D C Q E G H I L K M F P S T W Y V

R -10 9

N -7 -9 9

D -6 -17 -1 8

C -10 -11 -17 -21 10

Q -7 -4 -7 -6 -20 9

E -5 -15 -5 0 -20 -1 8

G -4 -13 -6 -6 -13 -10 -7 7

H -11 -4 -2 -7 -10 -2 -9 -13 10

I -8 -8 -8 -11 -9 -11 -8 -17 -13 9

L -9 -12 -10 -19 -21 -8 -13 -14 -9 -4 7

K -10 -2 -4 -8 -20 -6 -7 -10 -10 -9 -11 7

M -8 -7 -15 -17 -20 -7 -10 -12 -17 -3 -2 -4 12

F -12 -12 -12 -21 -19 -19 -20 -12 -9 -5 -5 -20 -7 9

P -4 -7 -9 -12 -11 -6 -9 -10 -7 -12 -10 -10 -11 -13 8

S -3 -6 -2 -7 -6 -8 -7 -4 -9 -10 -12 -7 -8 -9 -4 7

T -3 -10 -5 -8 -11 -9 -9 -10 -11 -5 -10 -6 -7 -12 -7 -2 8

W -20 -5 -11 -21 -22 -19 -23 -21 -10 -20 -9 -18 -19 -7 -20 -8 -19 13

Y -11 -14 -7 -17 -7 -18 -11 -20 -6 -9 -10 -12 -17 -1 -20 -10 -9 -8 10

V -5 -11 -12 -11 -9 -10 -10 -9 -9 -1 -5 -13 -4 -12 -9 -10 -6 -22 -10 8

Rat versus mouse RBP

Rat versus bacteriallipocalin

More conserved Less conserved

Comparing two proteins with a PAM1 matrixgives completely different results than PAM250!

Consider two distantly related proteins. A PAM40 matrixis not forgiving of mismatches, and penalizes themseverely. Using this matrix you can find almost no match.

A PAM250 matrix is very tolerant of mismatches.

hsrbp, 136 CRLLNLDGTC btlact, 3 CLLLALALTC * ** * **

24.7% identity in 81 residues overlap; Score: 77.0; Gap frequency: 3.7% rbp4 26 RVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDV btlact 21 QTMKGLDIQKVAGTWYSLAMAASD-ISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWEN * **** * * * * ** *

rbp4 86 --CADMVGTFTDTEDPAKFKM btlact 80 GECAQKKIIAEKTKIPAVFKI ** * ** ** Page 60

two nearly identical proteins

two distantly related proteins

BLOSUM matrices are based on local alignments.

BLOSUM stands for blocks substitution matrix.

BLOSUM62 is a matrix calculated from comparisons of sequences with no less than 62% divergence.

BLOSUM Matrices

BLOSUM62

BLOSUM Matrices

BLOSUM62

BLOSUM30

BLOSUM80

All BLOSUM matrices are based on observed alignments; they are not extrapolated from comparisons of closely related proteins.

The BLOCKS database contains thousands of groups ofmultiple sequence alignments.

BLOSUM62 is the default matrix in BLAST 2.0. Though it is tailored for comparisons of moderately distant proteins, it performs well in detecting closer relationships. A search for distant relatives may be more sensitive with a different matrix.

BLOSUM Matrices

A 4R -1 5N -2 0 6D -2 -2 1 6C 0 -3 -3 -3 9Q -1 1 0 0 -3 5E -1 0 0 2 -4 2 5G 0 -2 0 -1 -3 -2 -2 6H -2 0 1 -1 -3 0 0 -2 8I -1 -3 -3 -3 -1 -3 -3 -4 -3 4L -1 -2 -3 -4 -1 -2 -3 -4 -3 2 4K -1 2 0 -1 -1 1 1 -2 -1 -3 -2 5M -1 -2 -2 -3 -1 0 -2 -3 -2 1 2 -1 5F -2 -3 -3 -3 -2 -3 -3 -3 -1 0 0 -3 0 6P -1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4 7S 1 -1 1 0 -1 0 0 0 -1 -2 -2 0 -1 -2 -1 4T 0 -1 0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1 1 5W -3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1 1 -4 -3 -2 11Y -2 -2 -2 -3 -2 -1 -2 -3 2 -1 -1 -2 -1 3 -3 -2 -2 2 7V 0 -3 -3 -3 -1 -2 -2 -3 -3 3 1 -2 1 -1 -2 -2 0 -3 -1 4

