![Page 1: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/1.jpg)
Winter 2016 FREE
Julian Clarythe camp comic on settling
in the Kentish countryside
WINAn overnight
Glamping
experience Days out • Theatre • Homes & Gardens • Walks
Winter Activitiesto keep the children busy
Five of the best local
MUSEUMS
![Page 2: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/2.jpg)
15 Royal Star Arcade, High Street, Maidstone,Kent ME14 1JL 01622 296680
Open Mon-Sat 9-5pm, Sun 11-4pm
www.furnitureworldkent.com
� Free delivery on all orders
� Fast delivery on all stock items
� 0% Interest Free credit
Winter SaleON NOW
BUY NOW AT LOW SALE PRICES • PAY NOTHING FOR A YEAR • INTEREST FREE CREDIT
UP TOHALF PRICE
SAVINGS
Chairs Now from ONLY £399was £599.99
Fixed sofas NOW FROM ONLY £599was £939.99
The natural choice for comfortLuxury, hand made pocket sprung beds in our Somnus Sleep Studio
![Page 3: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/3.jpg)
Mid Kent Living 3
The teamMid Kent Living is published by Mail Publications Ltd (which also publishes the Downs Mail newspaper), Forge House, Bearsted Green Business Park, Bearsted, Maidstone, ME14 4DT. Tel: 01622 630330 Fax 01622 631131 email [email protected] www.downsmail.co.uk
Covering the Mid Kent townsMid Kent Living is published every three months with a free circulation in Maidstone,Medway, Tunbridge Wells, Tonbridge and Malling, Ashford and Sittingbourne. It isavailable at selected pick-up points throughout the area including major supermarkets. Subscription copies are posted (£8 annually).
Chairman: Claire ProcterEditor: Stephen EighteenPublishing Manager: Jo-Anne BrownSales Manager: Bill BrettAdvertising Sales: Tel 01622 630330
Contents
Interview
7-9 Personality profile - Julian Clary talks about his rural retreat
Editor's Choice
11-16 A selection of hand-pickedevents and great days outaround the county through the winter months
Leisure & Tourism
20-21 Tourist Profile -Five of the best local museums
22-23 Kids - Ideas to keep the kids busy this winter
24-25 Walks - Enjoy a country walk through Sutton Valence
28-29 Charity Profile -Supporting Kent based charities
Lifestyle
32-33 Mind, body & soul
34-37 Senior living
38-45 Homes & gardens
51-53 Motoring
54 Competitions
Images: Left - courtesy of English Heritage; centre - courtesy of Maidstone Museum; right - courtesy of English Heritage
![Page 4: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/4.jpg)
4 Mid Kent Living
Martin & Co Maidstone23 Pudding Lane • Maidstone • ME14 [email protected]
01622 690290maidstone.martinco.com
Thinking of selling, renting or changing agent?
![Page 5: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/5.jpg)
Mid Kent Living 5
Throw off the duvet and have some fun
The extent of the excellent entertainment on offer at this time of year never fails to amaze me.
With so many events geared up for Christmas and inclement weather often plaguinga year’s early months, late-GMT hibernation is an option exercised by many.
This is a shame, given the wealth of activities taking place right here and now.
For confirmation, have a look at Editor’s Choice, which begins on page 11. Did you realise, forinstance, that the International Garden Photographer of the Year Exhibition is taking place atSissinghurst Castle throughout January and February?
Or that James Bartlett, the BBC’s reigning Young Musician of the Year, will perform Mozart’sPiano Concerto No 12 alongside the Maidstone Symphony Orchestra on January 30? That verysame day, in Tunbridge Wells, there is a winter lantern parade.
The following weekend, for music lovers of a different ilk, top names from the world of technoand house will be performing at the Winter Social in Detling, near Maidstone.
Before you know it Easter will be here, with an egg hunt in Belmont House, nearFaversham, and the onset of spring week at Godinton House and Gardens near Ashford.
Were you aware of all this? If not, perhaps you should appreciate that these months contain as fun as any other and make the most of all our wonderful county has to offer.
Editor
www.svs.org.uk
Open
MorningPreparatory School (Nursery to age 11)
Friday 4th March 2016T: 01622 842117 | E: [email protected]
![Page 6: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/6.jpg)
6 Mid Kent Living
LivingMid Kent
Tenterden
Ashford
Charing
SittingbourneRochester
Tunbridge Wells
Tonbridge
Sevenoaks
Aylesford
Paddock Wood
MaidstoneBearsted
Kings Hill
West MallingChatham
CranbrookStaplehurst
Over 20,000 copies of our quartly magazine are delivered and available to pick-up frommajor supermarkets, libraries, shops, garden centresand leisure facilities throughout Mid Kent
For the best value, high impact advertisingcampaign talk to us today
01622 630 330
Mid Kent Living 2726 Mid Kent Living Images courtesy of: Bench (autumn scene) — National Trust/D SellmanRight panel images — Henry Jarvis
The season offers a new chapter for garden lovers in Kent,as Dawn Kingsford discovers at Emmetts Garden.
AUTUMN glory With its expansive pinetum, EmmettsGarden is the perfect place to marvel atautumn’s rich russets and golds, whiletaking in panoramic views across TheWeald.
The National Trust ranks the four-and-a-half acre gardens — along with thoseat Scotney Castle — as the top place tocelebrate autumn in all its glory.
Once owned by Frederic Lubbock, thecharming Edwardian estate is known forits array of autumn colour. Fostered as aplantsman’s paradise in the late 19thcentury and now owned by the NationalTrust, the garden is teeming with rareand exotic trees and shrubs that comein to their prime at this time of year.
It incorporates a quintessential Englishrose garden, alpine and rock garden,and its south garden is brimming withimpressive hardy exotic trees andshrubs, with 200 acres of woodlandbeyond.
The garden’s Japanese Katsura tree isthe flavour of the moment — not onlydoes it turn yellow and orange in
autumn but gives off the aroma of burntsugar, similar to the smell of candyfloss.
A great place for the whole family,including the dog — it is one of only ahandful of National Trust properties thatpermit your pet on a lead in all parts ofthe grounds — Emmetts’ wide openspaces, outdoor seating and takeawayrefreshments provide the perfect placeto let off steam.
This autumn, the family Hallowe’enpumpkin trail enables adults andchildren alike to explore the garden,spot spooky items, answer sinisterquestions and pick up some Hallowe’enfacts and prizes. Later in the yearchildren can take part in the Christmaself trail, helping Father Christmas’ elvesprepare for the big day.
New for this year is the children’s wildplay area, offering youngsters a chanceto clamber and get in touch with nature,or to borrow games such as giantdominoes and jenga, kites and cricketsets, while parents can look on from thenearby seated refreshment area.
Gardener’s question time
- with Emmetts’ head gardener Simon Walker
Your top tip?Spend some time in the garden, notgardening, just enjoying.
Least favourite job?Digging out brambles.
Favourite flower?I’m a sucker for a pink tulip.
Flowers, fruit or veg?Fruit. I used to help grow peaches, it’s a real art and I love stuff like that.
What’s your busiest month?For us at Emmetts Garden it’sFebruary, just before we reopen to the public.
Things to do� Family Hallowe’en pumpkin trail,
10am-5pm, from Saturday, October24 to Sunday, November 1. Trails are£1 each, available from the visitorcentre.
� Christmas elf trail, from December 1 to January 3 2016.
� Guided tours — Monday-Friday at2pm, discovering the latest shrubs,flowers and trees.
� Gardens to visit
Emmetts Garden, Ide Hill, Sevenoaks, is open daily (except Dec 24 and 25) until Jan 3, from 10am to 5pm, and then closed until Feb 27. Entry is £8.30 for adults and £4.15 for children from five to 16, including gift aid. For details visit www.nationaltrust.org.uk/emmetts-garden.
Find it
All of our pubs offer a selection ofscenic walks through beautiful
Kent countryside.Walk up an appetite then treat yourself to a snack,
lunch or dinner.Our menu’s are packed with
seasonal delights using the verybest Kentish produce
THETHE
P O A C H E R& PARTRIDGEV I N E YA R D
T H E
F A R MH O U S E
T H E
G R E A TH O U S E
T H E
D I R T YH A B I T
T H E
GUN
THE
Take a walk and discoverKent’s family of dining pubs
www.elitepubs.com
Gourmet NightAn evening of Game & Wine
at The Dirty Habit, HollingbourneTuesday 10th November 2015
Reception drinks from 7pm, Dinner 8pm£50pp including a glass of wine per course
Hosted by Michael Card from Ellis of RichmondImporters of fine since 1822
Heathfield01825 872361
Hollingbourne01622 880880
Lamberhurst01892 890222
Tudeley01732 358934
Hawkhurst01580 753119
West Malling01732 843257
Mid Kent Living 4140 Mid Kent Living
Mind, body & soul �
What and when you eat can affect the benefits you getfrom your workout. Here’s all you need to know…
You’ve bought allthe right kit andyour exercise planhas you on targetto achieve yourfitness goals. Butwhether you’rehitting the gym orpounding thepavements trainingfor a marathon, what and when you eatis vital if you’re to reap maximumbenefits from your workout.
The first thing to remember is thatcarbohydrates are your friend when itcomes to exercise, even if your goal isweight loss. “Carbohydrates are themain fuel used by working muscles andthe brain,” explains Agnese Pore of theSevenoaks Medical Centre, a registereddietician with expertise in sportsnutrition.
“Eating carbohydrates before exercisecan help improve performance and keepyou going for longer without hitting thewall,” she adds.
Protein is important too, as it helpsrepair and build muscles. Agnese Porerecommends you eat 20-30g of proteinwithin an hour of exercise to help your
muscles recover and repair (see below). A banana is the perfect snack if you’re
feeling peckish about 30 minutes beforeexercise, but a heavy meal before you’redue to work out isn’t a good idea. Yourbody’s energy will be focused ondigesting your food, which means it willbe less available to fire up your othermuscles.
Depending on what you eat, AgnesePore advises you allow between one tofour hours after a meal or snack beforeyou start exercising. “The amount oftime will depend on the amount andtype of the food you have eaten,” shesays. “Too much protein or fat will slowdown the movement from the stomach,and will make you feel uncomfortable. Ifyou have only an hour or so beforeyou’re due to exercise, aim for a meal orsnack that is rich in carbohydrates, lowin fat and moderate in protein. A bowl ofporridge made with low-fat milk or awholegrain sandwich or bagel withchicken and salad are all good choices,”she says.
Drinking enough is just as importantas what and when you eat. Dehydration,when the water content in your bodyfalls too low, can have a major effect on
your performance so it’s important tohave a good glug before and duringyour workout. “The amount you willneed to drink during exercise dependson the amount you sweat,” says AgnesePore. “This varies from person to personand depends on the intensity and lengthof your exercise session. Environmentalfactors can also play a role, so makesure you drink plenty when it’s hot. Andif your training session is set to be morethan an hour, you might be better offwith an electrolyte-based sports drinksuch as Lucozade.”
Get the most from yourEXERCISE
Agnese Pore
Editorial supplied by Trish Lesslie
Get your 20-30g of protein from one: � small chicken breast � medium fillet steak � pint of semi-skimmed milk� 100g tin of tuna � 200g pot of low fat yoghurt
Laser LipOReduces fat, cellulite, stretch marks
and rejuvenates the skin almost instantly
The procedure is completelynon-invasive, painless and there
are no needles or injections.
WHAT AREAS CAN BE TREATED?- Stomach - Hips - Thighs- Upper/Lower Back Fat
- Arms - Baby Bulge- Above Knee Area
- Male Breasts
Laser LipO Fat Reduction & Body Conditioning SPECIAL OFFER
3 SessionCourse £99
Al LipO Sessions are 40 minutes and include use
of our Vibration Plates throughout your course.
Book your first treatmentnow and re-shape your body!
Amelias Closet offers a comprehensive range of competitively priced treatments including; Nail Extensions & Strengthening Overlays inFibreglass, Acrylic or UV Gel, Manicures, Pedicures and Express Polish Treatments, using a combination of O.P.I
Nail Lacquer, over 200 Gel Polish colours and glitters, a variety of Minx Foils and Nail Art Designs. Amelias Closet offers Specialist Beauty Treatments such as Eyelash Extensions, Lash Express, Party Lashes, Lash Lift and Perming,Tinting, Definition Brows and Unisex Waxing. You can also find a range of Body Treatments, Facials and Backcials using the finest
Argan Oil, Ghassoul Clay and Beldi.
WIN A 3 sessionLipO CourseFor detailsSee Page 62
AMELIAS CLOSETNAILS & BEAUTY
01732 874440www.ameliascloset.co.uk
Kings Hill's Premier Nail & Beauty Salon in spacious and relaxing surroundings.
Bringing together over 20 years of industryknowledge and experience.
7 QUEEN STREET, KINGS HILL, KENT ME19 4DA
OPEN 7 DAYS with EASY PARKING!
What is Laser LipO? Laser LipO is a cold laser omitting a low level laser via flat paddles which are placed onto the targeted fatty areas. This painfree procedure causes a breakdown of fat cells (Lipolysis). The fat is thenpassed through the lymphatic System and the remaining is burned as energy.
What results can I expect? Results vary drastically per person but you canexpect to lose between 1-3cms at your first sessions.
Courses are available from 3-10 sessions. An interval of 72 hours is advisedand the quantity of sessions will be based on individual requirements.
ALLINGTON St Nicholas Church Hall (Back Hall)Poplar Grove, AllingtonTuesdays - 10amEmma 01795 472747AYLESFORD Aylesford Bulls RFC, Jack Williams’sMemorial Ground, Hall RoadWednesdays - 9amBev 01622 750701BARMINGSt. Andrews Church HallTonbridge RoadMondays 5.30 & 7.30pmJulie 07770 937425DITTONDitton Community CentreKiln Barn RoadMondays – 5.30pm & 7.30pmToni 07834 438422GROVE GREEN – BEARSTEDSt John’s CEP SchoolProvender WayWednesdays – 5.30pm & 7.30pmJulie 01622 734283 HARRIETSHAMHarrietsham C of E Primary SchoolWest StreetTuesdays - 7.30pmRay 07747 114511
KINGS HILLKings Hill Community Centre70 Gibson DriveWednesdays - 5.30pm & 7.30pmLindsey 07914 842597MAIDSTONE St. Martin’s Church HallNorthumberland RoadTuesdays – 3.30pm & 5.30pm & 7.30pmSue 07724 185071MAIDSTONE – TOWNSt. Luke’s Church Hall, Foley StTuesdays 5.30 & 7.30pmToni 07834 438422TOVILCornwallis Suite, Masonic Centre,Courtney RoadWednesdays – 9.30am & 11.30am& 7.30pmSue 07724 185071CRANBROOKCranbrook Rugby ClubAngley Road, CranbrookTuesdays - 9.30amDebbie 01580 720350
![Page 7: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/7.jpg)
Mid Kent Living 7
Personality profile �
The king of innuendo admits he’s happyto have traded the “urban gay scene” ofthe capital for a more bucolic lifestyle inKent.
Speaking from his country retreat,which he shares with his delightful dogs,Albie and Valerie (his deaf whippet), andhis companion of 13 years, Ian Mackley,he describes his rural idyll in Aldington,overlooking the inspirational andwindswept Romney Marsh.
After 30 years in stand-up, for thedoyen of double entendre, it’s time to be with the things that make him trulyhappy, after the death of his partnerChristopher from Aids in 1991 and aperiod of deep depression.
Now 56, he jokes, he’s thrilled with hisgrey hair, describing his transformationfrom a “fluffy chicken into a silver fox”as a positive – if unstoppable – step andhis move to the country, highlyappropriate.
He adds: “There’s nothing drearierthan a 56-year-old homosexual hangingaround Soho in Lycra. Mercifully, onegrows out of that. Thank goodness. I like to keep myself nice these days.
