![Page 1: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/1.jpg)
A novel active DNA topoisomerase I in Leishmania donovani
Héctor Villa a *, Ana R. Otero Marcos a *, Rosa M. Reguera a, Rafael Balaña-Fouce a ,
Carlos García-Estrada a , Yolanda Pérez-Pertejo a , Babu L. Tekwanib, Peter J. Myler c ,
Kenneth D. Stuart c , Mary-Ann Bjornsti d , David Ordóñez a.
a Departamento de Farmacología y Toxicología, (INTOXCAL) Universidad de León,
Campus de Vegazana s/n, 24071 León, Spain
b National Center for Natural Products Research, School of Pharmacy, University of
Mississippi, MS, 38677 USA
c Seattle Biomedical Research Institute, 4 Nickerson Street, Seattle, WA, 98195, USA
d Molecular Pharmacology, St. Jude Children´s Research Hospital, Memphis, TN,
38105, USA
*Both authors contributed equally to the work
#To whom correspondence and proofs should be sent: Dr. David Ordóñez
Departamento de Farmacología y Toxicología, (INTOXCAL) Universidad de León,
Campus de Vegazana s/n, 24071 León, Spain. Telephone: 34 987 291 257, Fax: 34 987
291 590
Email: [email protected]
Running Title: A novel DNA topoisomerase I in Leishmania
Copyright 2002 by The American Society for Biochemistry and Molecular Biology, Inc.
JBC Papers in Press. Published on November 19, 2002 as Manuscript M203991200 by guest on M
arch 26, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 2: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/2.jpg)
3
ABSTRACT
A common feature shared by type I DNA topoisomerases is the presence of a “serine,
lysine, X, X, tyrosine” motif as conventional enzyme active site. Preliminary data have
shown that Leishmania donovani DNA topoisomerase I gene (LdTOP1A) lacked this
conserved motif, giving rise to different theories about the reconstitution of an active
DNA topoisomerase I in this parasite. We, herein, describe the molecular cloning of a
new DNA topoisomerase I gene from L. donovani (LdTOP1B) containing the highly
conserved “serine, lysine, X, X, tyrosine” motif. DNA topoisomerase I activity was
detected only when both genes (LdTOP1A and LdTOP1B) were co-expressed in a yeast
expression system, suggesting the existence of a dimeric DNA topoisomerase I in
leishmania parasites.
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 3: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/3.jpg)
4
INTRODUCTION
DNA topoisomerases are ubiquitous enzymes that catalyze changes in DNA topology
by altering the linkage of DNA strands, solving topological problems caused by cellular
processes such as DNA replication, transcription or recombination (1, 2). These
enzymes are classified on the basis of the number of DNA strands that they cleave, and
the covalent bond formed in the enzyme-DNA intermediate. Unlike type II DNA
topoisomerases, type I enzymes are ATP-independent which transiently break a single
strand of DNA. Type I DNA topoisomerases are classified into two subfamilies: type IA
and type IB. The enzymes of type IA subfamily, including bacterial DNA
topoisomerase I and III, eukaryotic DNA topoisomerase III, and reverse gyrase (3-4),
form a tyrosyl linkage with a 5´-phosphate group of one of the DNA strands generated
due to the enzyme action (2), whereas the enzymes of type IB subfamily, including
eukaryotic and vaccinia virus DNA topoisomerases I (5) and DNA topoisomerase V,
establish the tyrosyl bond with the 3´-phosphate group (2). Type 1A topoisomerases
relax only negatively supercoiled-DNA with Mg2+ requirement, whereas type IB
topoisomerases relax both, negatively and positively supercoiled-DNA even in the
absence of a metallic cofactor, although Mg2+ and Ca2+ stimulate the relaxation activity
(6-7).
Type IB DNA topoisomerases are monomeric enzymes, constituted by four domains (8-
9). The nonconserved amino-terminal domain contains putative signals for nuclear
localization of the enzyme. The largest domain, the core, is essential for enzyme activity
and shows high phylogenetic conservation, particularly in the residues closely
interacting with DNA. The third domain is known as the linker, which is poorly
conserved and highly variable in length and is not essential for the enzyme activity.
Finally, the carboxy-terminal domain is highly conserved and crucial for the catalytic
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 4: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/4.jpg)
5
activity. This domain contains a tyrosine residue (Tyr723 in the human topoisomerase I)
which interacts with one of the DNA strands, creating a transient covalent
phosphodiester bond between the enzyme and the DNA.
A type I DNA topoisomerase has been purified and characterized from L. donovani
promastigotes, the causative agent for visceral leishmaniasis (10). Topoisomerases have
been shown as the promising targets for new drug development against leishmaniasis
(11). A DNA topoisomerase IB like gene (LdTOP1A) which encodes for a protein
lacking the conventional active site “SKXXY” motif has been characterized in L.
donovani. However, heterologous expression of LdTOP1A gene in E. coli produced an
inactive protein (12).
