Transcript
  • 7/30/2019 Typhlatya Monae Mitochondrial Partial COI-PAT Gene for Cytochrome Oxidase Subunit 1, Isolate Individual 1

    1/5

    The following menu user interface control may not be accessible. Tab to thenext button to revert the control to an accessible version.

    Destroy user interface control

    NCBI Skip to main content Skip to navigation Resources How To About NCBI Accesskeys

    Sign in to NCBI

    Nucleotide

    Search termSearch database

    The following autocomplete user interface control may not be accessible. Tabto the next button to revert the control to an accessible version.

    Destroy user interface control

    Limits Advanced Help

    The following popper user interface control may not be accessible. Tab to the

    next button to revert the control to an accessible version.

    Destroy user interface control

    Display Settings:

    GenBankThe following popper user interface control may not be accessible. Tab to thenext button to revert the control to an accessible version.

    Destroy user interface control

    Send:

    Typhlatya monae mitochondrial partial COI-PAT gene for cytochrome oxidase

    subunit 1, isolate individual 1

    GenBank: HE800930.1

    FASTAGraphics

    http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1#maincontenthttp://www.ncbi.nlm.nih.gov/nuccore/HE800930.1#navcontenthttp://www.ncbi.nlm.nih.gov/guide/all/http://www.ncbi.nlm.nih.gov/guide/all/#howto_http://www.ncbi.nlm.nih.gov/guide/browsers/#accesskeyshttp://www.ncbi.nlm.nih.gov/account/?back_url=http%3A%2F%2Fwww.ncbi.nlm.nih.gov%2Fnuccore%2FHE800930.1http://www.ncbi.nlm.nih.gov/nuccorehttp://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/limits?term=http://www.ncbi.nlm.nih.gov/nuccore/advancedhttp://www.ncbi.nlm.nih.gov/books/NBK44864/http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/459351171?report=fastahttp://www.ncbi.nlm.nih.gov/nuccore/459351171?report=graphhttp://www.ncbi.nlm.nih.gov/nuccore/459351171?report=graphhttp://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/http://www.ncbi.nlm.nih.gov/nuccore/459351171?report=graphhttp://www.ncbi.nlm.nih.gov/nuccore/459351171?report=fastahttp://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/books/NBK44864/http://www.ncbi.nlm.nih.gov/nuccore/advancedhttp://www.ncbi.nlm.nih.gov/nuccore/limits?term=http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccorehttp://www.ncbi.nlm.nih.gov/account/?back_url=http%3A%2F%2Fwww.ncbi.nlm.nih.gov%2Fnuccore%2FHE800930.1http://www.ncbi.nlm.nih.gov/guide/browsers/#accesskeyshttp://www.ncbi.nlm.nih.gov/guide/all/#howto_http://www.ncbi.nlm.nih.gov/guide/all/http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1#navcontenthttp://www.ncbi.nlm.nih.gov/nuccore/HE800930.1#maincontenthttp://www.ncbi.nlm.nih.gov/http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1
  • 7/30/2019 Typhlatya Monae Mitochondrial Partial COI-PAT Gene for Cytochrome Oxidase Subunit 1, Isolate Individual 1

    2/5

    The following popper user interface control may not be accessible. Tab to thenext button to revert the control to an accessible version.

    Destroy user interface controlGo to:LOCUS HE800930 555 bp DNA linear INV 05-MAR-2013

    DEFINITION Typhlatya monae mitochondrial partial COI-PAT gene for cytochromeoxidase subunit 1, isolate individual 1.ACCESSION HE800930VERSION HE800930.1 GI:459351171KEYWORDS .SOURCE mitochondrion Typhlatya monae

    ORGANISM Typhlatya monaeEukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;

    Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Caridea;

    Atyoidea;Atyidae; Typhlatya.