“When you're young, there are allthese things you want to achieve. Then,when you get to your 50s, you've eitherdone them or you haven't, so thephysical deterioration is offset by thethings that you can tick off the list. Inthat respect each decade is better thanthe last. Although I'm sure one reachesa tipping point where that's not the case anymore.”
His comedy, too, has matured,describing his early scripts as a reactionto the “right-wing men in bow-ties offeredas light entertainment back then”.
“I think you evolve, whether you wantto or not,” he says.
“There was a certain amount of angerand delight in confronting people when I started, which has more or less gonenow.
“Making people laugh is my main aimin life these days. I don't think there's so much to be angry about.”
He’s also happy to be on the roadagain, adding: “This is what I’ve alwayswanted to do, and I'm still doing it:standing on stage, talking about myselfand getting applause for it. What’s notto like?”
Born in Surrey, to a policeman and hisprobation officer wife, he spent much ofhis early life being anti-establishment.However, Julian seems to have made
Home is where the heart is
Dawn Kingsford caught upwith entertainer Julian Claryto ask him about his ruralretreat in Kent.
“Every decade is betterthan the last”
Image courtesy of Eddie Botsio.
![Page 8: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/8.jpg)
8 Mid Kent Living
� Personality profile
the seamless leap into mid-life with little reproach –loving the Royal Family – andadmits he’d “bite off theirhand” for an MBE.
In fact, he awards himself a Mincer of the BritishEmpire in his upcoming tour,which takes him toCanterbury and TunbridgeWells in April. Although, headmits, rather sadly: “It'snever happened, so I'mobviously not favoured bythe Establishment. I thinkI've been too rude about theRoyal Family over the years.I'm probably on some kind of black list somewhere.”
On stage in his latest tour,he’ll also be telling tales onsome of his closest showbizfriends, with a particular popat Joan Collins, who, on theirfirst meeting, he describedas “just as frosty as I’dfeared”. Back in the day, shealso instigated legal actionagainst him for trading onher name as The JoanCollins Fan Club.
Today, he counts heramong his closest friendsand the pair often holidaytogether at her villa in thesouth of France.
He delights: “She’s ascamp as Christmas andloads of fun. I tell a ratherlong story about how I oncesaved her life in a swimmingpool in St Tropez. It's a truestory, which I won't giveaway now, but it's a long,meandering tale that fills the first half.”
He credits Paul O’Grady,another friend – andneighbour – for his move to Kent.
Julian says: “He called mewhen the house came up forsale and it was love at firstsight. I’ve been here nineyears and it’s kept memotivated to earn themoney to bring it back to itsformer glory and it’s justabout there now.”
“I’m probablyon a black listsomewhere”
“I had to call in theghost busters”
![Page 9: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/9.jpg)
Mid Kent Living 9
Interestingly, his 17th century homewas once owned by the gay playwrightNoel Coward, (pictured below) who lived
in the house from1926 to 1956,before sadlypassing away in1973.
When Julianmoved in therewere numerousreports about theformer host
haunting his house – along with threeother spooks – and Julian was forced tocall in paranormal experts to rid hishome of its unfriendly guests.
“The vortex where the spirits come inwas outside Noel Coward’s bedroom andpeople saw figures lurking in the mirror.He has calmed right down now, butwhen I first moved in he seemed mostdisapproving.
“Visitors were getting locked inbathrooms, pictures were falling off ofwalls and the electricity would go out. It was like living with a bunch ofanarchists,” the entertainer recalls.
After making his peace with thespirits, the house now allows him toindulge his love of animals and hecounts, among his menagerie, a clutchof chickens and a host of china hens –“a slight obsession”, he confesses.
“My childhood imagination was filledwith the idea that animals are just asclever as human beings, justmisunderstood. It is quite clear to methat animals can communicate,experience emotions and expressthemselves with an intelligence that is different from, but equal to, ours. I find them fascinating.”
His changing lifestyle has certainlypresented fresh challenges, whichearned him third place in BBC showStrictly Come Dancing in 2004 and sawhim enter the Celebrity Big Brotherhouse in 2012 – against advice and goon to win.
But living the rural dream, hisfantastic kitchen and all the cookeryshows in the world have failed to woohim into becoming a master chef.
“I loathe cooking. All that peeling andchopping, and then it's gone within aminute.
“It’s a shame, because I have the sortof house where I had a vision of myselfbaking and making jam, but I'm not cutout for it at all.”
Instead, he has turned his attention towriting and is currently working on thethird book for his popular children’sseries The Bolds.
“They flow out of me, I don't knowwhere they're all coming from. It'sdelightful; I just have such a lovely timewriting them.
“Making children laugh is a whole newthing for me, it's lovely. No childpretends to laugh – it's very genuine.
“It's obviously a world away from myusual filth but that’s liberating.”
He also enjoys pottering around hisgarden, although when challengedabout his horticultural skills he remarks:“Am I good? I'm very good at walkingaround telling my gardener what to do.”
So, had he been told that after yearswearing make-up and leather in thecapital he’d end up living in the countrywith his dogs and pottering around the
garden, would he have believed it?“I probably would, actually. Because
as a child I was very into animals andnature. Obviously I got distracted for a few years. But I’ve come full circle.
“I love Kent, it keeps me exercising,carrying in logs and there’s a lot of mud,and I hope to stay here for a long time,but I will always have a place in myheart for London.”
So what’s next? I ask.“I don't have any burning desire to act.
I've spent so long creating my personathat it seems strange to let that go andbe someone else. But, I'm always lookingfor a surprising offer. Good things oftencome along as a sort of divineintervention. Just as you're thinking,what am I going to do next year?Something wonderful comes along.
“And if it doesn’t, I’ll think up my ownfun and games in the privacy of myluxury home . . . and I’ll make sure Idraw the curtains before I start!”
� The Joy of Mincing is Julian Clary’scelebration of 30 years as a campcomedian, touring nationwide in spring2016, stopping off at The Assembly HallTheatre, Tunbridge Wells, on April 22and The Marlowe, Canterbury, on April24. Julian’s second children’s book TheBolds to the Rescue (Andersen Press,RRP £6.99) is released March 3.
Long-time friends from KentJulian is looking forward to catching up with friends in Kent during his tour.He says: “There are fans that have followed me for my entire 30 years, and they bring their children along now.“I'm very fond of them, you know. You don't know their names necessarily, but it’s always a joy to see a familiar face. “There’s a delightful family from Tunbridge Wells I've known since the boy was 13 and now he's a grown-up. It's charming.“We talk about the old days at the Hackney Empire, or our aches and pains.“There's a connection there, even though we don't really know each other, because on one level we do.”
“I had a vision of myselfmaking jam”
“It’s a world away from my usual filth”
Image opposite; Courtesy of Tony Briggs; above image courtesy of Eddie Botsio.
![Page 10: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/10.jpg)
10 Mid Kent Living
![Page 11: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/11.jpg)
Mid Kent Living 11Sissinghurst Tower: Courtesy of Jonathan Buckley; Sissinghurst Library: Courtesy of John Hammond
JANUARYTo February 20, 2016The Magic of Masks and Puppets, MaidstoneMuseum & Bentlif ArtGallery, Maidstone A quirky collection of masksand puppets from across the world, including oldfavourites like Punch andJudy, Javanese shadowpuppets, commedia dell'arteleather masks and filmanimatronics, on loan fromthe Scottish Mask andPuppet Centre.
January 6A celebration of TwelfthNight, United ReformedChurch, MaidstoneMaidstone Choral Unionpresents an evening of carolsand readings to end theChristmas season. Mulledwine and mince pies tofollow. 7.30pm-10pm.Free admission.
January 7Salsa dancing Heart of Flavour,King Street, Maidstone Learn to dance salsa at this
exciting new venue, abovethe Heart of Kent Hospicedeli and coffee shop. Doorsopen 8pm, last entry 10pm,ends 11pm. Tickets £8.
January 9 & 10 Winter Activity TrailShorne Woods CountryPark, Shorne, Gravesend Drop in any day between10am and 3pm and pick up atrail sheet, then explore thewoods at your own speed,following the self-led activitytrail and see what you candiscover about the park. Allcompleted trails will receivea small prize. £2.50 peractivity sheet.
January 12 Staplehurst Knit andNatter, StaplehurstLibrary, Staplehurst Meet new people, have achat and a cup of coffee atthe library while getting onwith your favourite craftactivity or perhaps learninga new skill. 10.30am–11.30am.
January 16 & 17 The Medway Big SplashA weekend packed full of funfree aquatic activities at
EDITOR’S Choice Hand-picked events and greatdays out around the county.
Medway's SportsCentres, helpingyou kick start2016 in style.
Free familypool parties, giant
pool inflatables,family races, raft games,
and much more to entertain
at Medway Park, Mill Road,Gillingham, Strood SportsCentre, Watling Street,Strood, Hoo Sports Centre,Main Road, Hoo, Splashes,Cozenton Park, Bloors Lane,Rainham.Places are limited, sobooking is essential.
January 12 – March 31Rose Wylie, Turner Contemporary,Margate
January 16 - February 28 International Garden Photographer ofthe Year Exhibition, The Oast and TowerSissinghurst Castle, Sissinghurst
Paintings and drawings by celebrated Kent-based artist Rose Wylie.
Described in 2010 by Germaine Greer as Britain’s hottestnew artist, Wylie’s bold, large-scale figurative paintingsdraw on ancient and folk art, such as Mexican street artand contemporary Egyptian Hajj painting, as well as arthistory and film.
This display will focus on recent works from her ongoingFilm Notes, a series of paintings inspired by rememberedimages from contemporary films.
Rose Wylie was born in Kent, where she still lives andworks. She studied at Folkestone and Dover School of Art(1952-6) and the Royal College of Art, London (1979-81)and now, in her early eighties, is enjoying renewed interestin her work in the UK and internationally.
She won the prestigious John Moores painting prize in2014.Open Tue to Sun 10am - 5pm. Admission free.
FREEENTRY
Enjoy some stunning gardenphotographs on display forsix weeks in the inspirationalsurroundings of VitaSackville-West’s formerhome.
Filled with dried alliums,flowering bulbs, lusciousfoliage and bold prints, theInternational GardenPhotographer of the Year
exhibition addsa burst of colourto winter'smuted tones.
On display inthe oast house and tower, the exhibition is decorated by the gardeners with plantsfrom the world famousgarden itself. Normaladmission prices apply.
FREE FAMILY POOL PARTIES
![Page 12: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/12.jpg)
pop, blues, gospel, country,folk, musicals or classical.There is only one house rule – no backing tracks.
Singers need to bring alead sheet for their songsand one performance isguaranteed, two if time.
Lists are accepted from7.45pm, with performancesfrom 8.15–10.45pm. Bothlisteners and singers arewelcome. There is a PAsystem, plus a bar, with foodavailable for those who wishto eat. Admission £5.
January 30Maidstone SymphonyOrchestra Mote HallMaidstone LeisureCentre, Maidstone Join the BBC’s reigningYoung Musician of the Year,Martin James Bartlett, as heperforms Mozart’s PianoConcerto No 12, alongsidethe county’s premierorchestra. Other pieces willinclude Nielsen’s HeliosOverture and Dvorak’sSymphony No 7.
7.30pm-10pm.Tickets priced £5-£26.
18s and under are free.
January 30WinterLanternParadeTunbridgeWells Library The annual Winter LanternParade, which leaves thelibrary and wends its wayalong Camden Road really ISa chance for Tunbridge Wellsto shine! Many of thespectacular lanterns willhave been made duringlantern-making workshops –come along and see the endresults. This year’s theme is“Go Wilds.”
FEBRUARYFebruary 3 & March 2Storytelling DayRare Breeds CentreHighlands FarmWoodchurchNr AshfordA 30-minute magicalstorytelling session at11:30am and 1pm in theDiscovery Zone.
Relax with your little ones as they watch andlisten to a variety of differenttales as told by the farm’smaster storytellers.
Storytelling sessions arefree when farm admission is purchased.
February 5Capel Fleet RSPB Raptor View Point Isle of SheppeyOrganised by Kent WildlifeTrust, learn about the birdsof prey which live on theNorth Kent marshes.
Spend a day observingbirds of prey. Learn how toidentify different species and more about theircharacteristics, habitats and behaviour from wardenTony Swandale. 10.30am–4.30pm.
£27 (reduced by £5 forconcessions).
February 6Curzon Country CinemaBorough Green Village,Borough Green45 yearsIn the week leading up totheir 45th weddinganniversary, a couple receivean unexpected letter whichcontains potentially lifechanging news.
With Charlotte Rampling,Tom Courtenay andGeraldine James. 4.30pm.
12 Mid Kent Living
January 23The King is Back!Assembly Hall Theatre,Tunbridge Wells KentElvis has NOT left thebuilding!
To coincide with therelease of Presley’s newalbum, recordedposthumously with the RoyalPhilharmonic Orchestra, topUK Elvis tribute artiste BenPortsmouth takes to thestage to bring the King backto life for his many fans andfollowers.
Ben made history in 2012when he won the ElvisPresley Enterprises UltimateElvis Tribute Artist Contestwhich took place in Memphis,crowning Ben as the
Worldwide Ultimate ElvisTribute Artist' - the onlyartist from outside the USAto ever win this prestigioustitle. With stunning costumesand superb musicianship,this is a chance toexperience the essence andspirit of what it must havebeen like to see the youngElvis in action.
Tickets £25
January 25Open Mic Night, TheGrey Lady, The Pantiles,Tunbridge WellsSingers of all ages areinvited to sing, either with apianist and a bass player, oraccompanying themselveson guitar or piano.
Songs sung can be jazz,
FREEEVENT
February 7 The Town Mouse and the Country MouseGulbenkian Theatre, University of Kent CanterburyThe Pied Piper Theatre Company presents an enchantingand heartwarming telling of Aesop’s classic fable, packed fullof fun, music and song. Join two friends as they embark onan amazing journey and discover that sometimes new canbe exciting and different can be good, but the mostimportant thing is friendship.
Tickets: £8/ Baby on lap (0-18months) £1, Family Groups(4+) : £6.50, Suitable for ages 3 – 8 years. Starts at 14.00h.Running time: 50 minutes approx.
Daily until March 31Canterbury Guided TourTake a break from the sales toenjoy a fascinating 90-minuteguided walking tour ofhistoric streets and cathedralprecincts with knowledgeable,entertaining guides toaddress your questions andspecial interests.
Walks start from theButtermarket at 11am andcost £7.50 per person (orless). Tickets may be bought on the day at any time beforethe tour from the The Beaney Art Museum and Library,Canterbury Heritage Museum or Canterbury RomanMuseum. www.canterburyguidedtours.com
![Page 13: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/13.jpg)
Mid Kent Living 13
Hand-picked events from the editor �
where fairytales andEngland’s past collide.Step in to the castle’s realfairytales with storytellingbrought to life in spellbindingadventures.
Come dressed up as yourfairytale hero with thechance to win a prize.10am–3pm.
February 17The Brook TheatreChatham A chance for young peopleaged 8 to 16 to spend the day with professional dancerCatt, learning break-dancing,
hip hop and other streetstyles includingpopping, houseand locking.
Build up your skills, become part of a crew, build a routine and show off your skills in a battlewhen you perform at the end of the day. The group will be split according to age and experience once the workshop begins, soeveryone gets to go at their own pace.
10am–3pm. £15.
Dover Castle: Courtesy of English Heritage
A Walk in the WoodsRobert Redford plays thepart of Bill Bryson in this filmabout the author walking theAppalachian trail, with one ofhis oldest friends. 7.15pm
Both films projected by adedicated film and cinemalover with almost 50 years inthe business. Tickets £5.
February 6The Winter Social KentCounty ShowgroundDetlingNic Fanciulli’s Social brandreturns with an all-star lineup for its winter edition. Top
names from the world oftechno and house musicinclude Adam Beyer, EatsEverything, Maceo Plex, Maya Jane Coles and NinaKraviz. Doors open a 12pm.Last entry 8pm.