The present paper describes the molecular cloning and functional expression of a novel
DNA topoisomerase I from L. donovani. Unlike type I DNA topoisomerases from
several other organisms, the leishmanial enzyme is encoded by two different genes
(LdTOP1A and LdTOP1B) located at two different chromosomes, and the polypeptide
encoded by LdTOP1B gene contains the conserved “SKXXY” motif required for
activity. This, to our knowledge, is the first report in which two different genes code for
an active DNA topoisomerase I.
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 5: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/5.jpg)
6
MATERIALS AND METHODS
Materials – Media and reagents were purchased from Sigma (St. Louis, MO). Primers
were purchased from Amersham.
Leishmania and Yeast Strains – For protein expression Saccharomyces cerevisiae
strain EKY3 [MAT α ura3-52 his3∆200 leu2 ∆1 trp1 ∆63 top1 ∆::TRP1], deficient in
DNA topoisomerase I activity, was used. Leishmania donovani strain LSB-51.1
(MHOM/SD/00/Khartoum) was maintained as promastigotes at 26ºC in Schneider's
Insect Medium containing 10% foetal bovine serum (BRL Life Technologies),
penicillin (50 U/ml) and streptomycin (50 µg/ml).
Cloning of DNA topoisomerase I - To generate a DNA probe for isolation of the L.
donovani LdTOP1A gene (GenBank accession number AF303577), 100 pmol of two
degenerated primers based on sequence homology alignments: 5´-
GAT/CACGATCGTCGGT/CTGCTG-3´(sense) corresponding to amino acid residues
DTVGCC and 5´-GTAG/CGTA/GCGGAACACCTT-3´(antisense) coding to the
conserved sequence KVFRTY, were added to a reaction mixture containing 100 ng of
leishmania genomic DNA, 200 µM of each dNTP and 2.5 U of Taq DNA polymerase
(Stratagene). A single 264 bp-PCR product was obtained and subcloned into pGEM-T
vector (Promega). A random labeled probe (Random Primed DNA labeling kit,
Boehringer Mannheim) was prepared using this 264-bp PCR product as template to
screen a L. donovani λ−EMBL3 genomic library (a gift from Dr. Meade, University of
Mississippi Medical Center, Jackson, MS) (13). 5 x 104 p.f.u. were plated and screened
by the PCR probe. One positive bacteriophage clone was isolated, which was further
purified through tertiary screening, and sequenced on both strands. Sequence analysis
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 6: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/6.jpg)
7
was performed by DNAstar), whereas comparisons with other genes of the database
were performed using the search algorithm BLAST (14).
Nucleic acid isolation, pulsed field gel electrophoresis (PFGE), and hybridization
analysis - Genomic DNA was isolated from 2 x 109 L. donovani promastigotes by
standard procedures (15). Total RNA was isolated from 109 cells using a RNA isolation
kit (QIAGEN). Plasmid DNAs were isolated by the alkaline lysis procedure.
Chromosomal localization of the genes was conducted by PFGE. Briefly, L. donovani
LSB-51.1 (MHOM/SD/00/Khartoum) promastigotes were harvested by centrifugation,
washed twice in PBS, resuspended in PBS and mixed with 2% agarose at the ratio of
1:1 (v/v). Processing of the samples was made at 50ºC for 48 h in 10 ml of 0.5 M EDTA
pH 8.0, 1% Sarkosyl, and 150 µl of 2 mg/ml fresh-made proteinase K. Separation of the
chromosomal bands was achieved at 14ºC in 1% agarose gels with 0.5 x TBE running
buffer, using a Clamped Homogeneous Electrical Field electrophoresis (CHEF,
BIORAD) with a 35-120 s ramping pulse at 6 V/cm for 24 h. S. cerevisiae
chromosomes, were used as molecular weight markers. After staining with ethidium
bromide, gels were blotted onto nylon membranes (Sigma) by alkaline transfer. DNA,
RNA and chromosomal blots were hybridized with the randomly primed [α-32P]-labeled
DNA probes. All post-hybridization washes were performed to a final stringency of 0.1
x SSC, 0.1% SDS at 42ºC.
Nuclear run-on assay –Transcription in isolated nuclei was achieved as described
previously by Quijada et al. (16). Briefly, logarithmic phase promastigotes were
harvested by centrifugation and suspended in ice-cold hipotonic buffer. Cells were lysed
by vortexing in the presence of Nonidet P-40 and Triton X-100. Immediately nuclei
washing buffer was added and the nuclei were pelleted (3000 g), washed and stored at –
70ºC until use. In vitro transcription was performed for 10 min at 26ºC in the presence
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 7: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/7.jpg)
8
of 100 µCi of [α-32P]UTP (3000 Ci/mmol) (Amersham). The reaction was stopped and
the radiolabeled nascent RNA was extracted by phenol:chloroform. Non-incorporated
isotopes were removed on ProbeQuant G-50 microcolumns (Amersham). 3 µg of each
plasmid, to be probed with the nascent RNA, was linearized, denatured, and transferred
to a positively charged nylon membrane. The membrane was then subjected to
hybridization with the purified labeled RNA.