    REFERENCE 1AUTHORS Botello,A., Iliffe,T.M., Alvarez,F., Juan,C., Pons,J. and

    Jaume,D.TITLE Historical biogeography and phylogeny of Typhlatya cave shrimps

    (Decapoda: Atyidae) based on mitochondrial and nuclear dataJOURNAL J. Biogeogr. 40 (3), 594-607 (2013)

    REFERENCE 2 (bases 1 to 555)AUTHORS Pons,J.TITLE Direct SubmissionJOURNAL Submitted (04-APR-2012) Biodiversity and Conservation, IMEDEA,

    Miquel Marques, 21, Esporles, Illes Balears E-07190, SPAINFEATURES Location/Qualifiers

    source 1..555/organism="Typhlatya monae"/organelle="mitochondrion"

    /mol_type="genomic DNA"/isolate="individual 1"/db_xref="taxon:1173212"/country="Dominican Republic:Juan Dolio"

    gene 123/gene="COI-PAT"

    CDS 123/gene="COI-PAT"/codon_start=1/transl_table=5/product="cytochrome oxidase subunit 1"/protein_id="CCH22466.1"/db_xref="GI:459351172"/translation="SHIVSQESSKKETFGTLGMVYAMMAIGVLGFVVWAHHMFTV"

    ORIGIN1 tctcacattg taaggcaaga atcaagaaaa aaagaaacat ttggtacttt aggcatagtt61 tatgccataa tggctattgg agtgttagga ttcgttgttt gagcacacca catattcaca121 gtaggaatag atgtagacac acgagcatat tttacatcag caactataat tattgccgtg181 cctactggaa tcaaaatttt tagatgatta ggtactcttc acggaaacaa attcacctac241 agtccttcgt tgctatgagc cttaggcttt attttcctgt ttacaattgg aggtctcaca301 ggagtagtat tggccaactc ttcaattgat attgtccttc atgatactta ttatgtagta361 gcgcacttcc actacgttct atctatagga gctgtatttg gaattttcgc aggaattgcc421 cactggttcc cattatttac aggtctaacc atattaccaa aatgactaaa aatccatttt

    http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=1173212http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=1173212http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=1173212http://www.ncbi.nlm.nih.gov/nuccore/459351171?from=1&to=123http://www.ncbi.nlm.nih.gov/nuccore/459351171?from=1&to=123http://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi?mode=c#SG5http://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi?mode=c#SG5http://www.ncbi.nlm.nih.gov/protein/459351172http://www.ncbi.nlm.nih.gov/protein/459351172http://www.ncbi.nlm.nih.gov/protein/459351172http://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi?mode=c#SG5http://www.ncbi.nlm.nih.gov/nuccore/459351171?from=1&to=123http://www.ncbi.nlm.nih.gov/nuccore/459351171?from=1&to=123http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=1173212http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=1173212http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1
  • 7/30/2019 Typhlatya Monae Mitochondrial Partial COI-PAT Gene for Cytochrome Oxidase Subunit 1, Isolate Individual 1

    3/5

    481 ttgactatat ttattggagt gaacattaca ttcttccccc agcatttctt aggactaaat541 ggtataccac gtcga

    //

    Supplemental Content

    Change region shown

    Customize view

    Analyze this sequence

    Run BLAST Pick Primers Highlight Sequence Features Find in this Sequence

    Recent activity

    Clear Turn Off

    Typhlatya monae mitochondrial partial COI-PAT gene for cytochromeoxidase subuni...

    Nucleotide

    Typhlatya garciai mitochondrial partial COI-PAT gene for cytochromeoxidase subu...

    Nucleotide

    Typhlatya taina mitochondrial partial COI-PAT gene for cytochromeoxidase subuni...

    Nucleotide

    Typhlatya monae mitochondrial partial COI-PAT gene for cytochromeoxidase subuni...

    Nucleotide

    Typhlatya monae mitochondrial partial COI-PAT gene for cytochromeoxidase subuni...

