local coupon book 2012

Port Townsend & Jeff erson County Leader 2012 Local • 1

Lake Leland

Fort Worden Fort Worden State Park

Mystery Bay

Dosewallips State Park

Dosewallips State Park

Dosewallips

Little Quilcene River

GardinerGardiner

Protection

Marrowstone Island

Nordland

Coyle

QuilceneQuilcene

Four CornersCorners

Silverdale

Irondale

ToToTandos

Peninnsususl a

entntn

Da Da D

C e R

y

ayayaRdRdR .

yRdRdR.

Port TownsendCoupeville Ferry

Ferry to San Juan Islands

Visitor Center

Visitor Center

Corners

Little Quilcene River

Port Townsend

CapeGeorge

Visitor Center

The

INSIDE:Thousands of dollarsin coupon savings!

State Park

Mystery Bay State Park


Mystery Bay

Fort Flagler Fort Flagler State Park

Fort Flagler State Park

Fort Flagler

Fort Townsend Fort Townsend State ParkState Park

Marrowstone Island

Naval Naval Magazine Magazine

Indian Indian Island Island

Nordland

Port TownsendCoupeville Ferry

Fort Townsend Fort Townsend

Visitor Center

Coyle

BrinnonVisitor CenterVisitor CenterVisitor Center

Crocker Lake

GibbsLake

Sandy Shore Lake

Sandy Shore Lake

Sandy Shore

mountntn RdRdR .

QuilceneVisitor CenterVisitor Center

d

Ludlow

R

Ludlow

R

Ludlowd Ludlowd Ludlow

RdR.

R

Bridgehaven

INSIDE:

Anderson Lake Anderson Lake Anderson Lake State ParkState ParkState Park

H.J. Carroll Park

Chimacum

Port Hadlock

Irondale

DiscoveryBay

E

OaOaO kakaBa

CentntnerRdRdR

Wesesetsts

Va Va Vlleyeye

HadlockHadlockThe



Mystery Bay

GibbsLake

Eaglemo

d.ll

Your passport toYour passport toYour passport toLake LelandYour passport toLake LelandYour passport to

n

Your passport to

nt

Your passport to

tntn

Your passport to

ntneYour passport toerYour passport torRYour passport toRdYour passport todRdRYour passport toRdR.Your passport to.

D

Your passport to

D

Your passport toYour passport toVisitor

Your passport toVisitor CenterYour passport toCenterYour passport to

Local bargains,

C

bargains,

Ce

bargains,

e a

bargains,

ab

bargains,

bo

bargains,

ob bargains,bR bargains,Rd bargains,dRdR bargains,RdR. bargains,.

from from from from LocalC

LocalCo

Localoy

Localyl

Localle

Locale

businesses, Shine businesses, ShineR

businesses, Rd businesses, dRdR businesses, RdR . businesses, .

for for Local people.

SUPPLEMENT TO THEPORT TOWNSEND & JEFFERSON COUNTY LEADER

PaPaP rarar dada idid seBaBaB yaya

Visitor Center

Ludlowd Ludlowd Ludlow.

Your passport toYour passport toCenterYour passport toCenter

businesses, Shine businesses, Shine

2 • 2012 Local Port Townsend & Jefferson County Leader

Learn more > ourfirstfed.com 800.800.1577

Member FDIC

How Local is Your Bank?

First Federal, the only truly local bank on the Olympic Peninsula.

Bank Headquarters

Bank of America Charlotte, North Carolina

Chase Bank New York, New York

Columbia Bank Tacoma, Washington

KeyBank Cleveland, Ohio

Kitsap Bank Port Orchard, Washington

Sound Community Bank Seattle, Washington

Sterling Savings Bank Spokane, Washington

Union Bank San Francisco, California

US Bank Minneapolis, Minnesota

Wells Fargo San Francisco, California

First Federal Port Angeles, Washington

Port Townsend & Jefferson County Leader 2012 Local • 3

901 Ness’ Corner RoadPort Hadlock, WA

Building partnerships since 1984.Building partnerships since 1984.