Plasmid constructions – Plasmids were constructed using conventional cloning
techniques (15) and propagated using the E. coli strain TOP10F’ [mcrA ∆(mrr-
hsdRMS-mcrBC) φ80∆lacZ∆M15 ∆lacX74 recA1 deoR araD139 ∆(ara-leu) 7697
galU galK rpsL endA1 nupG (F’: lacYq Tn10 TetR)] (Invitrogen). The sequences were
verified by dideoxy sequencing along both the critical junction sequence sites.
YCpGAL1-LdTOP1A-URA construction: The 1.9 kb LdTOP1A gene was amplified from
L. donovani genomic DNA, using a sense primer with a flanking BamHI site and a
RGS(His)6tag: 5'-
GCGGATCCGACATGAGAGGATCGCACCACCACCACCACCACAAGGTGGAG
AATAGCAAGATGGGGGTGAAG-3', and an antisense primer with a flanking XbaI
site: 5'-CCTCTAGAGGACTCCGACACCTACAGACGAACAGAGTCACTCG-3'
which correspond respectively to amino-terminal and carboxy-terminal ends of
LdTOP1A gene. Restriction sites are underlined, and the start codon for DNA
topoisomerase I is indicated in bold. The amplified fragment was cloned into the
BamHI-SpeI site of the YCpGAL1-URA vector (a gift from Dr. Wang JC, Harvard
University, Cambridge, Massachusetts). The resultant construct, YCpGAL1-LdTOP1A-
URA contained the LdTOP1A gene driven by the galactose-inducible GAL1 promoter.
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 8: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/8.jpg)
9
YCpGAL1-LdTOP1B-URA construction: A 838-bp BamHI-ClaI fragment from pSK-
LdTOP1B was subloned into the YCpGAL1-URA vector. This construct contained
LdTOP1B gene also driven by GAL1 promoter.
pESC LdTOP1A-LdTOP1B-URA construction: In a two-fragment ligation reaction, the
construct was created by insertion of LdTOP1A previously cut with BamHI-XhoI from
YCpGAL1-LdTOP1A-URA and LdTOP1B cut with NotI-SpeI from YCpGALI-
LdTOP1B-URA. The resultant construct encodes the full-length L. donovani DNA
topoisomerase I driven by the GAL1 and GAL10 promoters.
YCpGAL1-hTOP-URA described previously (17) was used for expression of human
topoisomerase I. pUC18-rDNA, used in the nuclear run on assay, was kindly provided
by Dr. Requena (Centro de Biología Molecular, Severo Ochoa UAM, Madrid).
pGEM3Z-LdTOP1A and pGEM3Z-LdTOP1B were constructed by insertion of
LdTOP1A and LdTOP1B genes in the BamHI and HindIII restriction sites of
pGEM3Zf(+) vector (Promega).
Protein expression – S. cerevisiae strain, EKY3 was transformed with different
constructs viz., YCpGAL1-LdTOP1A-URA, YCpGAL1-LdTOP1B-URA or pESC
LdTOP1A-LdTOP1B-URA carrying the URA3 selectable marker, by treatment with
lithium acetate (18-20). Transformants were selected on synthetic complete (SC)–uracil
medium. At least four independent clones were selected from each transformation. After
6-h induction with 2 % galactose in SC ura-raffinose medium, the cells were harvested
by centrifugation, washed and resuspended at the ratio of 2 g wet cells/2 ml of TEEG
buffer (50 mM Tris-HCl pH 7,4, 1 mM EDTA, 1 mM EGTA, 10 % glycerol)
supplemented with or without 0.2 M KCl, and a mixture of protease inhibitors [1 x
sodium fluoride, 1 x sodium bisulfite, 2 x Complete Mini® (Roche Laboratories)]. Cell
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 9: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/9.jpg)
10
extracts were prepared by disruption with acid-washed glass beads according to a
procedure previously described (21,22). Briefly, cells were subjected to one freeze/thaw
cycle at –80ºC, lysed by vortexing with 425-600 µm glass beads and the extracts cleared
by centrifugation at 15000 x g for 30 min at 4ºC.
In vitro Relaxation Assay - DNA topoisomerase I activity was assayed by the
relaxation of negatively supercoiled plasmid DNA. DNA topoisomerase I proteins were
incubated in 20-µl reaction volume containing 0.3 µg of pHC624 DNA (2015 bp,
plasmid substrate), 20 mM Tris-HCl pH 7.5, 10 mM MgCl2, 5 mM DTT, 10 mM
EDTA, 50 mg/ml gelatin, 150 mM KCl. Human (23) and Leishmania enzyme activities
were assayed for 30 min at 37ºC. Reactions were terminated by the addition of 1% SDS,
and the extent of plasmid DNA relaxation was assessed by electrophoresis in a 1%
agarose gel in 0.1 M Tris borate buffer pH 8.0 at 5 V/cm for 4 h. The gels were
visualized under UV illumination after staining with ethidium bromide and
photographed (24).