Tickets £43.50+
February 15 - 19 The Fairytale CastleDover Castle Castle HillDover Open the book on thecharacters from England’sstory and explore the tales ofthe castle.
Journey into the realm
GREATFAIRYTALEFAMILY FUN
Transforming lives in every community
Ways we help• Church & community • Children & families
• Homeless people • People in poverty• Reuniting families • Unemployed people
Ways YOU can help• Donate • Fundraise for us
• Run, hike or bike for us • Volunteer for us• Leave a gift for us in your will
• Philanthropy • International development• Share a prayer • Shop with us • Recycle
74-80 Union Street, Maidstone, Kent ME14 1ED.www.salvationarmy.org.uk/maidstone
[email protected] 01622 681808.
The Salvation Army is a Church and registered charity in England (214779), Wales (214779), Scotland (SCO09359) and the Republic of Ireland (RHY6399).
Christian Church and Charity
We invite you to be our guests at our small multiawardwinning familyrun glamping site in Aylesford, Kent. OurVintage Shepherds Hut, African and Moroccan themed belltents and our Festival Tent are perfect for short family breaks,romantic getaways, or longer holidays in the Kent countryside.The selfcatering accommodation is located close to Kits CotyHouse (English Natural Heritage) in an Area of OutstandingNatural Beauty on the edge of the picturesque North Downs.
Whether you stay in our quirky themed Shepherd’s Hut ordecide to get closer to nature in our tented facilities, you willbe assured of a warm welcome, a warm bed and experience atruly unforgettable and extremely cosy night under the stars.
Ami and Mark look forward to meeting you soon!!
Book via telephone or online via our website.
Tel: 01634 685862 | Email: [email protected] Web: www.kitscotyglamping.co.uk
![Page 14: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/14.jpg)
14 Mid Kent Living
February 19 Mark Steel – Who do Ithink I am?Trinity Theatre, ChurchRoad, Tunbridge WellsWriter and comedian MarkSteel wrote and presentedMark Steel's In Town on BBCRadio 4 and toured it livearound the UK.
He is a regular on BBCOne's Have I Got News ForYou and Radio 4's Newsquiz.He has also appeared onBBC2's QI and Room 101.
He has written several,acclaimed books, including:Reasons To Be Cheerful andWhat's Going On and hewrites a weekly column forThe Independent for whichhe won columnist of the yearat the Press Awards in 2015.
This new show, inspired bythe birth of his own son,details the adoptedcomedian’s surprising andentertaining search for hisown mother.
Tickets priced £15. 8pmstart.
February 20 Brahms andTchaikovsky’s firstsymphoniesSt Stephen’s ChurchTonbridgeJoin the TonbridgePhilharmonic Orchestra as itperforms these great worksfrom two of the world’sgreatest composers, underthe guiding baton of MatthewWillis. 7.30–10pm.
February 26 Paul Carrack,Orchard Theatre, Home Gardens, Dartford Legendary Sheffield-born singer, songwriter and formerfrontman of Ace, Squeeze and Mike & The Mechanicsreturns to the road with his band for a 34-date UK tour.Dubbed by the BBC as ‘The Man with the Golden Voice’,Paul is undoubtedly a key figure in British pop history, witha back-catalogue of hits including How Long, Tempted andThe Living Years.
Tickets £29.50, £39.50.
Images: Paul Carrack©2014 Amanda at Bearly Famous
February 21The Tenterden 5 MileWittersham Village Hall,The Street, Wittersham,Nr Tenterden Runners of all standards arewelcome to take part in thisgreat little race whichcontinues to grow inpopularity. A fast-ish, almosttraffic-free run along thequiet lanes around the Kentvillage of Wittersham, nearTenterden, with all profits toWittersham Village Hall. Themorning also Includes achildren’s race.
Medals and free soup to all who complete the course.
10.30am. Email:[email protected]
February 27Concert of FavouriteMusic Invicta GrammarSchool, MaidstoneMaidstone’s own SimonProctor is organising thisconcert of favourite music inaid of Heart of Kent Hospice. Simon is a graduate of theRoyal Academy of Music andhas composed worksincluding a James BondPiano Concerto and Concertofor Serpent and Orchestra,which has gone on to beperformed globally.
Tickets £12 adults or £8 for children under 16.
You can purchase yourtickets online.
February 27 Force Fox 5 The GeorgeHigh Street, YaldingThe five-piece female frontedband with a rocky edge,covers everything old andnew from ELO and Van Halento the Foo Fighters and LadyGaga. Join them in thishistoric village pub – and beready to party! Over 18s only
MARCHMarch 6 Winter Welly andWaterproofDay, ButtercupsGoat Sanctuary,Boughton MonchelseaA chance for visitors toobserve the goats in theirhome surroundings and tosee them relaxed, playingand grazing. Members ofstaff and volunteers will beat hand to show you aroundthe stables and can introduceyou to some of the goats,while informing you of thework at Buttercups. You maywell see the Sanctuary atwork with volunteerscleaning and looking afterthe goats’ welfare, groomingand perhaps giving the
occasional bath. Hot andcold drinks are available
on the day. Entrance bydonation. 10am–3pm.
March 9 Kent Maritime DisastersFleur de Lis Hall,FavershamA talk by Roy Ingletonorganised by the Favershambranch of the Association ofMen of Kent and Kentish Men.
Non-members welcome at£1 per person. 8pm–9.30pm.
FAMILYEVENT
March 2Wigmore Lectures on Tour, Rupert Matthews: The Wreck of the Titanic, Strood Library, Rochester Find out why so many died, why the Titanic was steamingat high speed when ice was around, why there were too fewlifeboats, where the rescue ship got to, why radio distresssignals failed to bring help earlier - and what the sacking ofa coal miner in Ebbw Vale had to do with it all. 8pm start.
Tickets: £4. Advance booking essential
![Page 15: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/15.jpg)
Mid Kent Living 15
Hand-picked events from the editor �
March 11Star Gazing – The Sky at Night Down House, Downe A treat for would-beastronomers of any age toenjoy talks and top tips inthe delightful surroundingsof Charles Darwin's garden,at Down House.
A chance to look throughthe house’s own telescopesto explore the night sky andgaze among the stars.
All are welcome, but there
is no disabled access downto the meadow where thestargazing event will be held.
Tickets £15/£20 from 0370333 1183 (Mon – Fri 8.30am–5.30pm, Sat 9am–5pm).
March 16 An Evening of BurlesqueHazlitt Theatre,Maidstone The biggest burlesquelegends from around theworld are united on one stage– in Maidstone.
Packed with all-stars fromthe four corners of the globe,this is a thrill-a-minute, fun-filled frolic into the bizarreworld of burlesque andcutting-edge variety. . .
It’s Vaudeville gone volatile.Couture costumes and mind-boggling speciality acts sharethe spotlight in a wickedlyhilarious extravaganza.
A chance to dress up andjoin in the cabaret. 7.30pm.Tickets from the HazlittTheatre, £22.
March 18Kent Wildlife TrustTyland Barn VisitorCentre, Sandling,Maidstone A friendly workshop suitablefor gardeners of all abilities.
Whatever the size of yourgarden - from a balcony to a country estate – learn how to make it wildlife-friendly.
Bring plans and photos ofyour garden and Kent Wildlife Trust’s MaureenRainey will reveal a wealth of ideas for you to make itreally come alive. Maureen is the county organiser of the Kent Wildlife GardeningAwards.
Tickets £27 (reduced by £5 for concessions)10am–3.30pm.
![Page 16: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/16.jpg)
16 Mid Kent Living
March 25 The Tortoiseand the Hare, AssemblyHall Theatre, TunbridgeWellsFollowing the sell-outsuccesses of Ugly Duckling,Three Little Pigs and Elvesand the Shoemaker,Northern Ballet bring theirmagic to Aesop’s fable of the Tortoise and the Hare.
This is a great opportunityfor your little ones to beintroduced to the delights of live ballet, music andtheatre.
The child-friendlyperformances last about 40 minutes, starting at 2pmand 4pm.
Tickets £8 and £6. Box office: 01892
530613
March 27 Easter Egg HuntBelmontHouse andGardens, Belmont Park, ThrowleyFun, games and activities forall the family at this lovelyneo-classical country house,where you can explore thebeautiful gardens, search forthe hidden eggs and finishwith a tasty treat in the tearooms! Belmont is also hometo Britain’s finest privatecollection of clocks.
Tel: 01795 890 202
legendary Frankie Valli & The Four Seasons. Featuringan anthology of classic hitsincluding Grease, December1963 (Oh What a Night!),Sherry, Can’t Take My EyesOff You, Beggin’, Walk Like A Man, Big Girls Don’t Cry,and many more, climaxingwith a spectacular finale ofLet’s Hang On!
One to have you up onyour feet and dancing in the aisles.
Box office: 01892 530613Tickets priced £23.50
March 27 & 28 Festival of Steam andTransport, The HistoricDockyard ChathamA steam funfair, streetentertainment, live music,walkabout acts and a funtwo-day programme to keepfamily and friends fully
March 27 Let’s Hang OnAssembly Hall Theatre,Tunbridge WellsIf you enjoyed Jersey Boys,you will love this award-winning production – a trulymusical journey through theprolific career of the
� Hand-picked events from the editor
Images: Ballet in Tortoise & the Hare, courtesy of Brian Slater
GREATDAY OFFAMILYFUN
entertained at the start of the Easter holidays.Hundreds of classic andvintage vehicle owners willjoin the line-ups of transportthrough the ages, withvehicles from 1890 to 1980,including “motion picturemotors” from Starsky andHutch, to Only Fools andHorses and the MustangFastback and Dodge Chargerfrom the 1968 SteveMcQueen movie Bullitt.
Discounts available foradvance purchases,Dockyard 12 month ticketholders and for two daytickets. Ticket hotline 01634 823826.
March 28 - April 1 Spring Week, GodintonHouse and Gardens,AshfordA week of activities forfamilies to enjoy. Treasurehunt, garden games,children’s crafts and anadditional daily activity.Adults £5, Children £3,Gardens open 1pm, activitiesuntil 4pm.
Tearoom open from 1pmuntil 5pm.
![Page 17: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/17.jpg)
Mid Kent Living 17
![Page 18: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/18.jpg)
18 Mid Kent Living
H A M I LT O N K I T C H E N S
Visit our showroom at Warmlake Business Estate, Maidstone Road, Sutton Valence, Kent ME17 3LQ
Discover our stunningrange of contemporary & traditional designs
❚ Free no obligation consultation & design
❚ Quality ❚ Design ❚ Imagination
www.hamiltonkitchens.co.uk
❚ All building works undertaken.
❚ Better and at the right price ✓
❚ Tel: 01622 844897
![Page 19: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/19.jpg)
Mid Kent Living 19
Advertisement feature
See our
competition
on page
54
![Page 20: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/20.jpg)
20 Mid Kent Living
GUILDHALL MUSEUM,ROCHESTERGo back in timeLong before the days of Charles Dickens– now arguably Rochester’s biggestclaim to fame – the town was carving outa name for itself in the annals of history.
Built in the 11th century, with itsimpressive stone keep, Rochester Castlewas strategically important in protectingthe South East from invasion.
Eight hundred years on and the town’smuseum is hosting an exhibition aboutthe events leading up to the siege aspart of its permanent display thathighlights how the castle and the riverhelped shape the history of the area.
Founded in 1897, the Guildhall Museumincorporates the Guildhall in the HighStreet, which was built in 1687, and theadjoining River Medway ConservancyBoard Building, added in 1909.
All visitors (including those withmobility difficulties) can accesselectronic media in the entrance gallery,which enables them to view short films
highlighting key features of the museumdisplays, including archaeologicalobjects going back to Roman Times, a set of 18th century cabinet-maker’s tools and civic silver and regalia fromMedway’s past.
Visitors are whisked back in time asthey experience what life would havebeen like in a full-size reconstruction of a Medway prison hulk and a replicaVictorian drawing room and kitchen.
A themed trail for children through the museum, plus quizzes for kids,makes this a great family day out.
MUSEUMS - Five of the best
World’s oldest boatAt the opposite end of the county,visitors can step back even further intime, to 1500BC.
Dover Museum’s prehistoric woodenboat - discovered in 1992 by workmenbuilding the A20 - is thought to be3,500 years old, making it the world’soldest known seafaring boat.
After nearly a month of excavation,which earned international praise, a 9.5-metre section was successfullyrecovered and is now on display.
The museum – one of the oldest inKent - divides the history of Dover intothemed periods, from prehistoric times,through the Roman and Saxon ages, to
the Tudors and Stuarts, and thedevelopment of Dover as aseaside resort in the 19th centuryand as a working port.
It charts the development of theCinque Ports, the geology ofthose infamous white cliffs andthe influence the town had on thelikes of playwright Noel Cowardand Bond novelist Ian Fleming,who made it their home.
The museum holds themed familydays throughout the year, usually once amonth, which are fun for children of allages.
Monday-Saturday, 9.30am-5pmSunday (April-Sept) 10am-3pmwww.dovermuseum.co.uk
Mid Kent Living has been outand about to come up with a listof some of the best museums inKent to visit.
DOVER MUSEUM, MARKET SQUARE
TUNBRIDGE WELLSMUSEUM AND ARTGALLERY Dinosaur footstepsThis Museum and Art Gallery shares thestory of Royal Tunbridge Wells throughfantastic collections of art, naturalhistory, archaeology, crafts and toys.
Charting thediscovery of itsfamous spa waters in1606, it touches oneverything in between— from its beginningsas Britain’s firstholiday resort, and asan inspiration toartists, innovators, and political radicals,for more than 400 years.
The museum, at Mount Pleasant, alsohas the world’s largest collection ofTunbridge Ware – a decorative souvenirwoodware made from the 1600s to the1920s – as well as a large toy collection,dating back to the 1700s, and one of thebest Georgian portrait collectionsoutside of London.
Children will be fascinated by the dolls,toys, and games, which date from the1700s – a far cry from today’stechnology-driven entertainment.
The museum also boasts a fabulouswardrobe of more than 7,500 clothesand accessories, from the 1700s to thepresent day, including wedding dresses,baby clothes, hair pieces and corsets.There are also more than 28,000natural history specimens, with starattractions including a dinosaurfootprint and a wildcat.
Open Tuesday-Saturday 9.30am-5pmSunday and Monday ClosedAdmission: Freewww.tunbridgewellsmuseum.org
Images: Opposite, courtesy of Nikhilesh Havel
![Page 21: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/21.jpg)
Mid Kent Living 21
One of the UK’s most fascinatingvisitor attractions, if you’re lookingfor a family day out or a quiet stroll inbeautiful surroundings.
Quex Park in Birchington is home to the Powell-Cotton Museum and thePowell-Cotton family’s extraordinarycollection of natural history,ethnography and decorative arts.
Quex House invites you to samplethe lives of the family in this exquisiteRegency-style home and to step backinto its beautiful 15-acre Victoriangarden.
ThePowell-CottonMuseum at QuexPark wasestablishedin 1896 byPercyHorace Gordon Powell-Cotton (1866-1940) to house his collection ofnatural history specimens andcultural objects brought back fromAsia and Africa.
A pioneer in the use of the dioramato display mounted animals, themuseum’s display is unique in the UK,stunning for its size, quality andimagery.
Further galleries contain Asianweaponry, ceramics and jade andivory from Europe, China and Japan,assembled by six generations of thefamily. In the afternoon, during thesummer season, several rooms inQuex House are also open to thepublic.
Guide dogs and hearing dogs arewelcome in the museum, house andgardens.
www.quexpark.co.uk
POWELL-COTTONMUSEUM, BIRCHINGTON
Three in one
This little treasure trove is filled withfine art and historical artefacts ofinternational importance.