360-385-1771

/HadlockBuildingSupplyhadlockbuildingsupply.com

family owned & operated since 1984


$5 offYOUR $20.00 PURCHASE

Does not apply to the purchase of tools, lumber or sale items. Limited to stock on hand. Do not combine with any other o� er. See store for details. Expires 10/31/13.

901 N

ess’ C

orne

r Roa

d • Po

rt Ha

dloc

k 36

0-38

5-17

71 • h

adlo

ckbu

ildin

gsup

ply.c

om

Building partnerships since 1984

$10 off$YOUR $50.00 PURCHASE


901 N

ess’ C

orne

r Roa

d • Po

rt Ha

dloc

k 36

0-38

5-17

71 • h

adlo

ckbu

ildin

gsup

ply.c

om




901 N

ess’ C

orne

r Roa

d • Po

rt Ha

dloc

k 36

0-38

5-17

71 • h

adlo

ckbu

ildin

gsup

ply.c

om




901 N

ess’ C

orne

r Roa

d • Po

rt Ha

dloc

k 36

0-38

5-17

71 • h

adlo

ckbu

ildin

gsup

ply.c

om



Ajax Cafe . . . . . . . . . . . . . . . . 15Bonita’s Four-Legged

Friends . . . . . . . . . . . . . . . 45Brickhouse Bistro . . . . . . . . . 19Chandlery c/o NWMC. . . . . . . 3Circle & Square Auto Care . . 47Creative Union Fabrics. . . . . . 7Derr Jewelry . . . . . . . . . . . . . 42Don’s Pharmacy &

Soda Fountain. . . . . . . . . 15Dos Okies Barbeque. . . . . . . 13El Sarape . . . . . . . . . . . . . . . . 45Elevated Ice Cream . . . . . . . 19Face of Grace. . . . . . . . . . . . . 15Fins Coastal Cuisine . . . . . . . . 3First Federal . . . . . . . . . . . . . . 2Four Sisters . . . . . . . . . . . . . . 41Frameworks . . . . . . . . . . . . . 43Gardens at Four Corners . . . 19Gudlife. . . . . . . . . . . . . . . . . . 13Hadlock Building Supply. . . . 3Homer Smith Insurance . . . 21Je� erson Transit. . . . . . . . . . 13Jordini’s On The Water . . . . . 29Khu Larb Thai Restaurant . . 37Leader . . . . . . . . . . . . . . .27, 33Lulu’s B&B for Dogs . . . . . . . 41Maricee Fashions . . . . . . . . . 43McDonald Insurance Group. . 41Mean Bean Co� ee Co. . . . . . 21Muskan Indian Restaurant 29

Naturalist Carpet Cleaning 27Nourishing Life Acupuncture 10Olympic Art & O� ce . . . . . . 13Pane d’Amore . . . . . . . . . . . . 29Perfect Dreams Cupcakes . . 29Pet Town . . . . . . . . . . . . . . . . 35Petals Flower Shop . . . . . . . 27Port Townsend Farmers

Market . . . . . . . . . . . . . . . 35Pourhouse. . . . . . . . . . . . . . . 45Printery Communications. . 11PT Shirt Co. . . . . . . . . . . . . . . 45Public House Grill. . . . . . . . . 43Quimper Mercantile Co . . . . 37Remax First. . . . . . . . . . . . . . 11Seams To Last . . . . . . . . . . . . 27Solar Hot Water . . . . . . . . . . 43SOS Printing . . . . . . . . . . . . . 10Sport Townsend . . . . . . . . . . 19Sweet Laurette Cafe

& Bistro . . . . . . . . . . . . . . . 3United Good Neighbors. . . . 48Uptown Nutrition . . . . . . . . 19Wandering Wardrobe . . . . . 15Water Street Creperie . . . . . 37Weddings by Design . . . . . . 24Wine Seller . . . . . . . . . . . . . . 41

Index to

PUBLISHERScott Wilson

EDITORAllison Arthur

DESIGN & LAYOUTChris Hawley

PRODUCTIONJohn StangerMarian RohKathy Busic

WRITERSAllison ArthurMegan Clafl inTristan HieglerViviann Kuehl

COPY EDITORSRobin Dudley Lynn Nowak

Sunny Parsons

ADVERTISINGSara RadkaTami HewittCarla Patton

Catherine Brewer

THE LEADER226 Adams Street

Port Townsend, WA 98368

360.385.2900website:

ptleader.com

Weddings by DesignWine Seller . . . . . . . . . . . . . .