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 10: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/10.jpg)
11
RESULTS
Sequence analysis and genomic organization- A single open reading frame (ORF)
consisting of 1908 bp was isolated (LdTOP1A gene, GenBank accession number
AF303577) showing a 50 % identity to Homo sapiens DNA topoisomerase I sequence
(K03077). The ORF encoded for putative polypeptide of 636 amino acids, with a
predicted molecular weight of 73 kDa, which is slightly smaller than human (765 aa)
and S. cerevisiae (769 aa) enzymes. The conserved core domain is present, whereas the
carboxy-terminal domain, which contains the active site, is absent, in this gene (Fig.1).
The presence of a tyrosine residue has been described at the enzyme catalytic site of all
DNA topoisomerases I characterized so far, except in leishmania. In order to search for
a new gene encoding a DNA topoisomerase I active site, PCR was performed using
specific oligonucleotides, whose sequence was based on Leishmania Genome
Sequencing Project (AL389894) (which operates with L. major Friendlin strain) (25).
The sense primer sequence was 5´-CGTGAAAGGCAAGTCTGAGG-3´ and the
antisense primer was 5´-AGGCGGCATGTGAATTAAAG-3´. Genomic DNA from L.
donovani LSB-51.1 (MHOM/SD/00/Khartoum) was used as a template. A single 826
bp-PCR product was obtained, cloned and sequenced, revealing a 95% identity with the
L. major sequence (LdTOP1B GenBank accession number AY062908). This fragment
contained the highly conserved “SKXXY” motif with the tyrosine as the active site
residue, and the sequence alignment analysis displayed ≈ 50% homology with the
carboxy-terminal domain of other eukaryotic DNA topoisomerases I (Fig 1).
To determine the LdTOP1A gene copy number, Southern blot studies were performed as
described in the Materials and Methods using the 264-bp PCR as a probe. A single band
was obtained (Fig 2A) revealing that it is a single copy gene confirming the earlier
results (12). The same experiment was performed for the second gene (LdTOP1B),
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 11: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/11.jpg)
12
using the 826-bp PCR fragment described above. Figure 2B showed a single
hybridizing band, thus suggesting that this gene is also present as a single copy in the
Leishmania genome. Chromosomal location analysis revealed that LdTOP1B gene is
placed at a single chromosomal band of ≈ 0.4 Mb. These data concur with the
Leishmania Genome Sequencing Project findings, according to which the LdTOP1B
gene EST has been identified on chromosome 4 (0.46 Mb) in L. major
(http://www.ebi.ac.uk/parasites/LGN/chromo4.html). These results show clearly that
LdTOP1A and LdTOP1B genes are located on different chromosomes, since LdTOP1A
gene was located on a chromosomal band of 1.6-1.9 Mb (Fig. 2C).
Transcription analysis- Northern Blot analysis was conducted to explore the
possibility that the two genes may undergo post-transcriptional processing, which may
lead to sharing of a common mRNA. A single hybridizing band of ~2.3 kb was
observed with the LdTOP1B gene probe, which differs from the ~3.6 kb mRNA band
observed for LdTOP1A gene (see Fig. 3A). In order to test whether these two mRNAs
are transcribed at a similar rate, nuclear run-on experiments were conducted using
nuclei isolated from logarithmic phase promastigotes. The rate of transcription of each
gene was determined relative to the rate of rDNA transcription. Genes whose relative
rates of transcription were measured include the LdTOP1A, LdTOP1B and rDNA genes,
pGEM-3Zf(+) and pUC-18 plasmids (3 µg of double-stranded, linearized and denatured
plasmids). Results of figure 3B show the transcription of LdTOP1A and LdTOP1B
genes relative to the rDNA transcription. The results of three independent experiments
are shown in Table I. The hybridization signal to the rDNA gene was arbitrary chosen as
1.0 and the other signals were reported relative to that value. Despite LdTOP1A and
LdTOP1B genes are located at different genomic clusters, their transcription rates,
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 12: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/12.jpg)
13
quantified in a phosphorimager, were similar approximately 10-13 fold lower respect
the rDNA signal.
DNA topoisomerase I activity- As shown in Fig 4. DNA topoisomerase I activity was
reconstituted using a deficient S. cerevisiae strain (EKY3, see Materials and Methods).
LdTOP1A and LdTOP1B genes were co-expressed together (Fig. 4A) in a pESC-URA
vector which contains the GAL1 and GAL10 yeast promoters in opposing orientation.
Co-expression of the two genes cloned in this vector guarantees protein-protein
interactions after induction in the yeast host strain. Nevertheless, when LdTOP1A (Fig.
4B) and LdTOP1B (Fig. 4C) genes were individually expressed (each one in a different
experiment), the resulting proteins did not show topoisomerase activity. Expression of
Human TOP 1 gene under similar conditions produced a functional protein, which
catalyzed the plasmid relaxation activity in vitro (Fig 4D).
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 13: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/13.jpg)
14
DISCUSSION
This paper describes the molecular cloning and characterization of a new gene
(LdTOP1B) encoding the carboxy-terminal domain of DNA topoisomerase I in L.
donovani. The results suggest that two different proteins, codified by two different
genes located on different chromosomes, were required to reconstitute a catalytically
active DNA topoisomerase I in leishmania. Similar intensities of the hybridization
signals obtained with LdTOP1A and LdTOP1B genes in the nuclear run-on assays
indicate that the abundance of nascent RNA transcripts derived from both genes was
similar and an interaction, probably at post-translational level, should occur to
reconstitute an active DNA topoisomerase I.