    Nucleotide

    See more...You are here:NCBI >DNA & RNA > Nucleotide DatabaseWrite to the Help Desk

    Simple NCBI Directory

    http://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE=Nucleotides&PROGRAM=blastn&QUERY=HE800930.1&DATABASE=nr&MEGABLAST=on&BLAST_PROGRAMS=megaBlast&LINK_LOC=nuccore&PAGE_TYPE=BlastSearchhttp://www.ncbi.nlm.nih.gov/tools/primer-blast/index.cgi?ORGANISM=1173212&INPUT_SEQUENCE=HE800930.1&LINK_LOC=nuccorehttp://www.ncbi.nlm.nih.gov/nuccore/HE800930.1?&feature=CDShttp://portal.%24send%28%27seqsearchclicked%27%29/http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1?cmd=ClearHT&http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660034992788http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660034992788http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660034992788http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660034992788http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660028284187http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660028284187http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660028284187http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660028284187http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660026545235http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660026545235http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660026545235http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660026545235http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660021496882http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660021496882http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660021496882http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660021496882http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660014617124http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660014617124http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660014617124http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660014617124http://www.ncbi.nlm.nih.gov/sites/myncbi/recentactivityhttp://www.ncbi.nlm.nih.gov/guide/http://www.ncbi.nlm.nih.gov/guide/http://www.ncbi.nlm.nih.gov/guide/dna-rna/http://www.ncbi.nlm.nih.gov/guide/dna-rna/http://www.ncbi.nlm.nih.gov/sites/ehelp?&Ncbi_App=entrez&Db=nuccore&Page=genbank&Snapshot=/projects/entrez/[email protected]&Time=2013-03-07T07:40:35-05:00&Host=portal104%20NCBI_Phid:CE8B3ADF1388A2510000000000759E7F;%20PageURL:http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1;http://www.ncbi.nlm.nih.gov/sites/ehelp?&Ncbi_App=entrez&Db=nuccore&Page=genbank&Snapshot=/projects/entrez/[email protected]&Time=2013-03-07T07:40:35-05:00&Host=portal104%20NCBI_Phid:CE8B3ADF1388A2510000000000759E7F;%20PageURL:http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1;http://www.ncbi.nlm.nih.gov/guide/dna-rna/http://www.ncbi.nlm.nih.gov/guide/http://www.ncbi.nlm.nih.gov/sites/myncbi/recentactivityhttp://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660014617124http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660014617124http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660021496882http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660021496882http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660026545235http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660026545235http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660028284187http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660028284187http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660034992788http://www.ncbi.nlm.nih.gov/portal/utils/pageresolver.fcgi?recordid=1362660034992788http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1?cmd=ClearHT&http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1?cmd=ClearHT&http://portal.%24send%28%27seqsearchclicked%27%29/http://www.ncbi.nlm.nih.gov/nuccore/HE800930.1?&feature=CDShttp://www.ncbi.nlm.nih.gov/tools/primer-blast/index.cgi?ORGANISM=1173212&INPUT_SEQUENCE=HE800930.1&LINK_LOC=nuccorehttp://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE=Nucleotides&PROGRAM=blastn&QUERY=HE800930.1&DATABASE=nr&MEGABLAST=on&BLAST_PROGRAMS=megaBlast&LINK_LOC=nuccore&PAGE_TYPE=BlastSearch
  • 7/30/2019 Typhlatya Monae Mitochondrial Partial COI-PAT Gene for Cytochrome Oxidase Subunit 1, Isolate Individual 1

    4/5

    Getting Started NCBI Education NCBI Help Manual NCBI Handbook Training & Tutorials Resources Chemicals & Bioassays Data & Software DNA & RNA Domains & Structures Genes & Expression Genetics & Medicine Genomes & Maps Homology Literature Proteins