ADVERTISINGSara Radka

Copyright 2012Port Townsend &

Jefferson County Leader

6 • 2012 Local Port Townsend & Jeff erson County Leader

Chamber supports local businesses

Why does it matter that people shop locally?“Every purchase you make locally helps to keepour communities vibrant and economicallysustainable,” says chamber Executive Director Teresa Verraes.

What does the chamber do for local businesses?“The chamber’s vision is to be the leading network fostering the most well-informed, driven, dynamic businesses and professionals in Jefferson County,” says Verraes.

You sponsor a lot of events to support businesses, don’t you? “There’s so much going on to create a more vibrant economy in Jefferson County,” says Verraes, urging businesses to take advantage of programs like the free small business symposium that was offered as well as opportunities with the Young Business Professionals, Team Jefferson and Main Street.

You are in this for the long haul?“The Jefferson County Chamber of Commerce has a commitment to the long-term economic, social and environmental health of our region.”

And your mission then is to build a local economy?“Our mission is to build and serve a large, diverse member network by providing resources and opportunities for connecting with the greater business community, informing members on matters that impact the local economy, promote member businesses throughout the region and advocate for member issues and opportunities to support business growth and well-being.”

Name some of kinds of events you sponsor?“In collaboration with Local 20/20, Main Street, EDC/ Team Jefferson and the Silverwater Café we’re debuting ‘Fixing the Future,’ which is about strengthening our local economy. We put on programs like ‘Marketing in the Real World.’ Check out our website at jeffcountychamber.org. There’s so much going on.”

– Allison Arthur

Jefferson County Chamber of Commerce ambassadors and friends celebrate the expansion of Conservatory Coastal Homes. The business moved this year from a small space to a large corner lot in downtown Port Townsend. Submitted photo

Chamber supports local

Why does it matter that people shop locally?“Every purchase you make locally helps to keep

sustainable,” says chamber Executive Director Teresa Verraes.


Present this coupon in person and receive

20% OffAny Purchase of $25 or more; one time purchase,

not to be combined with any other discounts.

Open 7 Days ~ 10 a.m. -5 p.m.

Located at the end of Water Street • 360.385.3628 ext. 101Located at the end of Water Street • 360.385.3628 ext. 101

The Wooden Boat ChandleryPurveyors of All Things Nautical

Creative Union Fabrics112 Kala Square Place, Port Townsend 360-379-0655

Spend $50 or more & receive$10 Off !Expires 3/31/13

Waterfront views1019 Water Street

360-379-FISH (3474)www.fi nscoastal.com

Nobody prepares seafood like

Sandwiches, steaks, pastas, salads all at

Open 7 days for lunches & dinner at

Now in our 11th year & going strong.

$10OFFpurchase of $40 or more!

Free Dessert!With purchase of 2 entreés

Thursday, Friday & SaturdayDinners 5-9 pm

Café & BistroCafé & BistroSweet Laurette


THE WOODEN BOAT CHANDLERYSailing Supplies . Navigational Instuments .

Ships’ Bells & Clocks . Binoculars . Jackets . Vests . Hats & Scarves . Unbreakable Dinnerware . NOAA Charts & Cruising Guides . Maritime Books . Prisms . Port Holes . Lighting . Blocks . Cleats . Oarlocks . Shipmate Stoves . Nautical Gifts & Galleyware . Pirate Gear & Sailor Toys for

Li’l Scuppers.