Blosum62 scoring matrix

A 4 R -1 5 N -2 0 6 D -2 -2 1 6 C 0 -3 -3 -3 9 Q -1 1 0 0 -3 5 E -1 0 0 2 -4 2 5 G 0 -2 0 -1 -3 -2 -2 6 H -2 0 1 -1 -3 0 0 -2 8 I -1 -3 -3 -3 -1 -3 -3 -4 -3 4 L -1 -2 -3 -4 -1 -2 -3 -4 -3 2 4 K -1 2 0 -1 -1 1 1 -2 -1 -3 -2 5 M -1 -2 -2 -3 -1 0 -2 -3 -2 1 2 -1 5 F -2 -3 -3 -3 -2 -3 -3 -3 -1 0 0 -3 0 6 P -1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4 7 S 1 -1 1 0 -1 0 0 0 -1 -2 -2 0 -1 -2 -1 4 T 0 -1 0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1 1 5 W -3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1 1 -4 -3 -2 11 Y -2 -2 -2 -3 -2 -1 -2 -3 2 -1 -1 -2 -1 3 -3 -2 -2 2 7 V 0 -3 -3 -3 -1 -2 -2 -3 -3 3 1 -2 1 -1 -2 -2 0 -3 -1 4 A R N D C Q E G H I L K M F P S T W Y V

Rat versus mouse globin

Rat versus bacterialglobin

Evolutionary distance in PAMs

Two randomly diverging protein sequences changein a negatively exponential fashion

“twilight zone”

Differences per 100 residues

At PAM1, two proteins are 99% identicalAt PAM10.7, there are 10 differences per 100 residuesAt PAM80, there are 50 differences per 100 residues

At PAM250, there are 80 differences per 100 residues

“twilight zone”

PAM: “Accepted point mutation”

• Two proteins with 50% identity may have 80 changesper 100 residues. (Why? Because any residue can besubject to back mutations.)

• Proteins with 20% to 25% identity are in the “twilight zone”and may be statistically significantly related.

• PAM or “accepted point mutation” refers to the “hits” or matches between two sequences (Dayhoff & Eck, 1968)

Ancestral sequence

Sequence 1ACCGATC

Sequence 2AATAATC

A no change AC single substitution C --> AC multiple substitutions C --> A --> TC --> G coincidental substitutions C --> AT --> A parallel substitutions T --> AA --> C --> T convergent substitutions A --> TC back substitution C --> T --> C

ACCCTAC

Li (1997) p.70

Percent identity between two proteins:What percent is significant?

100%80%65%30%23%19%

We will see in the BLAST lecture that it is appropriate to describe significance in terms of probability (or expect) values.As a rule of thumb, two proteins sharing > 30% over a substantial region are usually homologous.

An alignment scoring system is required to evaluate how good an alignment is

• positive and negative values assigned

• gap creation and extension penalties

• positive score for identities

• some partial positive score for conservative substitutions

• global versus local alignment

• use of a substitution matrix

Calculation of an alignment score

We will first consider the global alignment algorithmof Needleman and Wunsch (1970).

We will then explore the local alignment algorithmof Smith and Waterman (1981).

Finally, we will consider BLAST, a heuristic versionof Smith-Waterman. We will cover BLAST in detailon Monday.

Two kinds of sequence alignment: global and local

• Two sequences can be compared in a matrix along x- and y-axes.

• If they are identical, a path along a diagonal can be drawn

• Find the optimal subpaths, and add them up to achieve the best score. This involves

--adding gaps when needed--allowing for conservative substitutions--choosing a scoring system (simple or complicated)

• N-W is guaranteed to find optimal alignment(s)

Global alignment with the algorithmof Needleman and Wunsch (1970)

[1] set up a matrix

[2] score the matrix

[3] identify the optimal alignment(s)

Three steps to global alignment with the Needleman-Wunsch algorithm

[1] identity (stay along a diagonal)[2] mismatch (stay along a diagonal)[3] gap in one sequence (move vertically!)[4] gap in the other sequence (move horizontally!)

Four possible outcomes in aligning two sequences

Fill in the matrix starting from the bottom right

sequence 1 ABCNJ-RQCLCR-PMsequence 2 AJC-JNR-CKCRBP-

sequence 1 ABC-NJRQCLCR-PMsequence 2 AJCJN-R-CKCRBP-

N-W is guaranteed to find optimal alignments, although the algorithm does not search all possible alignments.

It is an example of a dynamic programming algorithm:an optimal path (alignment) is identified byincrementally extending optimal subpaths.Thus, a series of decisions is made at each step of thealignment to find the pair of residues with the best score.

