charakterisierung der primärstruktur - agilent
TRANSCRIPT
![Page 1: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/1.jpg)
Charakterisierung der Primärstruktur
rekombinanter Proteine mittels „Peptide
Mapping“ und „Intact Protein Analysis“
Moritz Wagner
Waldbronn
![Page 2: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/2.jpg)
mAb Structure
Light Chain
Fc
Fab
Antigen
binding
Hinge
Glycosylation
siteTruncation
(lysine)
Disulfide
shuffling
Pyroglutamate
Deamidation/oxidation
Heavy Chain
Fucose – 146 Da
Mannose – 162 Da
N-Acetylglucosamine – 203 Da
Galactose – 162 Da
1299.3G0
1445.4G0F
1607.5G1F
1769.6G2F
Average massStructureGlycan
![Page 3: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/3.jpg)
The Agilent Toolbox for Biologic Characterization
Intact Antibody characterization and sizing (accurate mass)
• Instrumentation: Q-TOF, TOF, CE, CE-MS
• HPLC Columns: Poroshell 300, Zorbax SB 300
Peptide mapping (resolution, resolution per time, Bioconfirm SW)
• Q-TOF- 1290 Infinity, Q-TOF-1260 RRLC, RRLC-UV
• HPLC Columns: Eclipse plus or Poroshell 120
Charge variants (resolution of charge variants)
• Bio-inert HPLC-UV, CE
• Bio HPLC Columns: Bio Mab WCX, Bio IEX
Aggregate analysis (resolution of monomers and multimers)
• Bio-inert HPLC UV, CE
• HPLC Columns: Bio SEC
Glycan analysis (confirmation of glycan pattern, detection and separation of variant)
• CE,CE-MS, mAB-Glyco-Chip, LC-MS, LC
![Page 4: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/4.jpg)
Agilent’s Biologic Characterization and QA/QC Solutions
Glycan Analysis
mAb-Glyco-Chip + Chip LC/MS
Capillary ElectrophoresisHPLC/FLDMALDI MS
Oligonucleotides
Reversed Phase or Ion Exchange columns + LC/UV
or LC/MS
Amino Acids
Reversed Phase columns , derivitization , eluents and
standards + LC/UV or LC/MS
Peptide Characterization/
Mapping
LC/MS RP Columns + LC/UV
Oxidation
LC/MS or CE/MS
HIC and Reversed Phase Columns + LC/UV or LC/MS
Charge Variants
Ion Exchange Columns + LC/UV
Agilent CE + CE Kits
Agilent CE/MS + CE Kits
Biologic Molecular Weight Determination
Reversed Phase Columns + LC/UV or LC/MS
CE/MS
Aggregation
Size Exclusion Columns + HPLC/UV
![Page 5: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/5.jpg)
Agilent’s LC/MS systems for biopharma applications
•Intact protein analysis
•Peptide mapping
•PTM analysis
•Intact protein analysis
•Peptide mapping
•PTM analysis
•Glycan analysis
![Page 6: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/6.jpg)
Intact Protein Analysis
Accurate Mass TOF, QTOF
1290 Infinity HPLC, nano LC with HPLC-chip
![Page 7: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/7.jpg)
Measure intact mAb molecular weight using Q-TOF
![Page 8: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/8.jpg)
Accurate Mass Measurement on Agilent TOF/Q-TOF
Mcalc Mexp Error (ppm)
Intact
major glycoform148,811.95 148,812.81 5.8
deglycosylated 145,923.24 145,924.41 8
Light chain 23,746.63 23,746.50 5.5
Heavy chain
major glycoform50,675.47 50,675.58 2.2
Fc
major glycoform52,755.62 52,755.64 0.4
FAB 48,046.18 48,046.09 1.8
![Page 9: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/9.jpg)
Delta mass ruler label the distance between peaks as mass, amino
acid or modifications. It helps the user to quickly decipher the
relationship of the two peaks.
Delta mass ruler / amino acid ruler / modification ruler
![Page 10: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/10.jpg)
Peptide Mapping and PTM
Characterization Using Agilent Q-TOF
and BioConfirm Software
Accurate Mass TOF, QTOF
1290 Infinity HPLC, nano LC with HPLC-chip
![Page 11: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/11.jpg)
MassHunter Acq for TOF/Q-TOF B.04.00
Improved Decision Engine for Data-Dependent MS/MS
• The scan speed (no. of transients/spectrum) is varied based on the MS1
precursor ion abundance
• “Target counts/spectrum” refers to the MS2 TIC. A higher value will
increase the accumulation time
![Page 12: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/12.jpg)
MassHunter Acq for TOF/Q-TOF B.04.00
Improved Decision Engine for Data-Dependent MS/MS
• If “Use MS/MS accumulation time limit” is checked, the accumulation of
transients will stop, even if the selected “Target counts / MSMS spectrum”
requires longer accumulation
• If “Reject precursors that cannot reach target TIC within time limit” is
checked, MS1 precursor ion abundances that cannot create the selected
“Target counts / MSMS spectrum” within the time limit, will be ignored and
instead the next precursor chosen by the decision engine will be fragmented.