Founded in 1858 by Dr ThomasCharles, who bequeathed his art andantiquities to Maidstone, the museum is set in the charming Elizabethanmanor house of Chillington in the centre of town.
With over 600,000 artefacts,Maidstone Museum has one of thelargest collections in Kent, and isthought to be one of the best in theSouth East. The most auspicious include
the ancient Egypt collection, and thebody of Ta-Kesh – one of the onlymummies held by a museum outsideLondon. Also well worth a visit are thosecovering archaeology, costume, culture,local history and Japanese art; there’seven a section on dinosaurs, including a life-size model that roars at you as you pass!
The museum’s Bentlif Art Gallery — a modern architectural addition to thebuilding in 2010 — has an extensivecollection of watercolours and oilpaintings. Also on the premises is theQueen’s Own Royal West KentRegimental Museum, documenting theregiment’s history and its predecessorssince the mid-18th century.
As well as its permanent collections,the museum hosts touring collections,workshops, talks and group visits,ensuring there is always something newand exciting to discover.
Monday-Saturday 10am-5pmSunday noon-4pm (April 1-October 31)Admission Freewww.museum.maidstone.gov.uk
MAIDSTONE MUSEUM, ST FAITH’S STREET
![Page 22: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/22.jpg)
22 Mid Kent Living
��������������� ������
INDOOR SPONGEBALL TENNIS
[email protected] or contact Julian on 07974 815 387
Easy to learn
Faster progress to rally
Fun from ages 2 to 102!
Outdoor tennis also available
Tennis for all ages whatever the weather
Est. 1989
Your child’s future starts here...
3 months toPre-School
Home to HomeEnvironment
www.lindenleachildcare.co.uk 01622 735094
Weavering StMaidstone
Kent ME14 5JR
Linden Lea Day Nursery SchoolOfsted grading of outstanding in all areastake children from 3 months old from 8am - 6pm. Call... 01622 735094 for details or arrange a visit.
LINDEN LEA NURSERY SCHOOL Based in the lounge of Downswood Community centre from 9am-1pm (term time only) for 2-5 year olds.Please call 01622 735094.
Free childcare available at both nurseries for 2 & 3 year olds.
LINDEN LEA OUT OF SCHOOL CLUB PICK UP FROM: Madginford, Roseacre, Thurnham & St Johns. Please call 07947 817766 for details.
Day Nursery SchoolNursery School
Out of School Holiday Club & Holiday Club
Places now available
![Page 23: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/23.jpg)
Mid Kent Living 23
WINTER -activitiesfor kids Dawn Kingsford went in searchof some dates for your diary towear out the kids this winter.
With a seemingly inexhaustible list of“things children like to do”, from squirtguns to sleepovers, corn mazes topuddle-jumping, we still struggle whenit comes to providing enough for themto do, especially in the winter months.
Like any job, establish what it is youwant to achieve and then pull on your“entertainment manager’s hat” and getplanning — it may be more fun than youthink.
The weather is one element you willneed to consider, but with mostyoungsters sharing a passion for water,it can be worked to your advantage.
Think about whether your activity willbe inside or out-of-doors and go fromthere.
In Kent, there are so many things –many of them free – to help fill a fun day.Try your local leisure centres, which runa host of activities, along with swimmingsessions and games; your local library isanother valuable resource, where youwill find a string of reading and story-time events on offer as well as a bundleof brochures about places to visit.
A quick trawl through your localnewspaper or on the web will throw up a whole host of activities in your area,many run by leisure attractions,organisations and charities such as theRSPB and the Kent Wildlife Trust; thesewill get your youngsters out and about,learning and letting off steam with otheryoungsters.
Smile makersA few of the favourite thingschildren tell us they love:
� Being independent
� Puddles
� Pretending � Blanket forts
� Chicken nuggets
� Face painting
� Follow my leader � Glitter
� Ice cream � Mazes
� Mud pies � Mysteries
� Nature � Zoos
Advanced SkateboardingThe Revolution Skatepark inBroadstairsTuesdays 5pm – 7pm£9 per lesson
Rocking Rockpooling -Family EventKent Wildlife Trust’sReculver Visitor Centre, nearHerne BayFriday, April 1, NoonDonations. No bookingrequired.
Children’s PrintingWorkshopJeffery Harrison VisitorCentre, Sevenoaks WildlifeReserve10am-1pm drop in sessions£5. Book on 01732 456407
Recycling CraftWorkshopTyland Barn Visitor Centre,Sandling, Maidstone
Thursday, February 1811am-3pm. Book on 01622 662012
LibrariesStories and craftsessions for pre-school kids, at yourlocal library. FREE
StaplehurstWednesdays 2.15 -2.45pm
FavershamSaturdays 11 - 11.30am
AshfordThursdays 10 - 10.20am
CharingThursdays 10 - 10.20am
Treasure TrailsJust download the map and instructions atwww.treasuretrails.co.uk for a fun day out with the kids.All maps cost £6.99
Canterbury Spy Mission The Canterbury TreasureTrail is a fun and imaginativeself-guided Spy Missionthemed walk which will haveyou exploring the hiddentreasures of Canterbury.
Rochester a DickensMysteryAs you follow the route, youcan solve the clues toeliminate the suspects todiscover whodunnit.
Razzamataz Theatre School are offering a FREETRIAL SESSION for youngsters wishing to experiencethe world of performing arts which is now consideredto be one of the most positive influences on a childslife. It’s not just for children who want to take it up as apotential career choice but for anyone who wants tosimply enjoy the benefits that it offers – from boostingself-esteem and confidence to helping individuals makesense of their emotions. It is also known to have asignificant impact on the process of improving literacylevels.To experience the benefits firsthand book your child’sfree session today. Email [email protected] Medway [email protected]. Alternativelyvisit www.razzamataz.co.uk
Razzamataz
![Page 24: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/24.jpg)
Explore the beautiful village of Sutton Valence, nestled just south east of the county town ofMaidstone. Set on the Greensand Way, overlooking the Vale of Kent and the famous Weald, this walkreally shows off some of the beautiful rural views and landscapes this area of mid Kent has to offer.
SUTTON VALENCE Walk
At the crossroads, continue straighton, pass over the stile and continuealong edge of the field, still followingthe Greensand Way. Pass through agate and continue with an appleorchard to your right. Pass through two more gates as you head towardsthe road.
Pass through the gate and turn leftfollowing Greensand Way, pass MorryBarn on the left. Turn right off road tofollow the Greensand Way sign andcontinue along path to the side of fieldwith stunning views on the right. Passthrough gap and continue along leftedge of field, passing Church Farm onyour left. Bear right past All Saints
Church car park as you approach theroad ahead.
Leaving the Greensand Way, turnright to follow the road (Ulcombe Hill)downhill. Enter the village of Ulcombeand turn right to follow the footpathsign in front of the school, across astream and along left edge of the field.Continue up a slight hill, through thegap and down towards road.
Cross the road and follow thefootpath sign over a stile and acrossthe field. Go over another stile, crossthe stream and continue towards theroad. Cross the road following thefootpath sign over the stile. Go througha gate and continue ahead across the
With picture postcard chocolate boxcottages and country pubs to boot, thisstunning winter walk will successfullywarm your cockles. From your first stepon the road to your last sip of hotchocolate at the pub, this gorgeous walkis the very definition of cosy!
From parking walk ahead on thecobbled footpath past the former Swanpub and the Post Office (beware of righthand drop to road). Continue on the pathpast some houses on your right headingtowards the nearby villages of EastSutton and Ulcombe. On reaching acrossroads continue straight on andfollow the Greensand Way footpath signacross the field.
Continue along field boundary andcross a track. Keeping the house to yourright, head across the field towards roadthen follow Greensand Way signs alongroad (Church Lane). Pass a church onyour right as you enter East Sutton, this14th century parish church features aJacobean pulpit and a late 13th centuryfont.
24 Mid Kent Living
Location: Sutton Valence (ME17 3AJ)
Distance: 5 miles (8 km)
OS Explorer Map: 137
Terrain: Field paths with somemoderate slopes
Parking: Limited parking in SuttonValence, please park withconsideration for others
Refreshments & facilities: Shops and pubs in
Sutton Valence
Information and images supplied by Explore Kent
![Page 25: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/25.jpg)
field. Cross a stream, go through a gateand head across the field to a stile andfollow the path through the woods.
Cross the road following the footpathsign over a stile. Go through a gate andcontinue ahead across the field. Crossthe stream, go through a gate and headacross the field to a stile and follow thepath through the woods. Cross the stileand turn left to follow the road. A shortdistance on, turn right to follow thefootpath sign. Pass a lake on your leftand go through the gap. Follow a pathalong edge of the field and up a slightslope. Cross over the stile to continueonto the path towards road.
Cross the stile and turn right to followroad. After a short distance turn left to
follow the bridleway. Pass a house andcontinue on the surfaced road. Continuealong the road and bear left, passingthe ruins of a castle on the right. SuttonValence Castle, is under the care ofEnglish Heritage, but is free to exploreand open throughout the year. Thecastle was probably abandoned in the14th century, but the remains of theNorman keep are still standing. Theelevated site is an excellent place tocapture panoramic views of thesurrounding countryside. Not tomention a really exciting find on afamily walk!
After a short distance you reachSutton Valence village. Take the firstroad turning on the right to take you
Mid Kent Living 25
For moreinspiration forwalking, cycling andoutdoor activities check outexplorekent.org or follow us onFacebook and Twitter@explorekent.
back to the Post Office where youstarted. Sutton Valence is a delightfulvillage to explore, with many historichouses as well as excellent pubs, sowhy not grab a pint, a roast or a hotchocolate and refuel in this beautifulKentish idyll.
![Page 26: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/26.jpg)
26 Mid Kent Living
All of our pubs offer a selection ofscenic walks through beautiful
Kent countryside.Walk up an appetite then treat yourself to a snack,
lunch or dinner.Our menu’s are packed with
seasonal delights using the verybest Kentish produce
THETHE
P O A C H E R& PARTRIDGEV I N E Y A R D
T H E
F A R MH O U S E
T H E
G R E A TH O U S E
T H E
D I R T YH A B I T
T H E
GUN
THE
Take a walk and discoverKent’s family of dining pubs
www.elitepubs.com
All our pubs are now servingafternoon tea
Traditional Cream Tea £7.50 per personFull Afternoon Tea £13.50 per person
Champagne Afternoon Tea£19.50 per person
See our website for further details
Heathfield01825 872361
Hollingbourne01622 880880
Lamberhurst01892 890222
Tudeley01732 358934
Hawkhurst01580 753119
West Malling01732 843257
![Page 27: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/27.jpg)
Mid Kent Living 27
Theatre �
Feel-good shows to keep youwarm through the dark months
Oh Goody! TimBrooke-Taylor andChris Serle
An unforgettable evening inthe company of one of thefunniest and best-lovedcomedy performers of ourtime as he discusses his longcareer with the writer andbroadcaster Chris Serle.Tim Brooke-Taylor tells
hilarious stories from alifetime in comedy. This is anevening of warmth and good-humour spiced withanecdotes about many of thenames Tim has appearedwith, including his fellowGoodies Graeme Garden andBill Oddie.Tim shot to international
stardom with the revueCambridge Circus in the1960s.A string of brilliant
anecdotes includes Tim’shesitant start in comedy as a schoolboy-magician, golfwith Seve Ballesteros,directing Orson Welles in afeature film and anencounter with EricMorecambe on a beach inPortugal. There will be clipsof the funniest momentsfrom his TV and film career.Hazlitt Theatre, Maidstone.Saturday, February 13,7.30pm
The BodyguardDirect from its smash-hitWest End run, TheBodyguard is coming toCanterbury for two weeks.Former Secret Service
agent turned bodyguard,Frank Farmer is hired toprotect superstar RachelMarron from an unknownstalker. Each expects to be incharge – what they don'texpect is to fall in love.A breathtakingly romantic
thriller, The Bodyguardfeatures a whole host ofWhitney Houston's greatesthits, including Queen Of TheNight, So Emotional, OneMoment In Time, Saving AllMy Love, I'm Your BabyTonight, Run To You, I HaveNothing, Jesus Loves Me, IWanna Dance WithSomebody and one of thegreatest hit songs of all time,I Will Always Love You.Marlowe Theatre,Canterbury. Wednesday,February 17 – Saturday,February 27, 7.30pm withmatinees, 2.30pm.
Fascinating Aida'sDillie KeaneDillie Keane takes a shortbreak from her FascinatingAida gal pals to present asolo show. With brand new tunes,
grand old favourites,gorgeous songs of love andhilarious songs of utterwickedness, Dillie will breakyour heart, mend it againand have it sent to thecleaners for pressing.And she'll give you her
recipe for chutney whileshe's at it.The Orchard Theatre,Dartford. Sunday, February21, 7.30pm
I, MalvolioThink Monty Python andBlackadder as Tim Crouchshoves Shakespeare’s pent-up steward Malvolio into thespotlight to hilarious effect,turning the entire story ofTwelfth Night on its head.Part abject clown, part
theatre-hating disciplinarian,Malvolio asks his audience toexplore the pleasure we takein other people’s suffering.This is a show for anyonewho has ever been told off,called a name or has fallen inlove with the wrong person.Tim Crouch is one of
Britain’s most innovative andrespected theatre-makers —and a hugely experiencedexponent of Shakespeare foryoung people.
Theatre Royal, Margate.Thursday, March 3, 7.30pm.
Thank You for theMusicThe world’s favourite ABBAand Bee Gees concert showcomes to town with its all-new, sequin-spangledspectacular.Joined by the UK’s No1 BeeGees revue, enjoy a night ofnon-stop hits such asMamma Mia, Stayin’ Alive,Dancing Queen, Night Fever,How Deep is Your Love,Super Trouper; Bee Geessmashes such as Islands inthe Stream, Grease and If ICan’t Have You.The Central Theatre,Chatham. Saturday, March5, 7.30pm.
Kent's theatres offer a colourful and fun-filled escape from the often cloudy skiesabove. Here we give you a guide to someof this winter's must-view shows.
Rock ‘n’ Roll legend Joe Brown goes from strength tostrength as his contemporary achievements continue togather momentum.His Very Best Of album achieved a Gold Record for
120,000 sales and was in the UK charts for eight weeks,staying four weeks in the Top 20. In the same year, his 50thanniversary was celebrated with a sell-out show at theRoyal Albert Hall. His new CD, The Ukulele Album, caused asimilar stir and due to its success a deluxe version was laterreleased.You may have seen Joe performing on Later With Jools
Holland or at the cinema playing his part closing the showat the Concert For George Harrison. You may havewitnessed his critically-acclaimed set at GlastonburyFestival or caught him on tour.Joe and his five-piece band will be on stage all evening.
Assembly Hall Theatre, Tunbridge Wells. Thursday, February 4, 7.30pm
Joe Brown in Concert
![Page 28: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/28.jpg)
28 Mid Kent Living
Give a bighand for localCHARITIESFrom sponsored runs to running shops and cafes, charity supporters in Kent find a variety of imaginative ways to raise thefunds needed for their chosen causes. Here, we look at how volunteers andworkers from four charities are helping to make a difference.
Heart of FlavourGreat food and drinkfor a great cause.
There is somethingtruly magical about Heart of Flavourlocated in King Street, Maidstone withits light bright space, rustic furnitureand Kentish products.
Scott Fitzgerald, and his team whichincludes staff and volunteers, have areal passion for creating simple butdelicious dishes using fresh, locallysourced and seasonal ingredients. Ifyou are starting the new year with aresolution to eat healthy, this is theideal place.
Scott, who is head of catering andhospitality for the Heart of KentHospice, is focusing on a host of freshideas, including a gluten-free corneroffering freshly-baked pizzas, toastiesand paninis for those with specialdiets.