Needleman-Wunsch: dynamic programming

Try using needle to implement a Needleman-Wunsch global alignment algorithm to find the optimum alignment (including gaps):

http://www.ebi.ac.uk/emboss/align/

Queries:beta globin (NP_000509)alpha globin (NP_000549)

Global alignment (Needleman-Wunsch) extendsfrom one end of each sequence to the other.

Local alignment finds optimally matching regions within two sequences (“subsequences”).

Local alignment is almost always used for databasesearches such as BLAST. It is useful to find domains(or limited regions of homology) within sequences.

Smith and Waterman (1981) solved the problem of performing optimal local sequence alignment. Othermethods (BLAST, FASTA) are faster but less thorough.

Global alignment versus local alignment

Rapid, heuristic versions of Smith-Waterman:FASTA and BLAST

Smith-Waterman is very rigorous and it is guaranteedto find an optimal alignment.

But Smith-Waterman is slow. It requires computerspace and time proportional to the product of the twosequences being aligned (or the product of a query against an entire database).

Gotoh (1982) and Myers and Miller (1988) improved thealgorithms so both global and local alignment requireless time and space.

FASTA and BLAST provide rapid alternatives to S-W.

How FASTA works

[1] A “lookup table” is created. It consists of short stretches of amino acids (e.g. k=3 for a protein search). The length of a stretch is called a k-tuple. The FASTA algorithm finds the ten highest scoring segments that align to the query.

[2] These ten aligned regions are re-scored with a PAM or BLOSUM matrix.

[3] High-scoring segments are joined.

[4] Needleman-Wunsch or Smith-Waterman is then performed.

Statistical significance of pairwise alignment

We will discuss the statistical significance of alignment scores in the next lecture (BLAST). A basic question is how to determine whether a particular alignment score is likely to have occurred by chance. According to the null hypothesis, two aligned sequences are not homologous (evolutionarily related). Can we reject the null hypothesis at a particular significance level alpha?

True positives False positives

False negatives

Sequences reportedas related

Sequences reportedas unrelated

True negatives

False negatives

True negatives

homologoussequences

non-homologoussequences

False negatives

True negatives

homologoussequences

non-homologoussequences

Sensitivity:ability to findtrue positives

Specificity:ability to minimize

false positives

RBP: 26 RVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWD- 84 + K++ + + +GTW++MA + L + A V T + +L+ W+ glycodelin: 23 QTKQDLELPKLAGTWHSMAMA-TNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWEN 81

Randomization test: scramble a sequence

• First compare two proteins and obtain a score

• Next scramble the bottom sequence 100 times,and obtain 100 “randomized” scores (+/- standard deviation)

• Composition and length are maintained

• If the comparison is “real” we expect the authentic score to be several standard deviations above the mean of the “randomized” scores

1 10 19 28 37

100 random shufflesMean score = 8.4Std. dev. = 4.5

Quality score

A randomization test shows that RBP is significantly related to -lactoglobulin

Real comparisonScore = 37

But this test assumes a normal distribution of scores!In the BLAST lecture we will consider the distributionof scores and more appropriate significance tests.

You can perform this randomization test using the UVA FASTA programs(http://fasta.bioch.virginia.edu/).

Z = (Sreal – Xrandomized score) standard deviation

The PRSS program performsa scramble test for you(http://fasta.bioch.virginia.edu/fasta/prss.htm)

Badscores

Good scores

But these scores are notnormally distributed!

pairwise sequence alignment. pairwise alignment: protein sequences can be more informative than dna...

lactoglobulin slide

definitions slide

dna protein

chance slide

protein sequences

dna alignments

time dna sequences

alignment overview

Documents

pairwise sequence alignment (i)

lecture 2 pairwise alignment - tau

overview of pairwise sequence alignment

pairwise...

pairwise sequence alignment

pairwise sequence alignment homology, score matrix

1 pairwise sequence alignment algorithms elya flax & inbar...

pairwise alignment (bioinformatics)

developing pairwise sequence alignment algorithms

cs123a three pairwise alignment f2012 - sjsu

pairwise alignment course - verify your cloning

lecture 2 pairwise alignment - tel aviv...

from pairwise to multiple alignment

pairwise alignment · 2014. 4. 3. · pairwise alignment:...

pairwise alignment global & local alignment

sequence alig sequence alignment pairwise alignment:-

pairwise sequence alignment and database search

pairwise alignment

pairwise sequence alignment exercise 2

dynamic programming for pairwise alignment 2