![Page 13: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/13.jpg)
MassHunter Acq for TOF/Q-TOF B.04.00
Improved Decision Engine for Data-Dependent MS/MS
• The new “Purity” parameter determines the intensity of a precursor ion
candidate relative to the total ion intensity in the selected isolation
window (1.3, 4.0, 9.0 amu).
4 amu
![Page 14: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/14.jpg)
MassHunter Acq for TOF/Q-TOF B.04.00
Improved Decision Engine for Data-Dependent MS/MS
• There is now more flexibility in setting collision energies for both data-
dependent and targeted MS/MS experiments.
• With the “Use Formula” feature, any function for collision energy over
mass can be defined, based on different charge states.
• The picture below shows an example for data dependent MS/MS
acquisition with 5 different collision energies for +2 charged ions,
depending on their m/z value.
![Page 15: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/15.jpg)
MassHunter Acq for TOF/Q-TOF B.04.00
Improved Decision Engine for Data-Dependent MS/MS
• The “Use Fixed Collision Energies” or the “Use Formula” option can
be used to set up automatic acquisition at 3 collision energies for
automated PCDL search for data dependent, targeted and the new
directed MS/MS acquisition *)
• “Directed MS/MS” is a special mode of data-dependent MS/MS, where
the decision engine will ONLY do MS/MS experiments on precursor
ions in the preferred list. RT and delta RT setting will be honored ! *)
![Page 16: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/16.jpg)
100% sequence coverage of heavy and light chain
Peptide MappingPeptide Map of mAb tryptic digest using Poroshell 120 column
Thin layer of
porous silica on a
solid core enables
peptides and
proteins to elute as
narrow bands at
high flow rates
![Page 17: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/17.jpg)
Peptide Mass Accuracy
light chain A(112-130) 2101.1245 2101.1208 1.76
light chain A(113-130) 1945.0199 1945.0197 0.09
light chain A(131-146) 1796.8922 1796.888 2.38
light chain A(150-173) 2676.2669 2676.2627 1.55
light chain A(150-187) 4160.01 4160.0033 1.61
light chain A(154-173) 2134.9657 2134.9615 1.99
light chain A(193-211) 2140.0778 2140.0735 1.99
light chain A(195-211) 1874.9254 1874.9197 3.06
Sequence
NameLabel Mass
Target
Sequence
Mass
Match
Difference
(ppm)
light chain A(1-19) 1996.088 1996.0841 1.98
light chain A(26-47) 2438.1986 2438.1979 0.31
light chain A(48-56) 992.5656 992.5655 0.15
light chain A(64-93) 3388.5238 3388.5194 1.31
light chain A(94-107) 1538.7191 1538.7154 2.43
Sequence Name Label MassTarget Sequence
Mass
Match Difference
(ppm)
heavy chain A(1-19) 1880.0511 1880.048 1.65
heavy chain A(20-38) 2126.9587 2126.9554 1.56
heavy chain A(39-67) 2927.4492 2927.4414 2.68
heavy chain A(39-65) 2714.3216 2714.3188 1.05
heavy chain A(44-65) 2233.0584 2233.0539 2
heavy chain A(44-67) 2446.1802 2446.1765 1.51
heavy chain A(66-72) 835.4663 835.4664 -0.11
heavy chain A(68-72) 622.3431 622.3439 -1.28
heavy chain A(73-87) 1768.8812 1768.8778 1.93
heavy chain A(77-87) 1324.6816 1324.6809 0.51
heavy chain A(88-98) 1317.5937 1317.5911 2
heavy chain A(99-105) 714.4018 714.4024 -0.94
heavy chain A(106-129) 2531.2534 2531.2479 2.2
heavy chain A(107-129) 2375.1509 2375.1468 1.74
heavy chain A(130-141) 1185.6426 1185.6394 2.72
heavy chain A(142-155) 1320.6705 1320.6708 -0.21
heavy chain A(156-218) 6712.309 6712.3072 0.27heavy chain A(156-221) 7054.4995 7054.4975 0.28
heavy chain A(156-222) 7182.5962 7182.5925 0.52
heavy chain A(227-256) 3333.643 3333.6349 2.45
heavy chain A(231-256) 2843.4544 2843.4503 1.45
heavy chain A(257-263) 834.4274 834.4269 0.55
heavy chain A(264-282) 2138.0249 2138.0202 2.22
heavy chain A(283-296) 1676.7985 1676.7947 2.25
heavy chain A(297-309) 3115.3418 3115.3315 2.13
heavy chain A(310-325) 1807.0038 1806.9992 2.51
heavy chain A(310-328) 2227.2034 2227.2001 1.5
heavy chain A(335-342) 837.496 837.496 0
heavy chain A(347-368) 2509.3347 2509.3289 2.32
heavy chain A(349-368) 2310.1993 2310.1968 1.08
heavy chain A(353-363) 1285.6677 1285.6667 0.79
heavy chain A(353-368) 1871.9648 1871.9629 1.03
heavy chain A(369-378) 1160.6228 1160.6223 0.4
heavy chain A(379-400) 2543.1289 2543.1241 1.9
heavy chain A(401-417) 1872.9184 1872.9146 2.06
heavy chain A(423-447) 3043.3964 3043.393 1.12
heavy chain A(425-447) 2800.2679 2800.2598 2.89