Besides thewelcoming cafébar downstairs,there is now aneleganthospitality suiteon the upperfloor which is astunning venue for weddings,conferences and corporate events. Itleads on to an outside terrace whichScott hopes to transform into a patioarea for al fresco food and drinks.
Heart of Flavour is open every dayexcept Sunday and offers a widechoice of barista coffees, cakes andpastries, afternoon tea, a delicioushot or cold lunch, or a drink and deliplatter after work.
All the profits go to Heart of KentHospice so you can enjoy great foodwhile supporting a good cause.
SpadeworkA crop of fresh ideas including amonthly farmers’ market is helping anOffham charity to keep its bankbalance blossoming.
Spadework provides training andwork experience for 90 adults withlearning and other disabilities at itsbase in Teston Road where clientsgrow the produce sold in the farmshop and café.
One of its biggest successes was thelaunch of the Offham Farmers’Market, now in its fourth year andheld on the second Saturday of eachmonth. The market, which is held atSpadework, enables the charity to sellits freshly-picked fruit and veg, aswell as cakes, jam and chutneys.
Starting small with 15 stalls and 100customers, the market rapidly wentfrom strength to strength, expandingto 30 stalls and 500 customers.
The range of local, high qualitygoods on offer includes drinks, chillisauces, pastries and vegan,vegetarian and meat-based hand-made snacks and ready meals. Thereis often a cookery demonstration aswell as live music for visitors to enjoywhile they shop. Market openingtimes are 10am to 1pm.
If you are unable to get along to thefarmers’ market, Spadework has afarm shop selling local produce and acafé which are open every day.
Steph hits money milestoneChampion fundraiser Steph Harrisonis one of Breast Cancer Care’s mostdedicated supporters.
After being diagnosed with breastcancer seven years ago, Steph, who is based in Sevenoaks, began raisingmoney for the charity in a huge rangeof ways and recently passed thefundraising milestone of £100,000.
To raise this amazing amount, Steph organised bucket collections,fundraising events, book signings with novelists Martina Cole and Susan Lewis and Sevenoaks PinkWeek which included a sportathonand pink party.
Speaking of her involvement withthe charity, Steph said: “BreastCancer Care is there to supporteveryone facing breast cancer. It is asecond family to me and I just can’t
imagine not being part of it.”The charity’s chief
executive Samia al Qadhisaid: “As one of our mostactive supporters, Steph hasalways been a huge asset tothe charity, but to reach a£100,000 fundraising total is phenomenal.”
![Page 29: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/29.jpg)
Mid Kent Living 29
Charity profile �
Set in 39 acres of stunning gardens and woodland amid beautiful Kentish countryside,the Seekers Trust offers a haven of tranquillity at Addington Park, near West Malling.
Established for more than90 years as a centre forprayer and healing, thecharitable organisationprovides an oasis ofpeace, designed topromote physical,emotional, spiritual andmental wellbeing. It drawsvisitors from all over theworld who want torecharge their batteriesaway from the stressesand strains of modern life.
The Seekers Trust wasfounded in London byCharles Simpson who hadstrong beliefs inreincarnation and healingthrough the power ofprayer. Soon largerpremises were needed,and the Seekers acquiredAddington Park, thenstretching to 368 acres, amanor house and farm.Through donations,dedication and hard work,the stables wereconverted into beautifulchapels, residential andguest flats were built andthe rose garden wasplanted
The manor wasrequisitioned duringWorld War II by the RAFand fell into disrepairduring the hardship of thepost-war years. Sadly, itsuffered a fire and wasdemolished and sold,along with most of theland, leaving the acreageowned by the trust today.
The centre is now run bythe founder’sgranddaughter, KathySearle, who was bornthere in 1952, andreturned a few years ago.“I just love the place, it isso special,” she said.People come to theSeekers with a wide range
of problems and thetrust’s volunteers andtrained healers offercomfort and a confidentialear, coupled with thepower of prayer andspiritual healing. There isno charge for the trust’shealing services, althoughit relies heavily ondonations.
The beautiful groundsare open all year andvisitors are alwayswelcome to sit by thecarp-filled pond or takequiet woodland walks. To help preserve thetranquillity of theparkland, there is a no-petpolicy. Some people dropin to relax and re-energise, others tomeditate or to pray, orsimply breathe in theuplifting scents of thememorial rose garden.
Spiritual healingsessions take place twiceeach week – on Tuesdaysfrom 11am to 4.30pm andon Thursdays from 11am to2pm and from 7pm to9pm. The tea rooms arealso open on these days.
Crystal shopAmong the trust’s latest initiativesis a crystal shop where visitors canlearn about the powers attributedto a variety of specially-chosencrystals which are also available to purchase by mail order. Also on display is an archive collectionincluding antique crystaldoorknobs salvaged from the oldmansion.
Rose gardenFirst planted in 1932, the rosegarden with its deeply-scentedblooms, is an important feature ofthe Seekers Trust. The garden ofremembrance was relocated to itscurrent site in 1947 following thedemolition of the manor house.Members are able to dedicate arose to their loved ones and aplaque is placed underneath withtheir chosen wording. They areable to visit at any time and eachyear are invited to a day ofremembrance. “It is held in Julywhen the roses are at their bestand the scent is wonderful,” saidKathy. “It is a very special daywhen you can enjoy the beauty ofthe roses and be close to thoseloved ones that you have lost.”After the service, there is a chanceto chat and share memories overtea and cakes.
THE SEEKERS TRUST– an oasis of peace
Contact detailsA registered charity, the trust relies heavily on donations and the help of volunteers.To contact the Seekers Trust, email [email protected], or telephone 01732843589 or write to the charity at The Lilacs, The Close, Addington, West Malling,Kent. ME19 5BL.
![Page 30: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/30.jpg)
30 Mid Kent Living
The most beautiful venue for any type of event
• Signature Wedding Receptions
• Stylish Events & Celebrations
• Corporate Delegate Days
CORPUS CHRISTI HALLKENT’S BEST KEPT SECRET
The Corpus Christi HallEarl Street, Maidstone, Kent ME14 1JP
www.corpuschristihall.comT: 01622 670011 E: [email protected]
Maidstone’sExclusive Venue
The Taste of BengalBangladeshi Cuisine
Ashford Road, Harrietsham ME17 1HYAir Conditioning & Fully Licensed
Opening Times; Daily 12-2pm & 6pm – 11pm
01622 859461 01622 858662
Every Tuesday is
Banquet Night £10.95
(Collection only)
Discount onorders over £1010%
![Page 31: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/31.jpg)
Mid Kent Living 31
Food and drink �
The first micro-pub in Kent threw openits doors six years ago, and since thentheir collective turnover is frothing overat more than £20million.A drop in the ocean compared to the
big brewery-owned outlets, but thepopularity of partaking of ale in thesepersonalised pubs is attracting awelcome new stream of regulars, servedby a band of micro-breweries, whichhave grown in number in the last yearby more than in the previous 10.Martyn Hillier, from Herne, who heads
up the Micro-pub Association, says theconcept first fizzed into action followinga change in licensing laws in 2005 and,today, the county boasts 31 micro-pubs(most in East Kent) and about the samenumber of micro-breweries – up fromjust two in 1990. Martyn, who turned a butcher’s shop in
Herne into what is now regarded as thebirthplace of Britain’s micro-pubrevolution, believes micro really isbeautiful. He adds: “Their successreflects the enthusiasm of their owners,who are caring hosts, conversationstarters, sources of local informationand promoters of real ale. There is noset formula or design, though all aresmall. At best, like a traditional local,they strengthen a community by being a
forum for discussing local issues,creating friends and local connections.”His pub, The Butcher’s Arms, is now a
thriving business and like so many othermicro-pubs shares a fascinating historyof its own, with other outlets includingThe Firkin Frog – a former kitchenshowroom in Herne Bay, and revealingnames such as the Potting Shed inHythe and Ales of the Unexpected inMargate.Mr Hillier says: “By keeping things
simple, my aim of attracting like-mindedbeer drinkers to a snug bar, serving beerstraight from the cask came together.” And a growing number of micro-
breweries in Kent have woken up to thefact that a micro-pub can sell twice asmuch beer as an ordinary pub because,primarily, that is all it sells…and withalmost one micro-brewery to everymicro-pub, the choice of ales is massiveand fast moving.Mr Hillier adds: “Micro-pubs can reflect
and respond to their customers viewsquickly. It’s a virtuous circle.” In someareas micro-pubs have put the fizz backin to a community, with regenerationgrants often available. So, if you have anempty shop in your area, why not thinkabout transforming it into your ownvillage pub?
With the demise of countless pubs across the county, DawnKingsford has been finding out about the latest drinkingrevolution, as DIY-ers make their mark with the rise in micropubs and breweries.
Teachers Pete and Karen Goody useKent hops to create beers at theirmicro-brewery in a former farmbuilding at Herne. Their bitter, Genesis, was named
Best Kentish Beer and the BestHopped Beer in the county in 2014.Goody Ales is open every month for
its Firkins at Full Moon celebration.www.goodyales.co.uk
A DIYdrinkingrevolution
The Caveman BreweryThe Caveman Brewery is beneath theGeorge and Dragon pub in Swanscombe,less than a mile from where thePalaeolithic Swanscombe Skull wasfound in 1935.One of the smallest micro-breweries in
Kent, with all its brewing activities belowground, it was established to provide an‘on-tap’ source of ale for the pub above.Now, the flavour-led brewery, usesEnglish malt and hops to create its BestBitter; fruity American vines for its paleale, and German malt in its stout. Beersare available throughout Kent.www.cavemanbrewery.co.uk
Historic hop recipePhil and Debbie Goacher resurrected Maidstone’s brewing tradition by openingGoachers micro-brewery in 1983.Prior to that, the town boasted four independent brewers, the last closing in 1972.Goachers’ Ales is now thriving in Tovil, using only Kent hops and a full-mash
brewing and open fermentation process.Beers also have no added sugars orartificial colouring.Howard Goacher (pictured with dad Phil)
said: “Our commitment to excellence andtraditional methods produces ales ofdistinction and character, sought after in this increasingly standardised world.”
Goody Ales
![Page 32: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/32.jpg)
32 Mid Kent Living
Kettlecise® is THE single most effective Kettlebell fat burningworkout…… designed to shape and sculpt your body in as little
as 20 mins for rapid fat loss & a lean, toned body. It’s fun, stress busting, super quick and super effective!!!
NEW CLASSES COMING TO MAIDSTONEJANUARY 2016
To book, or for further information, contact Kettlercise®Instructor Shelley on 07789 733878, or go to
www.abelafitness.co.uk for further details.£5 a session – your first session is FREE! All abilities welcome.
DO YOU WANT RESULTS LIKE THIS?
KETTLERCISE® SYSTEM
12 WEEKS TO YOUR ‘TOTAL BODY TRANSFORMATION’
MONDAYBarming
St. Andrew’s ChurchHall, St Andrews Road
5.30 & 7.30pmJulie 07770 937425
CoxheathCoxheath Village Hall
Stockett Lane. 7.30pmSamantha 07544 402255
DittonDitton Community CentreKiln Barn Road. 5.30pm & 7.30pmToni 07834 438422
TUESDAY
NEW CONSULTANTCHANGE VENUE opening 29th DecLarkfieldLarkfield Priory Hotel802 London Road (A20)5.30 & 7.30pmHayley 07590276546
Allington St Nicholas Church Hall (Back Hall)Poplar Grove. 10amEmma 01795 472747
AllingtonAllington Community Association, Castle Road. 7.30pmVanessa 07712 647797
AylesfordAylesford Community Centre25 Forstal Road7.30pmBev 01622 750701
HarrietshamHarrietsham C of E PrimarySch, West Street. 7.30pmRay 07747 114511
Maidstone St. Martin’s Church HallNorthumberland Road3.30pm & 5.30pm & 7.30pmSue 07724 185071
Maidstone – TownSt. Luke’s Church Hall, Foley St5.30 & 7.30pmToni 07834 438422
WEDNESDAYAylesford Bulls RFCJack Williams Memorial, Ground Hall Road. 9.00amBev 01622 750701
TovilCornwallis Suite, Masonic Centre,Courtney Road. 9.30am & 11.30amSue 07724 185071
AllingtonPalace Wood Infants SchTalbot Road. 5.30pmLorraine 01622 631982
Grove GreenSt John’s CEP Sch, Provender Way5.30pm & 7.30pmJulie 01622 734283
Kings HillKings Hill Community Centre70 Gibson Drive5.30pm & 7.30pmLindsey 07914 842597
LenhamLenham Primary SchoolHam Lane. 7.30pmSammie 07979 692389
SnodlandHam Hill Working Mens Club,Function room, 259-261 Malling Road. 5.30pmTracey 01634 240429
Staplehurst Staplehurst School, Gybbon Rise5.30pm & 7.30pmRay 07747 114511
TovilCornwallis Suite, Masonic Centre,Courtney Road. 7.30pmSue 07724 185071
THURSDAYSnodlandHam Hill Working Mens Club,Function room, 259-261 MallingRoad. 9.30amTracey 01634 240429
MaidstoneThe Salvation Army74-80 Union Street. 9.30amKatie 07717454787
LooseLoose Parish Pavilion, King George V playing field7.30pmCaroline 07539 175355
Larkfield Larkfield Church farmsNew Hythe Lane. 7.00pmBev 01622 750701
LeybourneLeybourne Village HallLittle Market Row. 7.30pmBeverley 07809 591334
VintersVinters Park Community CentreHampton Road. 5.30pmLorraine 01622 631982
FRIDAYMaidstoneSt Lukes Church Hall33-35 Foley Street. 9.30amKatie 07717454787
SATURDAYLordswoodLordswood leisure CentreNorthdane Way8.30am & 10.30amEmma 01795 472747
![Page 33: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/33.jpg)
Mid Kent Living 33Mid Kent Living 33
Mind, body & soul �
It’s January and you’re officially out of excuses for eating another mince pie buthow do you turn a well-meaning New Year resolution into a long-term health goal?
Whether it isexercising more oreating less sugar,many of us willcommit this NewYear to a healthierlifestyle, especiallyafter the seasonof splurging is welland truly over.
Although a health-related resolution isalways a good starting point, extraeffort is required to stay on the righttrack to achieve your health goals.
Before undertaking a new fitness andweight loss plan, it is alwaysa good idea to consultwith a professional healthpractitioner, such as aphysiotherapist.“Physiotherapists can helpstructure a realisticexercise programme whichis sympathetic to yourtime constraints andprevious injury history,”explains Uzo Ehiogu, headof Physiotherapy andOccupational Therapy atLondon Bridge Hospital, partof HCA International.
For long-term weightmanagement, Uzorecommends resistance or
weight training as the most effectiveform of exercise. This is because suchtraining builds and maintains muscles,which is good for the metabolism, aswell as preventing injury and lifting yourmood.
While exercise is crucial in boostinghealth, it is also vitally important not toover-exercise. As Uzo notes. “Too muchtraining can be a bad thing, increasingthe risk of injury and illness. Always doexercises at the highest intensity thatyou can safely manage for between 20-60 minutes.”
Uzo particularly recommendsphysiotherapy for individuals
with a disability or limitedmobility, as a physiotherapistcan provide an accurate
assessment andadapt and tailorexercisesaccordingly.“Working with
clients, especiallythose with limited
movement, is wherephysiotherapy stands headand shoulders above otherhealth care professions,because we can provide atailored programme to
meet your uniqueneeds.”