    Sequence Analysis Taxonomy Training & Tutorials Variation Popular PubMed Nucleotide BLAST PubMed Central Gene Bookshelf Protein OMIM Genome SNP Structure Featured Genetic Testing Registry PubMed Health GenBank Reference Sequences Map Viewer Human Genome Mouse Genome Influenza Virus Primer-BLAST Sequence Read Archive NCBI Information About NCBI

    http://www.ncbi.nlm.nih.gov/Education/http://www.ncbi.nlm.nih.gov/books/NBK3831/http://www.ncbi.nlm.nih.gov/books/NBK21101/http://www.ncbi.nlm.nih.gov/guide/training-tutorials/http://www.ncbi.nlm.nih.gov/guide/chemicals-bioassayshttp://www.ncbi.nlm.nih.gov/guide/data-softwarehttp://www.ncbi.nlm.nih.gov/guide/dna-rnahttp://www.ncbi.nlm.nih.gov/guide/domains-structureshttp://www.ncbi.nlm.nih.gov/guide/genes-expressionhttp://www.ncbi.nlm.nih.gov/guide/genetics-medicinehttp://www.ncbi.nlm.nih.gov/guide/genomes-mapshttp://www.ncbi.nlm.nih.gov/guide/homologyhttp://www.ncbi.nlm.nih.gov/guide/literaturehttp://www.ncbi.nlm.nih.gov/guide/proteinshttp://www.ncbi.nlm.nih.gov/guide/sequence-analysishttp://www.ncbi.nlm.nih.gov/guide/taxonomyhttp://www.ncbi.nlm.nih.gov/guide/training-tutorialshttp://www.ncbi.nlm.nih.gov/guide/variationhttp://www.ncbi.nlm.nih.gov/pubmed/http://www.ncbi.nlm.nih.gov/nucleotide/http://blast.ncbi.nlm.nih.gov/http://www.pubmedcentral.nih.gov/http://www.ncbi.nlm.nih.gov/gene/http://www.ncbi.nlm.nih.gov/books/http://www.ncbi.nlm.nih.gov/protein/http://www.ncbi.nlm.nih.gov/omim/http://www.ncbi.nlm.nih.gov/genome/http://www.ncbi.nlm.nih.gov/snp/http://www.ncbi.nlm.nih.gov/Structure/http://www.ncbi.nlm.nih.gov/gtr/http://www.ncbi.nlm.nih.gov/pubmedhealth/http://www.ncbi.nlm.nih.gov/Genbank/http://www.ncbi.nlm.nih.gov/refseq/http://www.ncbi.nlm.nih.gov/mapview/http://www.ncbi.nlm.nih.gov/genome/guide/human/http://www.ncbi.nlm.nih.gov/genome/guide/mouse/http://www.ncbi.nlm.nih.gov/genomes/FLU/http://www.ncbi.nlm.nih.gov/tools/primer-blast/http://www.ncbi.nlm.nih.gov/Traces/sra/http://www.ncbi.nlm.nih.gov/About/http://www.ncbi.nlm.nih.gov/About/http://www.ncbi.nlm.nih.gov/Traces/sra/http://www.ncbi.nlm.nih.gov/tools/primer-blast/http://www.ncbi.nlm.nih.gov/genomes/FLU/http://www.ncbi.nlm.nih.gov/genome/guide/mouse/http://www.ncbi.nlm.nih.gov/genome/guide/human/http://www.ncbi.nlm.nih.gov/mapview/http://www.ncbi.nlm.nih.gov/refseq/http://www.ncbi.nlm.nih.gov/Genbank/http://www.ncbi.nlm.nih.gov/pubmedhealth/http://www.ncbi.nlm.nih.gov/gtr/http://www.ncbi.nlm.nih.gov/Structure/http://www.ncbi.nlm.nih.gov/snp/http://www.ncbi.nlm.nih.gov/genome/http://www.ncbi.nlm.nih.gov/omim/http://www.ncbi.nlm.nih.gov/protein/http://www.ncbi.nlm.nih.gov/books/http://www.ncbi.nlm.nih.gov/gene/http://www.pubmedcentral.nih.gov/http://blast.ncbi.nlm.nih.gov/http://www.ncbi.nlm.nih.gov/nucleotide/http://www.ncbi.nlm.nih.gov/pubmed/http://www.ncbi.nlm.nih.gov/guide/variationhttp://www.ncbi.nlm.nih.gov/guide/training-tutorialshttp://www.ncbi.nlm.nih.gov/guide/taxonomyhttp://www.ncbi.nlm.nih.gov/guide/sequence-analysishttp://www.ncbi.nlm.nih.gov/guide/proteinshttp://www.ncbi.nlm.nih.gov/guide/literaturehttp://www.ncbi.nlm.nih.gov/guide/homologyhttp://www.ncbi.nlm.nih.gov/guide/genomes-mapshttp://www.ncbi.nlm.nih.gov/guide/genetics-medicinehttp://www.ncbi.nlm.nih.gov/guide/genes-expressionhttp://www.ncbi.nlm.nih.gov/guide/domains-structureshttp://www.ncbi.nlm.nih.gov/guide/dna-rnahttp://www.ncbi.nlm.nih.gov/guide/data-softwarehttp://www.ncbi.nlm.nih.gov/guide/chemicals-bioassayshttp://www.ncbi.nlm.nih.gov/guide/training-tutorials/http://www.ncbi.nlm.nih.gov/books/NBK21101/http://www.ncbi.nlm.nih.gov/books/NBK3831/http://www.ncbi.nlm.nih.gov/Education/
  • 7/30/2019 Typhlatya Monae Mitochondrial Partial COI-PAT Gene for Cytochrome Oxidase Subunit 1, Isolate Individual 1