heavy chain A(448-454) 659.3488 659.349 -0.35
Average Error = 1.3ppm
![Page 18: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/18.jpg)
Extract MS/MS spectraUnder find by MFE, results tab, a
new section of extracting MS/MS
spectrum:
MS score
contribution
MS/MS score
contribution
Contribution
to the
MS/MS
score
Under match sequences, a new
tab „scoring‟ is added
![Page 19: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/19.jpg)
MassHunter BioConfirm Software
•Allows multiple enzyme digest
•Missed cleavage
•More than 80 predefined
modifications in the chemical data
dictionary
•Allows user defined modifications
•Allows C13, N15, O18, D labeled
amino acid
![Page 20: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/20.jpg)
MassHunter Bioconfirm Software
Matching rules allow incomplete
digest, predicted modifications
and DNA point mutation
![Page 21: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/21.jpg)
Table view and spectrum view
Product ion assignment
Product ion label
![Page 22: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/22.jpg)
MassHunter BioConfirm B.04.00 More confidence with MS/MS support
Digest sequence: TSPYVLPVPFLNVLNGGSHAGGALALQEFMIAPTGAK, match compound at 3752 Da
with 1* Oxidation predicted modification, with MSMS support, we can identify the location of predicted
modification, find out the Oxidation is on M at A171, not on H at A160 because of MSMSScore(70 vs. 49)
Unique ions
confirm Oxidation
at Met at pos. 171
Identify the predicted
modification location
![Page 23: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/23.jpg)
Delta mass ruler label the distance between peaks as mass,
amino acid or modifications. It helps the user to quickly
decipher the relationship of the two peaks.
Delta mass ruler / amino acid ruler / modification ruler
![Page 24: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/24.jpg)
MassHunter BioConfirm B.04.00 Compare two samples to find and visualize the difference
Coloring whether
found in Sample,
Reference or both
Mirror plot of TIC,
ECC, BPC, TCC
Compare MS and
MS/MS spectra
underneath each
other
Visualize sequence
coverage in both
samples
![Page 25: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/25.jpg)
Forced Oxidation Study
Using Agilent Q-TOF
Mass Profiler Pro and BioConfirm Software
![Page 26: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/26.jpg)
Comparison at Peptide Digest Level
![Page 27: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/27.jpg)
Using Mass Profiler Pro to Analyze Large Batch of Samples
PCA plot of different oxidation conditions
•Principal component analysis (PCA) is a clustering tool often applied to reduce the dimensionality of complex data sets.
•The result for the oxidation samples demonstrates correct grouping of the technical replicates and clear separation between different concentrations of t-BHP treated mAbs.
•It is clearly observed that control (cyan) and 0.1% (red) are well separated as compared with other oxidized samples.
![Page 28: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/28.jpg)
Using BioConfirm Qualitative Comparison to
Compare Sample One to One
Common
featuresReference Sample
R
S
R
S
SR
mirror
Table
MS spectra
MS/MS spectraChromatograms
![Page 29: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/29.jpg)
Unmodified peptide
R
S
R
S
SR
![Page 30: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/30.jpg)
Single oxidation
R
S
R
S
SR
![Page 31: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/31.jpg)
Double oxidation
R
S
R
S
SR
![Page 32: Charakterisierung der Primärstruktur - Agilent](https://reader034.vdocuments.net/reader034/viewer/2022042120/625817b18c901369505c95b6/html5/thumbnails/32.jpg)
MassHunter BioConfirm B04
Improve result quality with confidence
•Combining MS mass accuracy and MS/MS product ion assignment to reduce FP
•Improve MaxEnt deconvolution for intact protein analysis
Help user to predict the unexpected modifications
•Protein truncation
•Modification and amino acid caliper
•Mass/subsequence search
•Mix/match predicated modifications
•Non-specific enzyme digestion
Comparative analysis
•Allow easy comparison between reference control and multiple samples
•Peptide centric table
•Mirror plot for entire sample as well as individual peptide
This information is subject to
change without notice
© Agilent Technologies, Inc. 2011
Published in Germany, July 2011