How to lose weight and boostyour HEALTH FOR 2016
Uzo Ehiogu
The top threeresistance moves forweight loss
Single-Leg Dumbbell RowStand holding a weight in one hand.Lean forward so your back is flat andalmost parallel to the floor, rest theother hand on a chair for support.Extend the arm holding the weighttowards the floor and lift the straightleg behind you, so your body forms aT-shape. Slowly bend the left elbowand draw the weight up until theelbow is even with your torso, holdfor a moment, then lower the weight
Squat to overhead pressStand with feet shoulder width apart,elbows bent, with a weight in eachhand at shoulder height. Lower intoa squat (don’t let your knees goforward past your toes) and pushthrough your heels to stand up,pressing the weights overhead
The Superman Lie facedown extending the armsand legs with toes pointed, palmsfacing the floor. Inhale while raisingarms and legs, pause, then exhalewhile slowly returning to startingposition
Editorial supplied by Sevenoaks Medical
![Page 34: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/34.jpg)
34 Mid Kent Living
The CnamdooGeracyadylemohmedhtiwelpoep
ertneC opsebruosiitroppusytilicafellewevilotaitnem
ekogni
eW.
mhtwpopnosrepareffomaetruoybde
,sreetnulov
stneilCekoocemoH
wotatnmpecivresdertnecffatsyldneirffo
:yojnenacsnultalaemtohde
W.-divor
dna
hc
f More InForTel: 610
act: Conto f GoThe
669637226 Open
cnosrePragefasA
rg 6 Ee,tr Cenandmo Go
ours:HOpen am 8
seitivitcadertnecoitaxalerrofnedr
dginfo Maad,t Ronmoer
am - pm (Mon5
n
15 8LHME, drdginfo
pm (Mon-Fri)
eractooF
nagnihtaB
feracyaD
canidnaemohta
htnignirewohsdn
seitilicaf
cinilc
emoheW
S
erihriahcleehW
sesicrexedetaeS
i
ytilibasiD
plehemoH
gninedrag
itamrofnI
csrehcuovlevart
hs,gninaelchtiwp
ecivdadnano
emeh
gnippo
es
V
B
C
snoisse
roppognireetnuloV
gnidneirfe
sessalcretupmo
seitinut
namydnaH
teDtcatnoC
n
:sliat aMKUegA
eTE- ofni:liam
tSlliM7,enotsdi
:le 81635722610enotsdiamkuega@o
M,enotsdiaM,teer
ku.gro.e
WX651EM
![Page 35: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/35.jpg)
Mid Kent Living 35
With house or carinsurance you hope never tomake a claim but you stilltake out a policy.
It is the same with lastingpowers of attorney (LPAs). Ifyou do not have them inplace and cannot deal withyour own affairs, the impact
on your family is huge. The following story is trueand shows what can happen.
*Margaret’s husband John was only 64 whenhe had a severe stroke and was rushed tohospital. He came home after five months butcould not walk, talk or make himself understood.With help from Social Services and her grownupchildren, Margaret was able to cope with her newfull time job of looking after her husband – butmoney was a problem. Most of the savings were
in John’s name so Margaret could not accessthem. Even joint accounts can be frozen in suchcases. Margaret thought she needed a lastingpower of attorney but, because John was unableto communicate, it was too late to set up an LPA.The only option was to apply to the Court ofProtection so that she and the children could actas court deputies on John’s behalf.
It cost Margaret £1,555 to apply to the courtand it took seven months for them to beappointed as deputies. They have to pay £30 ayear for a court insurance bond and submitaccounts every year showing how they aredealing with John’s money. They were lucky. Inmany cases, it takes much longer for a courtdecision and the insurance bond can be hundredsof pounds a year. All of this could have beenavoided if they had existing LPAs.
Powers of attorney – can youafford not to have them?
*Names have been changed to protect identities.
For help with Wills, Powers of Attorney, Probate & Funeral Plans
Contact: Peter Camrass DipPFS Aff.SWW
Call: 01622 720985 or go online: www.camrasswills.co.uk
Do you want helpwriting your Will?
Do you need powersof attorney?
Do you need helpwith probate?
Do you want to buy afuneral plan?
• We offer help & advice • • Home visits •
• All fees agreed beforeyou proceed •
Advertisement feature
Tel: 01622 246 0460800 566 8889
www.nightingalebathrooms.co.uk
Senior living �
![Page 36: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/36.jpg)
36 Mid Kent Living
Ability specialises incaring for people in theirown home. Treating ourclients as individuals notnumbers - meeting theirneeds is our mainconcern. Consistentlyensure our staff provideexcellent care and havea customer-centredattitude. Ability employshighly qualified staff who have good people skills and apositive attitude towards their work.“We give the FULL amount of time allocated to eachindividual. Our care is efficient, effective and goodvalue for money.
Ability Professional Care Service“Different from the rest”
Professional Care ServicesCQC Reg No. 1-136247205
CQC’s glowing report found, “all staff were trained in thesafeguarding of vulnerable adults… have kind and attentivestaff… so obliging... the best thing I have ever done... I cannotspeak highly enough... they are wonderful people... really listen tome... a relative commented, "When my family member washospitalised, the manager offered to come and sit with me. Thisspeaks volumes about the kind of people they are".
To discuss your care needstelephone 01622 684503Maidstone Studios, New Cut Road,Vinter Park, Maidstone ME14 5NZ
If you are thinking of working in care speakto our care manager for more information.
Care in your own home
Award winning local companyQuality ServiceExpert Advice
Competitive PricesWide range of products
7 day breakdown serviceFREE survey & quotation
Contact us today(01622) 277200
T: 01622 870111 www.iron-maids.co.uk
For our special offers follow us on
Free collection and delivery withinthe local area
Shirts £1.35 (starching available)
All other clothing £3.20 per Kg
Full laundry service available
Full dry cleaning and repair service
Iron Maids offer a premier ironing service, alongside our laundry and dry cleaning services, to households all around Kent and East Sussex. Whether you require a regular ironing service or a helping hand with the odd basket of ironing, Iron Maids can help. Our service is quick, flexible, personal and affordable.
Premier ironing, laundry and dry cleaning service
Trust the domestic cleaning experts at Molly Maid
Our uniformed staff are thoroughly trained, fully insured and their work is guaranteedFree in-home estimateNo contractsAll materials suppliedRegular or special cleansTotally secureMore affordable than you may think
![Page 37: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/37.jpg)
Mid Kent Living 37
49 West Park Road, Maidstone, Kent, ME15 7AFCall us today to request your FREE, no obligation, home survey.
Brand New Straight Stairlifts
£1395 Reconditioned Stairlifts £895Both include next day installation
Tel No: 01622 756128 Mobile: 07905 [email protected]
REMAINING INDEPENDENTwhilst living with dementiaIndependence can be something peopletake for granted, but when a person isdiagnosed with dementia it could meanchanges need to be made to theireveryday lives. Alzheimer’s Societybelieves that life doesn’t end whendementia begins and with the right helpand support, it is possible to live wellwith dementia and remain independentfor longer.
People with dementia say they feelhappier if they can remain independentand in their own home for as long aspossible – often with the support ofothers. But it can be difficult managingeveryday situations for a person withdementia, particularly as the dementiaprogresses.
As a result, some people may not beas safe at home as they used to be. Butthe charity says it is important to findthe right balance between independenceand unnecessary harm.
The person with dementia should,
where possible, be involved in decision-making and their consent sought andgiven about changes. If this is notpossible, it is important that thosemaking the decision do so in theperson's best interests.
Jackie Swapp, Alzheimer’s Societyoperations manager for Kent andMedway, said: “A diagnosis of dementiadoesn’t mean that you have to give upyour independence or prevent you frommaking your own choices about how youlive. With the right help and support, youcan continue to live in your own home
for as long as you are able to. There are clear benefits for remaining in yourown home – especially as you may feelhappier and more in control there.”
There are an estimated 24,000 peopleliving with dementia in Kent andMedway and Alzheimer’s Society has a whole host of services available topeople affected by dementia, includingDementia Cafes, Singing for the Brain,peer support and activity groups.
To find out more about how thecharity can help, call 01892 835498 or visit www.alzheimers.org.uk
A warm welcome at the Dementia CafeIf you have dementia or are caring for someone with dementia then you arewarmly welcomed to the Dementia Café at Heart of Kent Hospice, Preston Hall,Aylesford, Kent ME20 7PU, where you can find out more about the supportavailable locally while enjoying a tea or coffee.
The cafe is open from 10.30am to 12.30pm on the first Saturday of everymonth. It is run by a hospice dementia nurse specialist. Just turn up you will besure of a warm welcome.
Editorial supplied by Alzheimers Society
Senior living �
![Page 38: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/38.jpg)
38 Mid Kent Living
Established 1946
National & International Removals & Secure Storage
We don’t just move houses...We move homes....
A company you can trust
Local & long distance, full & part loads
International removals and shipping
Wrap & pack service available
Domestic & commercial moving & storage
Fleet of own vehicles
All staff are British Association of Removerstrained & CRB checked
Short & long term storage
CCTV & Redcare alarm protection 24/7
Fully insured
Own storage warehouse
Self storage available
“A very big thank you to yourself, your office staff and yourremoval team for a very helpful and efficient removalservice which helped to ease the stress out of the day.
We would certainly recommend your company to anyonewho is considering a move.
Mr & Mrs Underdown, Maidstone
Bray & SonA third generation,
family runcompany with 69years experience of
moving homes.Why trust yourpossessions toanyone else!
“Just a note to commend the team who moved me last week.They were all very courteous, careful with the packing and the moving, and
continued to be cheeful in spite of the torrential rain.”Mr How, Bearsted
Call 01622 670562/[email protected]
Unit 15 Heronden Road, Parkwood, Maidstone
B012 B.A.RTrained Staff
Take a virtual tour of the warehouse with Google maps at Bray & Sons, Maidstone
![Page 39: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/39.jpg)
Mid Kent Living 39
Advertisement feature
Many people arefinding the world offinance and mortgagesmore daunting thanever in the light of newregulation. However,with the expert andfriendly guidance oflocal financial expert
Sarah Ferrell you have nothing to fear!Whether you are buying a home for the first
time, re-mortgaging, looking at your financesduring, or as you approach retirement, or maybefinancing an investment property, Sarah will bedelighted to provide the expert advice andknowledge you need to help you through theprocess.
Sarah has worked within the mortgage marketfor more than 20 years and not only has awealth of experience but is fully aware of whatlenders are looking for in these days of tighterregulation and stringent affordability criteria.Sarah says, “Every lender has a slightly differentway of calculating how much a client canborrow so knowing the criteria inside out andknowing which lender is the right one for you iscrucial.” Sarah has helped people with all
manner of circumstances - people needing toconsolidate their finances, clients who have haddifficulty securing a mortgage due to being self-employed or people finding they are suddenly“too old” to re-mortgage. Sarah says, “Manypeople who have previously made their ownmortgage arrangements and finding they areunable to get the mortgage they want and it isoften a case of just not having found the rightlender for their circumstances”.
Sarah is one of the few advisers fully qualifiedand licensed to advise on Equity Release andshe takes time to discuss how this area oflending no longer holds the stigma and risk itonce did. Based locally, she is happy to visit youat home at a time to suit you rather than tie youto 9-5 appointments.
Sarah is dedicated to making sure that sheprovides clear and uncomplicated advice toevery client. “I would rather go throughsomething repeatedly than for somebody tomake a decision of which they are unsure”
Whether you need to look at a mortgage,equity release, life cover, writing your will or ageneral review of your finances then Sarah isour local approachable professional and just theperson to speak to!
Making Mortgages simple and honest
M: 07789007447T: 01622 631372
Call Sarah at Professional Mortgage Services
FREE CONSULTATIONAVAILABLE FOR:� Mortgages for First Time
Buyers, re-mortgages, capitalraising and house purchases
� Mortgages for buy-to-let andsecond homes
� Will writing
� Equity release for retiredhome owners needing torelease a cash sum
� Life insurance, Critical Illness cover and allgeneral insurances
Professional Mortgage Services is a trading style of Sarah Ferrell an appointed representative of Intrinsic Mortgage Planning Ltd which is authorised and regulated by the Financial Conduct Authority.A fee of £249 for mortgages and £995 for Equity Release is payable on full application only.
Think carefully before securing other debts against your home. Your home may be repossessed if you do not keepup repayments on your mortgage or any other loan secured on it.Equity Release is a lifetime mortgage or home reversion scheme. To understand the features and risks, ask for apersonalised illustration.The Financial Conduct Authority do not regulate some buy to let mortgages.The Financial Conduct Authority does not regulate on Will Writing.
"Incredible"
"Amazing"
" I '’m Speechless""Baa-ri l l iant"
Sell Your House in Weeks and Save ££Thousands with our Baa-rilliant Offer!
Start today by getting your FREE no obligation property appraisal
We're
open
24/7!
Scotland
NorthEast
EastMidlands
East ofEngland
South WestSouth East
WestMidlands
Wales
NorthWest
Yorkshire
and the Humber
Part of the
EweMove Flock
Hurry! Limited to the first 20 instructions
CALL Paul now on 01622 320050OR TEXT: MAIDS to 60222
1.8%
0.9% Selling Fee(inc. VAT)
hT£ £SoHruoYYolleS
’
htidaskeeWWeniesuo
’
ffffOtililBd na
’
!
’
’
ohT££eevaS
1.8%1.8%1 8%
0.9%’
uohtiwsdnasuo
Se%% ’
effffOtnaililr-aaBr
Selling Fee’
!r
Selling Fee’
Selling Fee’
" I ''I mepS
0.9%
yadottratSSt
(inc. VAT)
’
sselhhlcche"
"tnailri ll l-aaB"
Se
ERFruoygnittegybbyy
e’
"I
e
I
llebiibreddi
ccrnIIn"
"
" zamA
g
treporpnoitagilboonEE
e ng’
gni "
g
lasiarrappayt
g Fe’
e We'rereW n open epo
! 24/7!7/42
e’
Hurry!
yadottratSSt
CALL Paul now on OR TEXT: MAIDS to 60222
’
Limited to the
ERFruoygnittegybbyy
01622 320050
Hurry!
CALL Paul now on OR TEXT: MAIDS to 60222
’
first 20 instructions
treporpnoitagilboonEE
01622 320050
Limited to the
OR TEXT: MAIDS to 60222
’
first 20 instructions
lasiarrappayt
lFewEfoaP
’
t
s
t
Humber
Scotland
South West t
Midlands
Midlands
England
h
and the orkshireY
WesNorth
dWale
West
EasSouth
h
East of
tEas
EasNorth
kcole voMe
e htt ra
Property �
![Page 40: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/40.jpg)
40 Mid Kent Living
The thought of gardening in winter in the wind,rain and mud has many of us putting off thechore until the spring. However, not all jobs need wellies and a wintercoat. Here are a few things you can be gettingon with while waiting for the better weather.
Crown HouseHome GardensDartfordKent DA1 1DZ
Call today and we'll be happy to give you a free, no-obligation survey and quotation for your beautiful drivewayor patio. We'll even guide you through our comprehensiveportfolio of products and offer great ideas onhow to put different productstogether to create a look to suit yourstyle andbudget.
As your local installer, we can offer abeautiful driveway or patio and total peace of mind
COUNTRYWIDEDRIVEWAYS0800 6965184
07437 837416 www.countrywide-landscaping.co.uk
1. Cleaning Give all of your gardening tools a goodclean to remove the dirt and any rust.
2. ShedsWinter is a good time to clear out thegarden shed and greenhouse. Get rid ofany broken pots and tools as well as oldpesticide containers. Disinfect pots andseed trays with a mild detergent.
3. CompostWith all the leaves and cuttings that
accumulate and need to be disposed of,there’s no better time to start acompost bin. For those who alreadyhave a bin, a good stir will help alongthe composting process.
4. WildlifeClean bird baths and keep them toppedup and ice-free. Putting out fat blocksand seeds will not only help local wildlifeto survive the winter but will encouragebirds, hedgehogs and small reptiles toremain in the garden. They will repay
the favour many times over byeradicating many garden pests in thecoming year.
5. CataloguesWhy not spend a cold winter’s eveningcurled up by the fire looking throughsome of the mail-order seed and plantcatalogues? That way, you can visualiseand plan your ideal garden and beraring to go with new ideas when thebetter weather does arrive.