A hidden paradise . . .right here on the peninsula!

Fabrics • Notions • Thread • Fine ScissorsPatterns & More!

Come see our selection.Happy crafting!

Creative Union Fabrics112 Kala Square Place, Port Townsend 360-379-0655

1019 Water Street • Port Townsend • 360-379-FISH7 days a week • 11 am - 9 pm • www.� nscoastalcuisine.com

Come Enjoy a relaxing meal & a great view!

Tuesday Nights~ half priced bottle of wine ~

Find us. Like us.

Laurette believes in simply fresh, delicious food, which

she often buys at the Farmers’ Market down the street.

Wed., Thur., Fri. • Breakfast / Lunch: 8 am to 2:30 pm

Sat. Brunch: 8 am - 2:30 pmSun. Brunch: 8 am - 2 pm

Thur., Fri. & Sat. Dinner: 5pm-9pmClosed Mondays & Tuesdays

1029 Lawrence St. • 385-4886www.sweetlaurette.com


‘The Local’ bagel evengets recycled

Business: Bob’s Bagels, owned by Bob Larsen

How did you start?“We started by giving away bagels to friends andclients who, in turn, gave them to friends, which startedthe demand for more,” says Larsen. “The fi rst day, we made 68 bagels and sold 40.”

How many are you making today?“We’re making about 1,200 a week and selling all but a handful we save for ourselves.”

You call one sandwich “The Local.” Why?“‘The Local’ is from our fi rst menu. It’s a bagel with Cape Cleare smoked salmon and Mt. Townsend Creamery fromage blanc. With our current menu we could call every sandwich ‘The Local.’ With the exception of cream cheese and butter, all our sandwiches have local ingredients.”

And you do something cool with leftovers?“The leftover toppings that do not stick to our bagels are collected and given to Finnriver Farm to feed their chickens. We then buy eggs from them to make into sandwiches at the [Port Townsend farmers] market. Strange full circle.”

And you are making something new in house?“Our vegetarian pecan sausage is made in house, and it also has local ingredients in it like Pane d’Amore bread crumbs, Mystery Bay chèvre and ricotta, Midori produce and ferments, Colinwood produce, Red Dog produce, Nash’s fl our, to name a few supplies.”

How do you support local businesses?We listen to music a lot, including KEXP in Seattle and KPTZ. We cater both of their pledge drives. We buy several CDs from Quimper Sound each month. All our offi ce supplies come from Olympic Art & Offi ce. We buy kitchen wares from What’s Cookin’ and Green Eyeshade. Because we do so much of our delivering and commuting via bicycle, we try to support all the bike shops in town and slightly out of town. Some others are coffee from Sunrise, soaps from Bunny’s and refueling, after 40 miles of deliveries, with breakfast at the Moose or Goose.”

– Allison Arthur

“The Local” is the name of a bagel sandwich created by Bob Larsen. It includes Cape Cleare Fishery salmon and Mt. Townsend Creamery’s cheese, featured here on an “Everything” bagel. Photo by Allison Arthur

‘The Local’ bagel even

“We started by giving away bagels to friends andclients who, in turn, gave them to friends, which started


Nourishing Life Chinese Medicine

Acupuncture & Herbs

www.nourishinglifeacupuncture.com

$30

Community Acupuncture Clinic

$10 initial paperwork fee does apply for New Patients

1233 Lawrence Street 360-379-6798

Mondays4 - 7

Wednesdays1 - 4

Fridays1 - 4

$30 Affordable Acupuncture Treatments!

2319 Washington Street, Port Townsend385-4194 sosprinting.biz [email protected]

Full color, Full service, Design to bindery.

Gr

een Business

ENVIRONMENTAL AW

ARD

My great-grandfather John Huntingford was a county commissioner who built our courthouse as we made the transi-tion from territory to statehood. My father George served for 22 years and my cousin Glen for 12 years. Their tradition of service is a daily inspiration.