A type I DNA topoisomerase of 67 kDa has been purified from Leishmania donovani
promastigotes nuclear extracts by Chakratorty et al. (10). Das et al. (25) have recently
described that this enzyme harbors a serine in place of the usual catalytic tyrosine. In
addition a theoretical protein model for L. donovani topoisomerase was presented,
suggesting that the serine 553 acts as the reactive nucleophile for enzyme catalysis.
However, it is difficult to understand how a serine residue can stand-in for
phosphodiesterase activity, since some experiments in which active yeast DNA
topoisomerase I was mutated at their active site (Tyr727) to Ser or Phe, resulted in
enzyme inactivation (23). On the other hand, a DNA topoisomerase I-like gene, lacking
the sequence corresponding to a conventional active site motif, has been described in L.
donovani. Heterologous expression of LdTOP1A) gene in E. coli resulted in production
of a catalytically inactive protein (12).
In previous studies with human DNA topoisomerase I, Stewart et al. (26) were able to
reconstitute the enzyme activity by mixing a 58 kDa recombinant core domain with
series of different recombinant carboxy-terminal fragments, which bind tightly to the
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 14: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/14.jpg)
15
core domain forming 1:1 complex probably through non-covalent interactions. This
model hypothesizes that the core and carboxy-terminal domains of topoisomerase I are
folded independently and then are simply associated with each other to form an active
enzyme (26). A similar mechanism may be suggested for independent refolding of
LdTOP1A and LdTOP1B gene products resulting in reconstitution of an active
topoisomerase I in L. donovani. The results therefore suggest the presence of a novel
type of dimeric topoisomerase I in L. donovani. Understanding of distinct molecular
characteristics of the leishmanial topoisomerase I and regulation of expression of the
enzyme during parasite growth may be useful for development of selective inhibitors of
leishmanial topoisomerase I as promising leishmanicidal agents.
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 15: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/15.jpg)
16
ACKNOWLEDGMENTS
We thank William Colley and John Vance (St. Jude Children´s Research Hospital,
Memphis, TN), Santiago Martinez-Calvillo (Seattle Biomedical Research Institute,
Seattle, WA), José María Requena and his group (Centro de Biología Molecular Severo
Ochoa, Universidad Autónoma de Madrid, Spain) for their help in molecular
techniques. We also want to thank Francisco Fierro (Universidad de León, Spain) and
Iris Segura for technical support in PFGE, and John Chris Meade (University of
Mississippi Medical Center, Jackson, MS) for the Leishmania genomic library. This
research was supported by Comisión Interministerial de Ciencia y Tecnología (grants
PM98/0036 and PB96/0159) and Junta de Castilla y León (grants LE05/01 and
LE06/02) and by a grand from the National Institute of Health, CA 58755 and ALSAC.
Fellowships awards to HV and AROM from the Ministerio de Ciencia y Tecnología,
Spain, is gratefully acknowledged.
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 16: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/16.jpg)
17
REFERENCES
1- Champoux, J. J. (2001) Annu. Rev. Biochem. 70, 369-413
2- Wang, J. C. (1996) Annu. Rev. Biochem. 65, 635-692
3- Jaxel, C., Nadal, M., Mirambeau, G., Forterre, P., Takahashi, M., and Duguet, M.
(1989) EMBO J. 8, 3135-3139
4- Brahms, S., Nakasu, S., Kikuchi, A., and Brahms, J. G. (1989) Eur. J. Biochem. 184,
297-303
5- Cheng, C., and Shuman, S. (1998) J. Biol.Chem. 273, 11589-11595
6- Liu, L. F., and Miller, K. G. (1981) Proc. Natl. Acad. Sci. U.S.A. 78, 3487-3491
7- Goto, T., Laipis, P., and Wang, J. C. (1984) J. Biol. Chem. 259, 10422-10429
8- Stewart, L., Ireton, G. C., and Champoux, J. J. (1996) J. Biol. Chem. 271, 7602-7608
9- Stewart, L., Ireton, G. C., Parker, L. H., Madden, K. R., and Champoux, J. J. (1996)
J. Biol. Chem. 271, 7593-7601
10- Chakraborty, A. D., Gupta, A., and Majumder, H. K. (1993) Ind. J. Biochem.
Biophys. 30, 257-263
11- Chessman, S. J. (2000) Parasitol. Today 16, 277-281
12.- Broccoli, S., Marquis, J. F., Papadopoulou, B., Oliver, M., and Drolet, M (1999)
Nucleic Acids Res. 27, 2745-2752
13- Meade, J. C., Shaw, J., Lemaster, S., Gallagher, G., and Stringer, J. R. (1987) Mol.