Top 5 tips for WINTERGARDENERS
![Page 41: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/41.jpg)
Mid Kent Living 41
CRB Checked, Insured, All work
guaranteed. Free quotes and no
call out charge.
or Mid Kent area
Bruce 07584 056821
Call 0800 111 4664
www.hireahubbygroup.com
• Carpentry
• Landscaping
• Renovations
• Maintenance & more!
• Fencing
• Tiling
• Paving
• Painting
• Plastering
• Doors & Windows
• Repairs
• Roofing
Better safe than sorry…In the UK today a domestic or commercial property is burgled every 40 seconds.
Brook Security has been protecting
homes and businesses for over 20 years.
We are NACOSS Gold accredited and can
provide the very best standards of security.
Contact us now for your FREE consulation:
0800 281 249
www.brooksecurity.com
Homes & gardens �
Visit our Showroom at: Elm Court Garden Centre,Capstone Road, Gillingham Kent ME7 3JQ
CB LeisureServices
CB Leisure Services Ltd0333 014 5563
Refurbishment
Slabbing & Tiles
0% Financeavailable
Hot Tubs
Swimming Pools
Hot Tubs from£3495
![Page 42: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/42.jpg)
42 Mid Kent Living
Security.Improved
INTRUDER ALARMSCCTV SYSTEMS
ACCESS CONTROLACCESCCTV SYSTEMS
INTRUDER ALARMS
S CONTROLACCESCCTV SYSTEMS
INTRUDER ALARMS
.ImprovedSecurity
Call Our Team For A Free & Friendly Quote
Property MaintenanceJ.L.B
All Repairs Undertaken.....
� Broken Brackets � Leaking Gutter Joints� Down Pipes
T.01622 201078M.07854 529434
Annual Gutter Cleaning ServiceGutters & Fascia Cleaned
To A High Standard Inside And Out
Quality Roofing at Affordable Prices
� New Tiled Roofs� General Roofing
Repairs� Moss Removal
� UPVC Fascias, Soffits &Guttering
� Felt Flat Roofing
Prices Start From As Little As £20.00So To Ensure Your Gutters Are Flowing
Blockage Free This Winter
A family run business with over 30 years experience
Free survey & quotations
Glaze-Tech Services Ltd
• UPVC double glazed windows & doors• Solid core composite doors, the best in the market• Domestic & commercial aluminium products• Insurance backed guarantee on all installations• Supplied and installed by skilled fitters• Secondary Double Glazing Specialists• Repairs service to locks,
hinges & handles
Unit 8 2M Trade Park, Beddow Way, Aylesford, Kent ME20 7BT
T: 01622 717130F: 01622 717132
www.glazetech.co.uk [email protected]
Installers of top quality double glazing
![Page 43: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/43.jpg)
Mid Kent Living 43
Homes & gardens �
Over 50
Offers availableon ex-displaymodels
169 Tonbridge Road, Maidstone, Kent ME16 8NA
New Year, New bedroom?We have a large portfolio of extremely delighted customers thanking us for our
excellent work We are a family run business and we don’t do hard pressure selling, just friendly expert advice and design and a value for money price.
www.bedroomflair.co.uk 01622 729855
![Page 44: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/44.jpg)
44 Mid Kent Living
• Walk-in Baths • Walk-in showers (low level & level access) • Wet Rooms• Product & installation guarantee • Waterproof wall panelling
• Slip resistant safety flooring • Grab rails, shower seats & raised toilets • Friendly, family business • Discounts for OAPs, Ex Service Personnel and SSAFA
[email protected] www.ahminstallations.co.ukPlease come and visit us at Newnham Shopping Village, Bearsted, Maidstone Kent
Showroom opening times Mon-Sat 9am-5pm, Sun 9am-4pm
Offer expiresdeposits by
31st Mar 2016
FREE Georgia basin & toilet with every walk-in shower/bath order
Call now to arrange a FREE survey & quote
01622 738204 0800 731 6495
Give your home a makeoverwith the designer touch
ANNIE BAILEY / STUDIO01622 296060
Call Ann for details to visit ourstudio at Unit 2, The Old Forge,Bearsted Green.
Booking an appointment is highlyrecommended or book a home visit.
Curtains, Blinds & Soft FurnishingsWith the “Designer Touch”
• Made-to-measure curtains/blinds • Cushions & soft furnishings • Wide range of fabrics
CURTAINS, BLINDS & SOFT FURNISHINGS
WWW.DESIGNERTOUCHCURTAINS.CO.UK
• Free measuring service, quotes & fabric samples
• Fully compliant with new British Safety standard BS EN13120
0800 0742 721�SBIPRODUCTS.CO.UK�
Call today for a free home consultation.
Made to measure fixed or retractable canopies, walkway covers, carports with built in spotlights for your home.
VERANDAS & CARPORTS All weather covers for year round protection
� �
� �
� �
� �
� �
� �
� �
� �
� �
� �
� �
![Page 45: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/45.jpg)
Mid Kent Living 45
Homes & gardens �
If you want to renovate, remodel, add-on or extend your homeyou may not have to go through a lengthy process for planningpermission, but many home improvement projects can be doneunder Permitted Development (PD) rights.
1. Internal remodellingIf what you propose does not requireyou to extend the overall footprint ofthe dwelling, PD allows you to carry outthe work. You will, however, need tofollow Building Regulations guidance forsome aspects such as structuralelements and electrical works.
2. Moving windows and doorsYou do not normally need planningpermission to replace or add newwindows in the original walls of yourhouse — but you may need permission ifconditions were attached to the originalpermission. Double glazing can beinstalled under PD, providing thebuilding is not listed. For new or biggerwindows or doors, you will need tofollow Building Regulations guidance.Bear in mind that bay windows areclassed as extensions.
Planning permission to insert a newwindow or door opening is not requiredas long as any upper floor windows onthe side elevation are glazed withobscured glass (level 4 or 5 obscurity).They must also be fixed into a non-opening frame (unless the opener ismore than 1.7m above the floor of theroom in which the window is installed).
3. RooflightsAlterations can be made to the roof of adwelling under PD. However, rooflightsare not permitted under PD where they
would extend forward of the roof planeon the elevation fronting a highway. But they are permitted providing theydo not project more than 15cm from the roof slope.
4. Using attached buildings, eg. garages
You can alter internal space providingyou are not increasing the overallfootprint of the dwelling.
5. Single-storey extensions andconservatories
These must accord with the following:
� It does not sit forward of the principalelevation.
� Materials should be similar.
� Where it is within 2m of any boundary,the eaves cannot be higher than 3m,and no more than 4m in heightotherwise.
� Rear extensions — no more than 4m in depth (detached house) or 3m indepth (semi-detached or terrace).
� Side extensions — the width must notbe greater than half the width of theoriginal dwelling. Side extensions arenot permitted on Article 1(5) Land (e.g. AONB, Conservation Areas).
6. Loft ConversionsPD allows for the construction ofdormer windows, which would provideadditional headroom within a convertedattic. However, they must not sit higher
than the highest part of your existingroof, or extend forward of the roof planeon the principal elevation.
There are also limitations on the cubiccontent allowed under PD but generallyup to 40sqm is fine.
7. Two-storey extensionsA two-storey extension can only be built under PD if it is at the rear of thedwelling (this includes the addition of a second-storey onto an existing single-storey part of the house). It must notexceed 3m in depth or be within 7m ofthe rear boundary.
8. Sheds and OutbuildingsThis is possible providing the total areacovered by such buildings/enclosuresdoes not exceed 50% of the total areaof the curtilage – taking into accountany extensions, but not the area coveredby the main house.
Outbuildings cannot sit forward of theprincipal elevation, and there are heightrestrictions depending on the type ofroof (4m for dual pitch roofs, 3m forother roofs, and 2.5m when the buildingis within 2m of the boundary).Outbuildings may only be single-storey,with the maximum eaves heightremaining at 2.5m.
The use should be ‘incidental’ to thatof the dwelling, eg: gym, garage, and notused for residential, eg: bedrooms.
Eight ways to improve your homewithout PLANNING CONSENT
What is permitteddevelopment (PD)?Under PD you are able to undertakecertain projects without needingplanning permission.
![Page 46: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/46.jpg)
46 Mid Kent Living
Sales & Services
First class services for buying and selling antiques and collectables
Also confidential pawn broking services available.
Call for more information 07775 602526
19 High Street, Cranbrook TN17 3EE
Antiques@number19
01580 291648
ALL MAKES OF WATER SOFTENERS SERVICED • SALES • SERVICE • FILTERS & REVERSE OSMOSIS
• FREE SURVEY PROMPT INSTALLATIONS
01474812005
BARNSIDE, WROTHAM ROAD, MEOPHAMwww.softwaterservices.co.uk
[email protected] SALTSOFTENER
No1 Locally Since 1996
www.wrightsfencing.co.uk
Kent Carpet Cleaning Services Ltd(part of Rolin Cleaning Services)
Looking for a professional, local, family run carpet cleaning company? Then give Chrissy and John a call.
• Upholstery Cleaning • Leather Suite Cleaning • Stain Removal • Stainguard Protection
Special Offer – Free bottle of spot and stain remover
07860100295 John 01732 872 199 07801 561696 [email protected] www.rolincleaningservices.co.uk
Denied
Double Glazing Repairs& Locksmith Services
• Locks repaired or replaced • Letterboxes• Hinges & window handles• Broken glass & misted units• Lost key replaced & doors opened• Patio doors, runners & rollers• Doors that are difficult to close and lock
01622 611107 / 07967 625 447
DeniedAccessAccess
CARPET &UPHOLSTERYCLEANINGOFFER
Freephone 0800 6942024 Throughout the South East
50%Discount
HOMEFRESHCarpets (Average) Normal rate Special rateSingle Room (12’ x 12’) £42 £21Through Room (12’ x 18’) £56 £28Hall, Stairs & Landing £56 £28
Upholstery3 piece suite £84 £42Leather 3 piece suite £146 £73
CurtainsFull length £74 £37Half Length £42 £21
No hidden extras - Allprices inclusive of VAT
www.apolloroofing.co.uk
07808 414965or 01622 853601
for a free, no obligation quote
COMPLETE ROOFING SERVICE• Full Roof Installation • Tiling & Slate Roofing • uPVC Fascias & Soffits • Chimney Repointing or Removal • Roofing Repairs & Maintenance
FREE LOCAL DELIVERY
LOGMAN ENERGY suppliers of......seasoned, dry hardwood logs �
...cut to order for woodburning stoves and open fires �
�All logs seasoned from managed, sustainable Kentish woodlands.�Established 20 years - friendly and reliable
See you soon Robbie: 07802 625125or visit: www.logmanenergy.co.uk
� Roof Repairs� Tiled, Slate Roofs� Flat Roofs� Fascias, Soffits &
Guttering� Velux Roof Windows
� Moss Removal � 30+ years experience � Competitive prices� All work fully guaranteed� Free quotations &
advice
01732 422020 Tonbridge email: [email protected]
01622 244024 Maidstonewww.hawkroofing.co.uk
![Page 47: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/47.jpg)
Mid Kent Living 47
Sales and Services �
Tel: (01622) 734377 Direct: 07885 241666www.richardsroofing.co.uk email: [email protected]
RICHARDS ROOFING & BUILDING SERVICES LTDLead Work and Tiling Specialists
� Brickwork and carpentry� Plastering and decoration� Loft, cellar & garage conversions� Design support & advice� Qualified plumbers, electricians
& heating engineers
� New tiled roofs, repairs &replacements
� Slate and lead roofs & repairs� PVCu guttering, fascias & soffits� Cladding & bargeboards� Repointing & chimney repairs
CONTACT US TODAY TO FIND OUT MORE
01622 804549countrystylerecycling.co.uk
SAVE £££s ON SKIP HIRE ACROSS KENT4, 6, 8 & 12yd Skips
Permits ArrangedCompetitive Rates
Domestic & CommercialFully recycled at our own facilities
Book and pay online on our website
AY TODUS ACTCONTTATO FIND OUT MORE stylerecycountr
SA4, 6, 8 & 12yd Skips
VE £££s ON SKIP
01622 8
angedermits ArrPtese RatitivCompe
cialtic & CommerDomesacilitieswn f ot ourcled aecyFully r
ebsitewy online on ourBook and pa
uk.co.clingystylerec804549
MirandaMirandaDOUBLE GLAZING REPAIRS
Miranda
SPECIALIST REPAIRER FOR OVER 20 YEARS
ALL REPAIRS GUARANTEED
Misted / Broken Glass Units,Door & Window Handles,
Locks & HingesPatio Door Wheels & Tracks
SPARE PARTS SHOP
01634 717400www.mdgrepairs.co.uk
Units 15-16 Dickens CourtEnterprise Close, Medway City Estate
Kent ME2 4LY
Fast
Deliv
ery
01622 843511
� Skip Hire 3, 4, 6 & 12 Yard Bins
� Covering Maidstone & The Weald
� EA Registered � Fast & Prompt Service
� Commercial & Domestic
South Belringham Yard, South Lane,Sutton Valance, Kent ME17 3BD
Prom
pt
Collection
D.T SKIP HIRE
D.T SKIP HIRE
Prices from £110+VATOver 20 Years Experience
Exhausts: 01622 672798Tyres: 01622 687466
www.maidstone-exhaustcentre.co.uk
Covering most aspects of car repairs
TYRES - EXHAUSTS - BRAKES
SUSPENSION - TRACKING & MORE
Maidstone Exhaust Centre & Bower Lane Tyres
Bower Lane, Maidstone, Kent
www.elliottlandscapes.com
07545 705957
Elliott Landscapes for all your gardendesign and regular maintenanceneeds, from lawn mowing to acomplete garden makeover in a
professional, courteous and reliablemanner. We also undertake civil and
drainage works. Approved by the Federation of
Master Builders and Checkatrade.
• Pruning and maintenance • Leaf clearance • Disposal of Christmas Trees
• Garden tidy ups • Hedge cutting • Landscaping
Tel: 07593 514740aaronkinggardenmaintenance@gmail.comwww.aaronkinggardenmaintenance.co.uk
AARON KING GARDEN MAINTENANCE
![Page 48: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/48.jpg)
48 Mid Kent Living
D. BODY LTDWaste Collection
Domestic & Commercial ENVIRONMENTAL LICENSED CARRIERS
� Cesspool Emptying
� Septic Tanks
� Drain Clearing
� Sludge Removal
� Treatment Plants
� Gulleys & Forecourts
� High Pressure Jetting
01622 631688 24Hr - 7 Days A WeekPrompt & Friendly Service
www.dbody.co.uk The Paddock, Detling Hill, Maidstone, Kent
Antifreeze De-Icer Bulbs Wipers
Headcorn, TN27 9SHwww.psautoparts.co.uk 01622 891777
GET YOUR CAR READY FOR WINTERCAR BATTERIES FROM £36.99 inc VAT
� � � �
We are a well established family run companywith over 25 years experience based in Maidstonecovering Kent, we can help you with yourbathroom or kitchen design and install, wespecialise in central heating repairs and upgrades including boiler replacements. Gas safe
No 521635
PlumbustersPLUMBING & HEATING SPECIALISTS
Please call for a FREE quote
Tel: 01622 672743
Mobile 07703 442025
www.plumbusters.co.uk
The complete Bathroom Maintenance CompanyN O C A L L O U T F E E & F R E E Q U O T E S
Call Gary 07738 902116 • 01622 736266 ALL WORK GUARANTEED
Supply • Install • Repair • Floor & Wall Tiling • Full Plumbing Services
Fully Insured Free Quotes
Tel 01622 206431 Mob 07932 752875www.boatmanlandscapes.com
Complete Garden Maintenance
• Grass cutting, from field to a garden •Hedge cutting • Weed control • Japenese Knotweed treatment
• Fencing • Rubbish removal • Hedge & tree reduction • Turfing
• CRB Checked
![Page 49: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/49.jpg)
Mid Kent Living 49
Sales and Services �
TilyardAuto’s
MoT TestingFree re-test and minor adjustments
Service & repairs carried out to all makes & modelsLocal recovery service available
Tyres • Exhausts • TrackingFREE COLLECTION AND DELIVERYSERVICE WITHIN 10 MILE RADIUS
Tel: 01622 663662Unit 5, Bridge Industrial Estate, Wharf Road,
Tovil, Maidstone ME15 6RR
All MOT’s£40.00
Qualitree Services Complete Tree Care
01622 208426 www.qualitree-services.co.uk
vices
208426 62210
rQualitree Se
VV
VV
TyyrT
ree Care
kvices.co.ur.qualitree-seww.wwww
TComplete
Quotationour FreeYYooday forTTo
Call
For a free site survey call:
01622 52710607788 532926
• Fencing • Treework • Turfing • Decking• Levelling Ground • Jet Washing Service
• Water Features • Astroturf • Patios • Clearance • Driveways
No job too big or small
EPICLANDSCAPES For all your Electrical needs
From extra sockets to house rewiring Replace old light fittings with new fittings
Call Alf for your free quoteRing 07831 247843 or 01622 738680
www.electricrewired.co.uk • [email protected]
The new 17th Edition wiring regs are applied We are Part P Certificated
Electric Rewired
Underwood ContractorsSpecialists in Tarmacadam |Block Paving
Tarmac & Natural Stone | All Groundwork UndertakenFree Estimates | All Work Fully Insured & Guaranteed
For a FREE QuotationOffice: 01622 691680 | Mobile: 07592 564235
O v e r 3 0 Ye a r s E x p e r i e n c eVISIT OUR WEBSITE
www.underwoodcontractors.co.uk
Fence me in & alot moreAll types of Fencing & Gates Installed & Repairs
All Aspects of Garden Services, Landscapes, Decking, Patios, Paths & Paving.