While SOS Printing has been serving the people and businesses of Jeffer- son County for 35 years, owner Dan Huntingford is a fourth generation native. The Huntingford family have been helping make Jefferson County a better place since 1869. (or thereabouts) So when you need printing, why not head on down to the beach, to SOS Printing – National Award winning, one of the finest small print- shops in America.


KEVIN MILLER22 Years of Local Service(360) [email protected]

JEFF ASHMOREReal Estate Professional

(360) 531-4131ashmore.je� @gmail.com

*Some restrictions apply. Contact listing agents for details.

$10000 OFF

Design it. Print it. Copy it. Mail it.631 Tyler Street, Uptown PT M-F 9:00-5:30

800-339-1256 360-385-1256 www. printery.com

Web and Graphic Design for Company Identity Package, Logo, Brochure, Direct Mail or Newsletter

One coupon per customer. Offer expires 11/30/12

Design it. Print it. Copy it. Mail it.Design it. Print it. Copy it. Mail it.Design it. Print it. Copy it. Mail it.

Valid thru 3/30/13 • First 7 coupons only! *

$30,000 potential savings!

Lynnesfield Homes

7 GOLDEN TICKETS10% OFF

$10000 OFF

Design it. Print it. Copy it. Mail it.631 Tyler Street, Uptown PT M-F 9:00-5:30

800-339-1256 360-385-1256 www. printery.com

Web and Graphic Design for Company Identity Package, Logo, Brochure, Direct Mail or Newsletter

One coupon per customer. Offer expires 11/30/12

Design it. Print it. Copy it. Mail it.Design it. Print it. Copy it. Mail it.Design it. Print it. Copy it. Mail it.


Mercantile – a new localanchor downtown

Quimper Mercantile is one of the newestbusinesses in Jefferson County, and it was startedby and for locals. The community-owned business– more than 850 people have bought stock in thecompany – is open in downtown Port Townsend where Swain’s Outdoor and More had been for years. Quimper aims to be an anchor store to downtown.

What’s the aim of Quimper Mercantile?“We want to bring back everyday shoppers, people who would otherwise go online or wait to go to Sequim. Instead, we want people to say, ‘I’m going to go downtown to Quimper, they might have it,’” says Quimper Mercantile CEO Peter Quinn.

You have a motto, don’t you? “My slogan is ‘We just want to buy some socks,’” Quinn says. “We’ll have everyday things at everyday prices.”

How many local products do you have to start?“Fifteen or 20 or more. It’s an ongoing process. We won’t stop adding local products. We’ll be expanding our line.”

And you’re employing local people? “Yes. We have eight people now. We have people from Port Townsend to Brinnon. Everyone lives locally.”

What do you need to be successful?“We need people to shop and we need to sell more stock [in the company]. We’re really pleased with the depth and breadth of what we have, but we have other uses for the money. We could easily put in another 50 to 60 percent of the inventory and all that takes is more investing.”

How excited are you for this for the local economy?“I don’t think there’s a question that this is worth doing. We know how valuable it is to have a vibrant downtown, and you can’t do that without an anchor tenant. People won’t come down every day if they don’t think there’s something for them. They have to have a feeling they are going shopping. It’s essentially the Port Townsend mall.”

– Allison Arthur

Quimper Mercantile assistant manager Holly Mayshark, manager Shelton Spencer and CEO Peter Quinn note that clothing and shares in the store are available. Photo by Allison Arthur

Mercantile – a new localanchor downtown

businesses in Jefferson County, and it was started

Swain’s Outdoor and More had been for years. Quimper aims


J’eet Yet?Your Local BBQ Joint

Since 1999

2310 Washington St., Port Townsend • We Cater!360.385.7669 • www.dosokiesbarbeque.com

Dos Okies BBQGenuine pit-smoked BBQ

(360) 385-4777www.jeffersontransit.com

Car: $15,000, Car Insurance: $300Tank of gas: $40

Texting while driving: $124

Riding Jefferson Transit: $1.50Save your bucks & ride with us!