Cell. Biol. 11, 3937-3946
14- Altschul, S. F., Madden, T. L., Schäffer, A. A., Zhang, J., Zhang, Z., Miller, W., and
Lipman, D. J. (1997) Nucleic Acids Res. 25, 3389-3402
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 17: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/17.jpg)
18
15- Sambrook, J., Fritsch, E. F., and Maniatis, T. (1989) Molecular Cloning A
Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
16-.Quijada, L., Soto, M., Alonso, C., and Requena, J. M. (1997) J. Biol. Chem. 272,
4493-4499.
17- Woo, M. H., Vance, J. R., Otero Marcos, A. R., Bailly, C., and Bjornsti, M.-A.
(2002) J. Biol. Chem. 277, 3813-3822
18- Burke, D., Dawson, D., and Stearns, T. (2000) Methods in Yeast Genetics, Edition
Ed. A Cold Spring Harbor Lab Course Manual, Cold Spring Harbor Laboratory Press.
19- Gietz, R. D., and Schiestl, R. H. (1991) Yeast 7, 253-263
20- Gietz, D., St Jean, A., Woods, R. A., and Schiestl, R. H. (1992) Nucleic Acid. Res.
20, 1425
21- Bjornsti, M.-A, and Fertala, J. Methods Mol. Biol. Humana Press Inc; Totowa, N.J.
22- Jazwinski, S. M. (1990) Method Enzymol. 182, 154-174.
23- Lynn, R. M., Bjornsti, M.-A, Caron, P. R., and Wang, J. C. (1989) Proc. Natl. Acad.
Sci. USA. 86, 3559-3563
24- Ivens, A. C., Lewis, S. M., Bagherzadeh, A., Zhang, L., Chan, H. M., and Smith, D.
F. (1998) Genome Research 8, 135-145
25- Das, A., Mandal, C., Dasgupta, A., Sengupta, T., and Majumder, H. K. (2002)
Nucleic Acid. Res. 30, 794-802
26- Stewart, L., Ireton, G. C., and Champoux, J. J. (1997) J. Mol. Biol. 269, 355-372
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 18: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/18.jpg)
19
FIGURE LEGENDS
Figure 1. Alignment of LdTOP1B gene product with other eukaryotic type I DNA
topoisomerases. The sequence was translated to protein and aligned with other DNA
topoisomerase I proteins from different organisms, including L. donovani topoisomerase
I-like gene reported previously (11). GeneBank accession numbers are as follows:
LdTOP1B gene, AY062908; LdTOP1A gene, AF145121; Plasmodium falciparum,
X83758; Sacharomyces cerevisiae, J03250; Homo sapiens, K03077.
Figure 2. Genomic organization of LdTOP1A and LdTOP1B genes encoding DNA
topoisomerase I in L. donovani. A, Southern analysis of L. donovani LdTOP1A gene
(filter probed with 264-bp fragment). B, Southern analysis of L. donovani LdTOP1B
gene (filter probed with 826-bp fragment). C, Pulsed field gel electrophoresis (PFGE)
analysis of L. donovani indicating localization of LdTOP1A and LdTOP1B genes on
different chromosomal bands.
Figure 3. Expression analysis of LdTOP1A and LdTOP1B genes encoding DNA
topoisomerase I in L. donovani. A, Northern analysis of mRNA from L. donovani
promastigotes (day 2 culture) Lane 1: MWM, lane 2: total RNA, lane 3: filter probed
with 264-bp fragment; lane 4: filter probed with 826-bp fragment. B, Levels of nascent
LdTOP1A and LdTOP1B transcripts in isolated nuclei of L. donovani by nuclear run-on
assay.
Figure 4. In vitro plasmid DNA relaxation assay – A, Yeast extracts co-expressing
LdTOP1A-LdTOP1B genes. B, yeast extracts overexpressing only LdTOP1A gene. C,
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 19: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/19.jpg)
20
yeast extracts overexpressing only LdTOP1B gene. D, yeast extracts overexpressing
hTOP1 gene. a, b, c, d lanes are respectively serial dilutions of the yeast extracts (1/1;
1/10; 1/50 and 1/100), incubated with negatively supercoiled plasmid DNA in reaction
buffer for 30 min at 37ºC as detailed under “Materials and Methods”. Reactions were
terminated by the addition of SDS and the products were resolved in agarose gels,
followed by ethidium bromide staining. Supercoiled (Sc) and relaxed (R) plasmid DNA
topoisomers are as indicated.
Table I. Quantification of relative transcription rates for various genes in L. donovani
promastigotes. Nuclear run-on transcripts from promastigotes were hybridized to
plasmid DNAs immobilized on nylon filter, and the hybridization signals were
quantified on a phosphorimager. Values are relative signal intensities normalized for the
rDNA plasmid value (mean + standard deviation of three independent experiments).