Regular Contracts, Lawn Mowing, Hedge Cutting etc.
Call Colin on 07521 377306 or 01622 853978
Specialists in • Extensions • Plastering (All aspects)
• Refurbishments • Electrics • Modernisations • Kitchen & Bathroom Installations
• Driveways, Patios & Repointing • Fencing & Blockpaving FULLY INSURED
MD Building & Services
Tel: Mark 07841 409061email: [email protected]
www.mdbuildingservices.co.uk
MARSHALLS
01622 812005 07970 647334
@ Spindlebush Farm,Yalding Hill, ME18 6AL
� Seasoned logs suitable for open fires & wood stoves
� Bulk bags from £50� Loose loads: £100 delivered or £125� Nets of logs 3 for £10� Coal and kindling available
![Page 50: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/50.jpg)
50 Mid Kent Living
LTJ SURFACINGFamily run Business for over 27 years
Specialists in: • Tarmac • Block Paving • Concrete • Bonded Tar and Gravel • Resin Bounded • Brickwork • Driveways • Patios • Footways • Alterations and Repairs • Carparks and Roads • Pressure Washing• All other Groundwork undertaken private and commercialWe offer Machine and Hand Lay Tarmac Teams
For a Free Site Survey and Advice please call 07799 351299 or 01622 436933 Or visit us at www.ltjsurfacing.co.uk
P I N B I N SFriendly • Effecient • Reliable • Competitive
Commercial and domestic
0800 028 49 00Freephone
NEW SITE NOW OPEN
Detling Aerodrome Maidstone
Grab hire also available
� 1-14 day hire� Same day delivery� 2-4 yard mini skips� 6-20 yard skips� Roll-on, roll-offs� Council approved� Tipped at our site� 70% waste recycled� Crushed concrete� Top soil
PHONE THE REST – THEN RING THE BEST
PHONE THE REST – THEN RING THE BEST
WANTED 4X4s, CARS, VANS, TRUCKS, LORRIES AND ALL PLANT MACHINERY
Petrol, diesel, Good, bad, uglyCASH PAID, FAST COLLECTION
Running or not
07733 205083
• 4Kw Solar PV System • Installed for only £4750 • Investment return 18.4%• Saving up to 50% of your annual electricity bill • Under 6 Years payback
• Earn up to £850 per year index linked for 20 years
01622 677550www.solarisinstallations.co.uk
PAUL BEST Brickwork� Extensions� General Builder� 25 years Experience
01622 891960 07748 630747
Workshop 5, Slaney Place farm, Headcorn Road, Staplehurst, Maidstone, Kent TN12 0DT
www.theobaldsfurniture.co.uk 01580 890055
Most types of furniture re-upholstered and repaired.Cushion interior replacement service, antique restoration.Extensive range of fabrics and leather. Also a barn full ofsecond hand sofas.
Established 1975Professional and traditional upholsterers
![Page 51: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/51.jpg)
Mid Kent Living 51
The new MINI Clubman Following the success of the re-energised MINI 3-door Hatch and thesuccessful launch of the MINI 5-doorHatch, the new model features the
highest level of ride refinement everseen in a MINI.
The much-loved signature designfeature – its split rear doors – isretained, while accessibility andeveryday usability are enhanced thanksto four full-sized side doors. The resultis a powerful fusion of sleek lines,innovative touches and first-ratematerials with generous space for fiveoccupants, excellent luggage capacityand classic MINI driving characteristics.
With a more mature and sophisticateddesign, the new MINI Clubman’s
dimensions are larger than the previousgeneration MINI Clubman. The 360 litreboot can be extended to 1,250 litres byfolding the rear seats flat.
The latest generation of MINITwinPower Turbo Technology engineshave been installed, with four unitsavailable from launch – the MINI CooperClubman, MINI Cooper D Clubman, MINICooper S Clubman and MINI Cooper SDClubman. CO2 emissions are as low as109g/km, with fuel economy of up to68.9mpg.
An 8-speed Steptronic transmission is available as an option on selectedmodels. Exceptional handling comescourtesy of a suspension set-up which is unique to the new MINI Clubman.
Features make their MINI brand debuton the new Clubman, including anelectric parking brake, full electric seatadjustment and the optional MINI YoursInterior Styles with backlit door bezels.
The new MINI Clubman includesMINI’s highly acclaimed NavigationSystem as standard on all models,exemplifying the high levels of standardequipment across the range.
Pricing for the newest member of theMINI family starts at £19,995 OTR forthe MINI Cooper Clubman.
Check out the new MINI Clubman at:
www.ardenmaidstonemini.co.uk
The new BMW 7 SeriesThe sixth generation of the BMW 7 Series and flagship of
the BMW range, blends comfort, style, dynamic ability andcutting edge technology in equal measure to create aninspiring mode of luxury transport.
Thanks to the intelligent use of multiple materials in theconstruction of the body, including carbon-fibre reinforcedplastic (CFRP) for the Carbon Core, the new BMW 7 Series isboth stronger and up to 130kg lighter than its predecessor.This advanced construction is complemented by six-cylinderpetrol and diesel engines taken from the latest generation ofBMW power units.
According to the manufacturer - “With a wealth of interiorcomfort and driving features, from new ConnectedDrivetechnology to the sumptuous Executive Lounge feature, thenew BMW 7 Series redefines luxury on the move.” Find out more at: www.ardenmaidstonebmw.co.uk
The All New Jaguar XF – AT A GLANCE • All-new XF priced from £32,300• Aluminium-intensive architectureenables class-leading weight• The lowest CO2 emissions of any non-hybrid model in the segment: 104g/km /70.6MPG combined fuel economy• New manual transmission• 10.2-inch touchscreen infotainmentsystem - offers navigation, seamless iOSand Android connectivity, and 17-speaker, 825W Meridian digital surroundsound• Powertrains from 163PS Ingeniumdiesel and six-speed manual to 380PSV6 supercharged petrol and eight-speedautomatic transmission• Double-wishbone and Integral Linksuspension deliver exceptional ridecomfort, handling, and refinement• All-Surface Progress Control enablessmooth, effortless drive-away on low-friction surfaces such as snow and ice • The all-new XF offers a host ofadditional technology including full-LEDheadlights, a laser head-up display,autonomous emergency braking,adaptive cruise control with queue-assist, lane keep-assist, intelligentspeed limiter and semi-automatedparking.www.guysalmon.maidstone.jaguar.co.uk
Motoringnews
![Page 52: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/52.jpg)
52 Mid Kent Living
West Malling Garage Limited
FREE COLLECTION & DELIVERY within 10 miles
£95West Malling Garage have a fully qualifiedteam of technicians, who can service,repair and MOT all makes of car.
Fixed PriceServicingfrom
£20OFF MOT*
When bookingmade via email
* Not to be used in conjunctionwith any other offer.
01732 874350High Street, West Malling, Kent ME19 6QN
WINTER TYRES
NowAvailableCall for details
Quote MID KENT LIVING for discounted offer
from your home or office...call us sit back and relax!
Service • MOT • BodyshopAll makes & models
Free collection & delivery service
01622 739864www.patheardgarageservices.co.uk- G A R A G E S E R V I C E S -
BEARSTED
The Willows, The Street, BearstedMaidstone, Kent ME14 4HH
DETLING
Highland Garage, DetlingMaidstone, Kent ME14 3HT
![Page 53: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/53.jpg)
Mid Kent Living 53
H & C Motors Ltd.H & C Motors Ltd.
Servicing & Repairs while you wait,close to town centreDealer Level DiagnosticsMOTs by appointmentFree Courtesy Car by Appointment
Independent BMW & Mercedes Specialists
Affordable, advanced technology servicing
01622 752364www.handcmotors.co.uk
Approved by Trading Standards
Why pay main dealer prices?
19-25 Rawdon Road, Maidstone, ME15 6PT
Air Conditioning SpecialistsConvertible Hood SpecialistsOver 70 years’ of combinedexperience and accreditedtraining with local main dealersWe service all makes & models
MOBILE BODY REPAIRS
AUTOSPRAYSOLUTIONS
For the ultimate paint finish!
� SCUFFS, SCRATCHES, DENTS etc � SAVINGS UP TO 50% COMPARED TO BODYSHOPS
� Fully guaranteed to main dealer standard � Fully insured � 25 years experience � Insurance work welcome
Winner of tradespersonof the year 2013
Call now for your free quotation on01622 727263 / 07773 340049
or email [email protected]
Followus on
Motoring �
![Page 54: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/54.jpg)
54 Mid Kent Living
Carry on Glamping
Name:
Address:
Email:
Tel:
Closing date: Friday 4 March 2016
To opt out of receiving informationabout special offers please tick box.
WINOne night stay for
two worth £85
Send your entry to Kits Coty competitionMail Publications Ltd, 2 Forge House, Bearsted GreenBusiness Park, Bearsted, Maidstone, Kent ME14 4DT.
Kits Coty Glamping is a small family runglamping site, near Aylesford in Kent. We aremulti award winning having recently beenawarded Bronze in the category – self-catering holiday provider ofthe year for the South of England.
We aim to provide glamourous camping foreveryone by supplying everything you will needto ensure a stress free glamping experience.
We are giving away a night for 2 people inPamela, our vintage inspired Shepherds hut.Prize includes free hamper on arrival(containing wine, marshmallows, tea , coffee,water etc.) and free logs for either the woodburner orthe fire pit.
Breakfast hampers or cream teas can bebooked at extra cost as can additionalaccommodation if you want to bring somefriends.
Prize must be taken on a weekday (Mondayto Thursday) evening in either April or May2016 (excluding bank holidays).
Tel: 01634 685862 | Email: [email protected] Web: www.kitscotyglamping.co.uk
So hairdressing of Bearsted recentlycelebrated its eighth year of trading – and itcertainly has a lot to celebrate. In this time,not only has the popular salon gone fromstrength to strength but scooped a whole hostof accolades, including UK Creative Colouristtitle in 2013, a finalist at the L’Oréal Colourtrophy in 2014, winning the SouthernRegional final. It is this winningformula that keeps it ahead in itsfield and attracts customers returntime and time again.
The salon has continued to growand expand in the past eight years.Since it launched in 2007 the salonhas built an excellent reputation forits first-class friendly service andcreativity by providing a VIPtreatment for every client.
Steve O’Rourke, who co-owns thesalon with Sam Cooper, said: “We
work hard to ensure that every client istreated as a VIP, so they can sit back relaxand let us do the rest”
We are giving one lucky reader the
chance to experience the VIP treatment
at the salon. To win this excellent prize
simply fill in your details opposite and
send in your entry.
Experience the VIP treatmentat So Hairdressing
Name:
Address:
Email:
Tel:
Closing date: Friday 26th February 2016
To opt out of receiving informationabout special offers please tick box.
A gloss colour, cut & finishWorth £87
WIN
Send your entry to
So Hairdressing CompetitionMail Publications Ltd, 2 Forge House,
Bearsted Green Business Park, Bearsted,Maidstone, Kent ME14 4DT. 85 Ashford Road, Bearsted,
Maidstone, Kent, ME14 4BS
www.sohairdressing.co.uk
� Competitions
![Page 55: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/55.jpg)
Mid Kent Living 55
Bringingyou more than
just fireplaces
10% off throughout January
All plumbing and HeatingWork Undertaken
All Work GuaranteedGas Safe Approved
EngineerProfessional,
Reliable Service
Est. - 1971
Local family plumbers
Call Ian 07860 293732
G&I Streeter
01622 737803Email: [email protected]
THEFIREPLACE
• Multifuel,woodburning and gas stoves
• Electric, gas &solid fuel fires
• Marble, wood &stone surrounds
• Fitting serviceavailable
01795 599234www.the-fireplace.net
2 Castle Court, Castle Road, Eurolink Industrial Estate,Sittingbourne, Kent ME10 3TD
Mon-Fri 9.30am - 4pm • Sat 10am - 4pm*Terms & conditions apply
Serious On StandardsWe guarantee that all waste will be recycled in the mostresponsible way under our licence no. EAN/954896/CB
We are fully licensed and insured!
Junk Removal and Clearance the Smart Way withSOS Recycling!
Why have all the trouble of ordering a skip that willcost you more and then having to fill it yourself
Our two man teams will clear your rubbish whilst youcan just sit back and relax with a cup of tea!
Why spend a large part of your weekends queuing atthe local tip to get rid of your junk when we can do itall for you quickly, economically and professionally!
SOS Recycling is registered with the EnvironmentAgency and practices environmental responsibility
For more information on our junk clearance servicesor to book your junk removal call today on 07780 730217 Email - [email protected]
![Page 56: Winter Activities - Downs Mail · Preparatory School(Nursery to age 11) Friday 4th March 2016 T: 01622 842117 | E: leckiea@svs.org.uk. ... autumn but gives off the aroma of burnt](https://reader034.vdocuments.net/reader034/viewer/2022050410/5f8701350fd5b570f01384d5/html5/thumbnails/56.jpg)
Mid-Kent Living is published by Mail Publications Ltd, Forge House, Bearsted Green Business Park, Bearsted, Maidstone, ME14 4DT. (Chairman: Claire Procter, Sales Manager: Bill Brett, Editor: Stephen Eighteen). Printed by The Printing House
Tel: 01622 630330 email: [email protected] website: www.downsmail.co.uk
windows : doors : conservatories
We are a local business thatbelieve the key to success is“reputation”; that is why we like to distance ourselves from othercompanies in our sector and theway they work. If you would like aquality finish and competitive pricewithout the hassle give us a call.
www.southernglassmaidstone.co.uk
WE DO NOT employ pushy salesmen on commission. WE DO employ our own fitters. WE DO insure all our guarantees for peace of mind. WE DO give prices over the phone.
‘Our reputationspeaks for itself ’
1a Brunswick Street East Maidstone ME15 7UX
NEW SHOWROOM NOW OPEN
call: 01622 686732 or 01622 692217
(OPEN: Monday to Friday: 8am - 5pm. Saturday: 9am - 1pm)