220 Taylor Street • 385-3141 • fax 379-9784 • Mon. - Fri. 9 - 5:30, Sat. 10 - 5

Why put more miles on old Bessie? We have what you need and we will special order!

220 Taylor Street • 385-3141 • fax 379-9784 • Mon. - Fri. 9 - 5:30, Sat. 10 - 5220 Taylor Street • 385-3141 • fax 379-9784 • Mon. - Fri. 9 - 5:30, Sat. 10 - 5

• Business Supplies• Business Solutions• Real People • Plus Art

Shop with us at www.iteminfo.com

Gudlifewww.Gudlife.com

Social network for the

Homo \ Bi \ Transcommunity of the Olympic Peninsula

Networking E-List • Weekly LunchesMonthly Potlucks • Seasonal Dances

Gay-owned Business/Services Listing

Come on out - it’s all Gud!


Quilcene Village Store juggles local needs

Principals: Tom and Cass Brotherton, Greg andStacey Brotherton, Sage Brotherton and CathyBarsukoffHow long in business: Opened for gas inNovember 2011; food stocked since April 2012

What do you provide that’s different?“We’re trying to take the standard gas station and tweak it to make it a more locally centered grocery,” says Greg Brotherton. “Our goal is to serve the local people. Sometimes they want things from farther afi eld, and we accommodate that.”

How local are you?“The closest local farm whose products we carry is 300 yards away. It’s not the path of least resistance to get local stock. We need to meet people, see what they are producing and in a lot of cases, pick it up.”

What do people like about your store?“People like the friendly atmosphere. We are trying to harken back to the days when Mary ran the Village Store, and I think we are succeeding. She made the store a village center, and she carried whatever people wanted. Our products run the gamut, from standard gas station fare to organic grocery with local produce and fair trade handicrafts. We have Scooby Snacks dog treats, imports, bulk foods and ethanol.”

How do you want to be local?“We love being here. We’ve been here a year already, and I get stressed out going over the Hood Canal Bridge. It feels like home. We want to do everything we can to make it a vibrant community.”

– Viviann Kuehl

Greg Brotherton, along with his parents, wife and daughter, and Cathy Barsukoff keep things going in the store. Here he is caught juggling oranges between the arrays of fresh local produce and meats.

Photo by Viviann Kuehl


O� er expires 6/30/13

Don’s Breakfast

Special

Locally owned since 1962.

$499with this coupon!

SpecialSpecial

633 Water Street Appt: 360.301.5060 Store: 360.385.9294

“I’ve traveled the world, and Julie’s facial

is the best I ever had.”– Marion Kennedy,

Port Orchard

$10 Off any Facial$5 Off Any One Wax Service

*Discount applies for an equal-or-lesser-priced dinner, when paying full price for the � rst. O� er Valid Sun.-Thurs. only. Not valid on holidays. Expires 3/31/13.

PURCHASE ONE ENTRÉE

O� er Valid Sun.-Thurs. only. Not valid on holidays. Expires 3/31/13.Open Tues-Sun at 5pmLower Hadlock on the Waterfront360-385-3450 www.ajaxcafe.com

& receive a second at HALF PRICE!*

Wandering Wardrobe

Visit the ‘Garment District’ on Washington Street!

20% O� One Full-Priced Item936 & 926 Washington Street • Port Townsend

PT Pearl


Established in 1962, Don’s Pharmacy Soda Fountain has grown to be a local favorite. We serve delicious home-style meals and snacks, still grating potatoes for hash browns, slow-roasting choice beef and turkey and doing all the baking from scratch. Come try our wonderful soups, treat yourself to the best pie around, or enjoy old-fashioned bread pudding like Grandma made. For cool refreshment indulge in “Olde Time” Soda Fountain specialties such as Green River or Brown Cow or tangy Phosphate. Or bring a friend or the family and take on the biggest Banana Split you’ve ever seen!

Welcome to good food and a piece of Port Townsend history in a friendly atmosphere.

julie hoffmanesthetician • ownerInt’l cert • 20 years

www.faceofgraceskincare.com

Award-winning skin-care products: Eminence Organic, Jan Marini, Jane Iredale Make-up & more!