Relative intensities
LdTOP1A 0.11 + 0.05
LdTOP1B 0.08 + 0.03
rDNA 1.0
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 20: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/20.jpg)
L.donovani subunit B ------------------------------------------------------------ L.donovani subunit A ------------------------------------------------------------ P.falciparum ------------------------------------MQSMEINDNNSIKNESTSDDDILI 24 S.cerevisiae --------------------------------------MTIADASKVNHELSSDDDDDVP 22 H.sapiens MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK 60 L.donovani subunit B ------------------------------------------------------------ L.donovani subunit A ------------------------------------------------------------ P.falciparum NKIKQNLGNNKSCNSRSSKKESIKKQKSNSELGIKKNTKKSLGIKKEEEKKKQISKRKSN 84 S.cerevisiae LSQTLKKRKVASMNSASLQDEAEPYDSDEAISKISKKKTKKIKTEPVQSSSLPSP----- 77 H.sapiens HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEP 120 L.infantum subunit B ------------------------------------------------------------ L.donovani subunit A -------------------------------MKVENSKMGVKR-----------EQSHSN 18 P.falciparum ELKEKNNLKEGKKKYVEKKSRTVKDETKLTNVIKKETQNNKKP-----------KKLLKK 133 S.cerevisiae -------PAKKSATSKPKKIKKEDGDVKVKTTKKEEQENEKKK-----------REEEEE 119 H.sapiens EDDGYFVPPKEDIKPLKRPRDEDDVDYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKD 180 L.donovani subunit B ------------------------------------------------------------ L.donovani subunit A EDEEINEED-------------LNWWEQENLRIAMKGERRWETLAHNGVLFPPEYEP--H 63 P.falciparum SEENFEPIN--------------RWWEKIDDQTDIQ----WNYLEHRGLIFSPPYVQ--H 173 S.cerevisiae EDKKAKEEE-----------EEYKWWEKENEDDTIK----WVTLKHNGVIFPPPYQPLPS 164 H.sapiens KDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIK----WKFLEHKGPVFAPPYEPLPE 236 L.donovani subunit B ------------------------------------------------------------ L.donovani subunit A GIPIFYDGREFKMTPEEEEVATMFAVMKEHDYYRMEVFRRNFFESWR-EILDK------- 115 P.falciparum HVPIFYKSIKIELNAKSEELATYWCSAIGSDYCTKEKFILNFFKTFINSLENDNIIKQEN 233 S.cerevisiae HIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPVFQKNFFNDFLQVLKESGGP---- 220 H.sapiens NVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNE------- 289 L.donovani subunit B ------------------------------------------------------------ L.donovani subunit A ----RQHPIRRLELCDFEPIYQWHLVQREKKLSRTKEEKKAIKEKQDAEAEPYRYCVWDG 171 P.falciparum ETKLKKGDISNFKFIDFMPIKDHLLKLREEKLNKTKEEKEEEKKMRMEKELPYTYALVDW 293 S.cerevisiae ---LNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRLEREKFEEDYKFCELDG 277 H.sapiens ----EKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDN 345 L.donovani subunit B -MQPVQSPPVAPP-------SVPVAAPKKTPIDISALKLKMSPSVRATLAAAG------- 45 L.donovani subunit A RREQVANFRVEPPGLFRGRGKHPLMGKLKVRVQPEDITINIGETAEVPVPPA---GHKWA 228 P.falciparum IREKISSNKAEPPGLFRGRGEHPKQGLLKKRIFPEDVVINISKDAPVPRLYDNMCGHNWG 353 S.cerevisiae RREQVGNFKVEPPDLFXGRGAHPKTGKLKRRVNPEDIVLNLSKDAPVPPAPE---GHKWG 334 H.sapiens HKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPP---GHKWK 402 : : . ** * . * : . : :: . . .. L.donovani subunit B -------------------------VLGQCPRPIEAADEDALLKLKPMKTMVPSVKKVVA 80 L.donovani subunit A AVQHDHTVTWLAMWRDSVAGNMKYVMLAPSSSVKGQSDMVKFEKARKLKDKVDDIRASYM 288 P.falciparum DIYHDNKVTWLAYYKDSINDQIKYTFLSAQSKFKGYKDLMKYENARKLKSCVHKIREDYK 413 S.cerevisiae EIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQLKSYIDAIRRDYT 394 H.sapiens EVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYR 462 * . * . : :* : :: L.donovani subunit B P------VATTAPPPKVRRVESSSSSSSDSSSSSSDDDSS-------------------- 114 L.donovani subunit A EDFKSNDLHVAQRAVAMYFIDRLALRVGNEKGEDE-ADTVGCCSLRVEHIQLMPDN---- 343 P.falciparum NKMKNKNIIDKQLGTAVYLIDFLALRVGGEKDIDEEADTVGCCSLRVEHISFAHDIPFKS 473 S.cerevisiae RNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDE-ADTVGCCSLRYEHVTLKPPN---- 449 H.sapiens EDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQE 522 : : :: : .... .. *: L.donovani subunit B --------------------------------TDDSSGSDSSSYSS-------------- 128 L.donovani subunit A ------------------------------IVRFDFLGKDSIRYQNDVAVLPEVYALLQR 373 P.falciparum VDSKEQKTNDEKVNKIPLPTNLESISSEDCYITLDFLGKDSIRYFNTVKIDKQAYINIII 533 S.cerevisiae ------------------------------TVIFDFLGKDSIRFYQEVEVDKQVFKNLTI 479 H.sapiens Y-----------------------------VVEFDFLGKDSIRYYNKVPVEKRVFKNLQL 553 * *.