    5/5

    Research at NCBI NCBI Newsletter NCBI FTP Site NCBI on Facebook NCBI on Twitter NCBI on YouTube

    NLMNIHDHHSUSA.govCopyright |Disclaimer |Privacy |Accessibility |Contact

    National Center for Biotechnology Information,U.S. National Library ofMedicine 8600 Rockville Pike, Bethesda MD, 20894 USA

    http://www.ncbi.nlm.nih.gov/research/http://www.ncbi.nlm.nih.gov/books/NBK1969/http://www.ncbi.nlm.nih.gov/Ftp/http://www.facebook.com/ncbi.nlmhttp://www.twitter.com/ncbihttp://www.youtube.com/ncbinlmhttp://www.nlm.nih.gov/http://www.nih.gov/http://www.dhhs.gov/http://www.usa.gov/http://www.ncbi.nlm.nih.gov/About/disclaimer.htmlhttp://www.ncbi.nlm.nih.gov/About/disclaimer.html#disclaimerhttp://www.ncbi.nlm.nih.gov/About/disclaimer.html#disclaimerhttp://www.nlm.nih.gov/privacy.htmlhttp://www.nlm.nih.gov/privacy.htmlhttp://www.nlm.nih.gov/accessibility.htmlhttp://www.nlm.nih.gov/accessibility.htmlhttp://www.ncbi.nlm.nih.gov/About/glance/contact_info.htmlhttp://www.ncbi.nlm.nih.gov/About/glance/contact_info.htmlhttp://www.ncbi.nlm.nih.gov/http://www.nlm.nih.gov/http://www.nlm.nih.gov/http://www.nlm.nih.gov/http://www.nlm.nih.gov/http://www.nlm.nih.gov/http://www.ncbi.nlm.nih.gov/http://www.ncbi.nlm.nih.gov/About/glance/contact_info.htmlhttp://www.nlm.nih.gov/accessibility.htmlhttp://www.nlm.nih.gov/privacy.htmlhttp://www.ncbi.nlm.nih.gov/About/disclaimer.html#disclaimerhttp://www.ncbi.nlm.nih.gov/About/disclaimer.htmlhttp://www.usa.gov/http://www.dhhs.gov/http://www.nih.gov/http://www.nlm.nih.gov/http://www.youtube.com/ncbinlmhttp://www.twitter.com/ncbihttp://www.facebook.com/ncbi.nlmhttp://www.ncbi.nlm.nih.gov/Ftp/http://www.ncbi.nlm.nih.gov/books/NBK1969/http://www.ncbi.nlm.nih.gov/research/

Top Related