Complimentary consultations.

Mon-Fri 11- 5

Sat 10:30 - 5

• Retail Shop• European facials• Microdermabrasion• Dermaplaning• Oxygen treatments• Manual lymphatic drainage

You will be hard pressed to � nd long-time locals that don’t have a story to tell about the Ajax Café. The Ajax has been a locally

operated café for over 34 years with a long colorful history. It is o� the beaten path but once found, its out of the ordinary character make it hard to forget. The customers, former owners, performers and employees of the Ajax have contributed to the Ajax’s evolution and continue to put it in its own unique class. The Ajax uses as many products as possible including locally grown produce, cheese, � sh and many wines.

operated café for over 34 years with a long colorful history. It is o� the

Local Favoritefor 34 Years and Counting.

Wandering Wardrobe

• vintage boutique• whimsical wear• beautiful things

• 14 years of delight

360.379.4691

PT Pearl• sustainable clothing & gifts• fair trade/US made• a stone’s throw from the Haller Fountain

360.385.1018

936 & 926 Washington Street • Port Townsend

Visit the ‘Garment District’ on Washington Street!


Enanimals jewelryhas a story, history

Name of business: Enanimals, owned byMichele RaneyHow long in business: 30 years

What is unique about your products?“Because of my subject matter – wildlife, marine life, fl ora, Celtic designs and more – I can offer handmade jewelry to a large audience of both men and women,” says owner Michele Raney. “I take inspiration from my life experiences and the places I have visited throughout my travels and my upbringing.”

How do you encourage people to shop local?“By participating in the community both as a business owner and a volunteer it’s only natural that opportunities to shop locally, and to get involved locally, come up in conversation.”

What do you wish people knew about you?“I take the opportunity to educate people about my process every chance I get. It’s one thing to see my jewelry as a fi nished product, but there is a story, a history behind the process that is key to appreciating each piece.”

What do you shop for locally?“Personally I shop locally for groceries; I’ll often purchase fruits and vegetables from the farm stand near my home in Port Hadlock. I also love to shop the local thrift stores for clothing. For my jewelry I get some parts from the local bead shop. I purchase my enamels from a Seattle-based business but I do take advantage of local business for printing and purchase a lot of my offi ce and art supplies locally. I like knowing that what I spend here goes towards supporting others who live here.”

Ever have an “ah-ha moment” about shopping locally?“I’ll often barter and trade locally for products and services that I need, which is really at the root of local economics.”

– Megan Clafl in

Enanimals owner Michele Raney engraves an original design in graphite with traditional tools, then makes a steel-block die of the design with an electrical discharge machine. Submitted photo

has a story, history

“Because of my subject matter – wildlife, marine life, fl ora, Celtic designs and more – I can offer handmade jewelry


Robert Farr holds an antique camelback mantel clock that started his adventure into clock repair, which he does from his home in Port Ludlow. Photo by Allison Arthur

Father Time keeps past presentBusiness: Father Time fi xes clocks of all kinds, specializing in antique clocks.Owners: Robert Farr and Martha McMahon,Port Ludlow

How did the business start? “I inherited a clock from my grandmother and Ialways remembered it chiming,” says Farr, whorecalls he had the clock fi xed to the tune of $500.“While I was driving home, it hit me that I had repaired airplane engines. So when I got it home I took it apart and put it together. It’s still running. It became my evening job while I was working at Horizon Airlines.”

Are there really that many clocks to fi x?“In Port Ludlow and Port Townsend, there is an amazing number of clocks. I’ve repaired clocks from the 1700s. There’s one from 1741 that started its life in Europe. It’s been passed through generations, and every 30 years they’ve had it serviced by some clockmaker. My name is on that clock now, too.”

How far will you go to pick up an old clock?“We go from Silverdale to Port Townsend and all the way out to Port Angeles. We do an average of 150 to 200 clocks a year.”