** : . L.donovani subunit B -----DDRSSSSAESVVSGEATLFHIAQSQGLVNKEVLTQ-------------------- 163 L.donovani subunit A FTRR-KSPGMDIFDQLNPTQLNDHLKSFMDGLSAKVFRTYNASITLDRWFKEKPVDPKWS 432 P.falciparum FCKN-KNRDEGVFDQITCSKLNEYLKEIMPTLSAKVFRTYNASITLDQQLKRIKEVYGKT 592 S.cerevisiae FKRPPKQPGHQLFDRLDPSILNKYLQNYMPGLTAKVFRTYNASKTMQDQLDLI--PNKGS 537 H.sapiens FMEN-KQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKEL-TAPDEN 611 .. : : . . * * . * L.donovani subunit B ------------------------------------------------------------ L.donovani subunit A ------------------------------------------------------------ P.falciparum TYSLYSGETELHKSKKRKSSHLTSDTNILSDASDSTINDVNNEYDENGINKKLSYATTVG 652 S.cerevisiae ------------------------------------------------------------ H.sapiens ------------------------------------------------------------ L.donovani subunit B ----------------------------EEEEVPTLVPPRPPVVR--------------- 180 L.donovani subunit A ------------------TADKLAYFNKANTEVAILCNHQKSVSK--------------- 459 P.falciparum KENDVDDKNSPIEVDVSNINELINFYNNANREVAILCNHQRSIPK--------------- 697 S.cerevisiae ------------------VAEKILKYNAANRTVAILCNHQRTVTKGHAQTVEKANNRIQE 579 H.sapiens ------------------IPAKILSYNRANRAVAILCNHQRAPPK--------------- 638 : *. * : . : L.donovani subunit B ------------------------------------------------------------ L.donovani subunit A ------NFKLQMMQLT-----------------TKSEYTRKTIELLEKAEVTAKKKSVEE 496 P.falciparum ------QHDTTMSKIKK-------------QIELYNEDIKEYKKYLQHLKKNSDKKFIFV 738 S.cerevisiae LEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIHKRIIDREIEKYQRKFVRE 639 H.sapiens ------TFEKSMMNLQ-----------------TKIDAK--------KEQLADARRDLKS 667 L.donovani subunit B -----------SFPNDIGKALERYR----------------------------------- 194 L.donovani subunit A AAKEFLEEQ----DRMQREWLESYGTEEQ---------------------------KKEF 525 P.falciparum SKVSTLDGTLR--PNKVKENMKEESCKKK--------------------------LITLI 770 S.cerevisiae NDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVELKSSWNSVEKIKAQVEKLE 699 H.sapiens AKADAKVMK----DAKTKKVVESKKKAVQ---------------------------RLE- 695 : :: L.donovani subunit B ERLNREENIIRIKDDNKAVSLGTSKINYIDPRIICSWAKAQD------------------ 236 L.donovani subunit A EEIVAKRAAPRVRSEKKKSTSGAKKAESASGKKRAAKKKKSAKKGGKVLSKKAASKSSKK 585 P.falciparum KKVELLNNQMKVRDDNKTIALGTSKINYMDPRITVAFCKKFE------------------ 812 S.cerevisiae QRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD------------------ 741 H.sapiens EQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWG------------------ 737 :.: :.::. : *:.* : . : * L.donovani subunit B ------------VPINKIFSATIQKK-----FPWAMNAENFDF-------- 262 L.donovani subunit A APKKLKEEDEDDVPLVSMAAKTKKTAGVKRQRANKVVSDDDDVPLAALRVM 636 P.falciparum ------------IPIEKVFNRSLRLK-----FPWAMFATKN-FTF------ 839 S.cerevisiae ------------VPIEKIFTKTLREK-----FKWAIESVDENWRFM----- 770 H.sapiens ------------VPIEKIYNKTQREK-----FAWAIDMADEDYEFM----- 766 :*: .: : : : .
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 24: A novel active DNA topoisomerase I in Leishmania donovani Héctor](https://reader031.vdocuments.net/reader031/viewer/2022030322/5885bffc1a28ab80488b53f0/html5/thumbnails/24.jpg)
Stuart, Mary-Ann Bjornsti and David OrdóñezGarcía-Estrada, Yolanda Pérez-Pertejo, Babu L. Tekwani, Peter J. Myler, Kenneth D. Héctor Villa, Ana R. Otero Marcos, Rosa M. Reguera, Rafael Balaña-Fouce, Carlos
A novel active DNA topoisomerase I in Leishmania donovani
published online November 19, 2002J. Biol. Chem.
10.1074/jbc.M203991200Access the most updated version of this article at doi:
Alerts:
When a correction for this article is posted•
When this article is cited•
to choose from all of JBC's e-mail alertsClick here
by guest on March 26, 2018
http://ww
w.jbc.org/
Dow
nloaded from