ebi is an outstation of the european molecular biology laboratory. a web service for the analysis of...
TRANSCRIPT
![Page 1: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/1.jpg)
EBI is an Outstation of the European Molecular Biology Laboratory.
A web service for the analysis of macromolecular interactions and complexes
MSD Protein Interfaces, Surfaces and Assemblies
Glen van GinkelPDB Depositions
http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html
![Page 2: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/2.jpg)
Protein Data Bank in Europe http://www.ebi.ac.uk/pdbe1.11.092
Protein Quaternary Structures (PQS)
PQS is often a Biological Unit, performing a certain physiological function
PQS is a difficult subject for experimental studies
Assembly of protein chains, stable in native environment
Light/Neutron/X-ray scattering: mainly composition and multimeric state may be found. 3D shape may be guessed from mobility measurements.
Electron microscopy: not a fantastic resolution and not applicable to all objects
NMR is not good for big chains, even less so for protein assemblies.
In PDB, very few quaternary structures have been identified experimentally.
![Page 3: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/3.jpg)
3
PQS are difficult to calculate…
50 - 90% Secondary Structure (CASP 5), depending on method2
10 - 90% Tertiary Structure (CASP 5), depending on method and target
3
Probably 0%Quaternary Structure. Docking of given number of given structures: 5 - 20% success (CAPRI 5)
4
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFF
then we can calculate ...
If we know the sequence ...
1
![Page 4: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/4.jpg)
But PQS are assigned to many PDB entries!
Most of those are PROBABLE Quaternary Structures.
4
1. Depositor’s say prevails.
2. Accept everything which passes formal validation checks.
3. No experimental evidence for PQS is required.
4. If a depositor does not know or does not care (60-80% of instances for PQS), the curator is to decide.
5. The curator may use computing/modeling tools to assist the PQS annotation.
The wwPDB “rules” are:
www.wwpdb.org
![Page 5: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/5.jpg)
5
Crystallography is special in that …
A) crystal is made of assemblies
![Page 6: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/6.jpg)
6
Crystallography is special in that …B) there is no need to dock subunits
– the docking is given by crystal structure
Macromolecular interfaces should be viewed as an additional and important artifact of protein crystallography
![Page 7: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/7.jpg)
7
Wealth of experimental data on PQS in PDB
Crystal = translated Unit CellsMore than 80% of macromolecular structures are solved by means of X-ray diffraction on crystals.
It is reasonable to expect that PQS make building blocks for the crystal.
An X-ray diffraction experiment produces atomic coordinates of the Asymmetric Unit (ASU), which are stored as a PDB file.
In general, neither ASU nor Unit Cell has any direct relation to PQS. The PQS may be made of
Unit Cell = all space symmetry group mates of ASU
PDB file (ASU)
• a single ASU• part of ASU
• several ASU• several parts of ASU
![Page 8: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/8.jpg)
8
?no image or bad image
In (very) simple terms …
2
crystallisation
3
in crystal
? ?good image but no
associations
in vivo
1
![Page 9: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/9.jpg)
9
PQS server @ EBI (Kim Henrick) Trends in Biochem. Sci. (1998) 23, 358 PITA server @ EBI (Hannes Ponstingl) J. Appl. Cryst. (2003) 36, 1116
A simple thing to do …
![Page 10: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/10.jpg)
10
PQS server @ MSD-EBI (Kim Henrick) Trends in Biochem. Sci. (1998) 23, 358
http://pqs.ebi.ac.uk Method: progressive build-up by addition of monomeric chains that suit the selection criteria. The results are partly curated.
http://www.ebi.ac.uk/thornton-srv/databases/pita/ Method: recursive splitting of the largest complexes as allowed by crystal symmetry. Termination criteria is derived from the individual statistical scores of crystal contacts. The results are not curated.
PITA software @ Thornton group EBI (Hannes Ponstingl) J. Appl. Cryst. (2003) 36, 1116
Making assemblies from significant interfaces
![Page 11: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/11.jpg)
11
Protein functionality: the interface should be engaged in any sort of interaction, including transient short-living protein-ligand and protein-protein etc. associations. Obviously important properties:
• Affinity (comes from area, hydrophobicity, electrostatics, H-bond density etc.)
Depends on the problem.
Stable macromolecular complexes, PQS: the interface should make a sound binding. Important properties:
• Sufficient free energy of binding• something else?
• Aminoacid composition• Geometrical complementarity• Overall shape, compactness• Charge distribution• etc.
and properties that may be important for reaction pathway and dynamics:
What is a significant interface?
![Page 12: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/12.jpg)
12
Jones, S. & Thornton, J.M. (1996) Principles of protein-protein interactions, Proc. Natl. Acad. Sci. USA, 93, 13-20.
10
20
30
40
50
60
20 40 60 80 1000Rank ordering bins
% o
f re
al i
nte
rfa
ces
Planar Nonplanar
rms of least-square plane
10
20
30
40
50
60
20 40 60 80 1000Rank ordering bins
% o
f re
al i
nte
rfa
ces
Low protrusion High protrusion
Protrusion index
10
20
30
40
50
60
20 40 60 80 1000Rank ordering bins
% o
f re
al i
nte
rfa
ces
Less hydrophobic More hydrophobic
Hydrophobicity
Low ASA High ASA
ASA
10
20
30
40
50
60
20 40 60 80 1000Rank ordering bins
% o
f re
al i
nte
rfa
ces
Real and superficial interfaces
![Page 13: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/13.jpg)
13
“No single parameter absolutely differentiates the interfaces from all other surface patches”
Jones, S. & Thornton, J.M. (1996) Principles of protein-protein interactions, Proc. Natl. Acad. Sci. USA, 93, 13-20.
Formation of N>2 -meric complexes is most probably a corporate process involving a set of interfaces. Therefore significance of an interface should not be detached from the context of protein complex
“…the type of complexes need to be taken into account when characterizing interfaces between them.”
Jones, S. & Thornton, J.M., ibid.
Real and superficial interfaces
![Page 14: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/14.jpg)
14
It is not properties of individual interfaces but rather chemical stability of protein complex in general that really matters
Protein chains will most likely associate into largest complexes that are still stable
A protein complex is stable if its free energy of dissociation is positive:
ΔG diss0 =− ΔG int−TΔS0
Chemical stability of protein complexes
![Page 15: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/15.jpg)
15
Solvation energy of protein complex
Solvation energies of dissociated subunits
Free energy of H-bond formation
Free energy of salt bridge formation
Number of H-bonds between dissociated subunits
Number of salt bridges between dissociated subunits
A1 A2 A3 A1A2A3
Dissociation into stable subunits with minimum
ΔG diss
Choice of dissociation subunits:
Protein affinity
![Page 16: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/16.jpg)
Macromolecular Structure Database31.10.0716
Translational entropy
Rotational entropy
Sidechain entropy
Mass
Tensor of inertia
Solvent-accessible surface area
Symmetry number
Entropy of macromolecules in solutions
![Page 17: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/17.jpg)
17
• crystal is represented as a periodic graph with monomeric chains as nodes and interfaces as edges
• each set of assemblies is identified by engaged interface types
• all assemblies may be enumerated by a backtracking scheme engaging all possible combinations of different interface types
Example: crystal with 3 interface types
Assembly set
Engaged interface types
1 000 - only monomers2 001 - dimer N13 010 - dimer N24 011
Assembly set
Engaged interface types
5 100 - dimer N36 101 7 110 8 111 - all crystal
Enumerating assemblies in crystal
![Page 18: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/18.jpg)
18
Method Summary
1. Build periodic graph of the crystal
2. Enumerate all possibly stable assemblies
3. Evaluate assemblies for chemical stability
4. Leave only sets of stable assemblies in the list and range them by chances to be a biological unit :
• Larger assemblies take preference• Single-assembly solutions take preference• Otherwise, assemblies with higher Gdiss take preference
Detection of Biological Units in Crystals:
![Page 19: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/19.jpg)
Macromolecular Structure Database31.10.0719
If you have to ask ...
• What quaternary structure can my crystal structure have?
• What are the crystal contacts and interfaces in my structure ?
• What are the energetics that keep my quaternary structure together ?
• Are there any other structures in the PDB that have similar interfaces ?
USE MSDPisa
Upload your own PDB file for analysis !!
![Page 20: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/20.jpg)
20
A new MSD-EBI tool for working with Protein Interfaces, Surfaces and Assemblies
http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html
Web-server PISA
![Page 21: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/21.jpg)
21
![Page 22: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/22.jpg)
22
![Page 23: EBI is an Outstation of the European Molecular Biology Laboratory. A web service for the analysis of macromolecular interactions and complexes MSD Protein](https://reader036.vdocuments.net/reader036/viewer/2022062301/56649ebc5503460f94bc53eb/html5/thumbnails/23.jpg)
Details about the interface…