What’s been the most interesting clock? “For myself, probably the most interesting clock was an 1800s cuckoo clock that I restored myself. It spent 30 years in a barn. It was basically junk, but I’ve restored it and got the birds working. Our cat likes to watch.”

What have you learned about locals from your business?“There’s a lot of good U.S. history here. I was totally amazed. There’s a lot of interesting people here, and they all have these fascinating stories.”

— Allison Arthur


627 & 631 Water Street, Port Townsend

360-385-1156Open at 10 am – see our website at www.ElevatedIceCream.com

or call for seasonal closing times

10%OFF

“Rainy Day”Ice Cream Coupon

10% O� your Ice Cream purchase on any rainy day(even slightly rainy!) With this coupon. Exp. 4/30/13.

• 2 Acres - from protected annuals to large trees• Our prices & quality will make it worth the trip!• 2 Acres - from protected annuals to large trees

Open 7 Days a WeekMon-Fri: 9-6 • Sat & Sun: 9-5

321 Four Corners Rd., PT360-379-0807

• 2 Acres - from protected annuals to large trees15% O� Plant Purchases

Exp. 3/31/13

Save $3 on anyUptown Nutrition

Brand Supplements

1002 Lawrence St. • 360-385-3290 • www.uptownnutrition.com

$3OFF

No valid with any other o� er!Expires 3/31/13

1044 WATER STREET • MON-SAT: 9-8 & SUN: 10-6 • 360-379-9711 • www.sporttownsend.com

hikingbackpackingcampingtravelingswimming

20%OFF

ANY ONEITEM

Excludes sale items.

O� er expires 12/31/12Your Original Outdoor Connection








10%OFF

“Rainy Day”Ice Cream Coupon

10% O� your Ice Cream purchase on any rainy day(even slightly rainy!) With this coupon. Exp. 4/30/13.

Special Discount! For shopping early in our Candy Shop10% O� your Early Christmas Purchase

Nov. 14-Dec. 13, 2012

10% O� your Early Easter Purchase March 6-21, 2013 (Wed.-Thurs.)

GARDENS AT FOUR CORNERS • Gary and Patti created the Gardens at Four Corners 17 years ago, and their love for this area and the community only grows. They’ve learned that this is “dream country” for gardening if the challenges of soil, water (and deer!) are � rst conquered; so it’s their goal to

educate for success with helpful and knowledgeable sta� and carry quality, reasonably priced soils, mulches and healthy plants (includ-ing larger trees). People say they buy their plants here “because they live!” So, why travel out of the county when you can enjoy all of this on 2 1⁄2 acres, browsing the wonderful gardens at “Four Corners?!”

Locally owned since 1995.Exp. 3/31/13

Vitamins • Herbs • Homeopathics • Skin Care • Gifts1002 Lawrence St. • 360-385-3290 • www.uptownnutrition.com

Your Source for Healthy Living:Education • Lending Library • Reference Library

OPEN 7 DAYS A WEEKAll Your Outdoor Needs

Get a 20%-OFF SHOPPING SPREEonce during your birthday month.

Sign up for our email list

SPORT TOWNSEND

Name _________________________________________

Email _________________________________________Locally owned since 1990


Being localmeans helping

locals.

1-800-464-4140 Port Townsend360-385-3711

Sequim360-683-4970

www.homersmith.com

Homer Smith Insurance

“Homer Smith Insurance will match the first $10 you donate

to OlyCAP in 2012.”(Limited to the 1st 200 donors.)

Feel a little

coming on?

MEAN BEAN COFFEE COMPANY1300 W. Sims Way • QFC Parking Lot

$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$

Calm down with OFF your next cup of co� ee.


Homer Smith Insurance has offered great service and rapid response since 1950. The firm was launched by Homer Smith Jr. and is today led by Homer Smith III.

We believe in community!Online quotes: www.homersmith.com

Celebrating 60 years!AUTO ❘ HOME ❘ LIFE ❘ BUSINESS

MARINE ❘ HEALTH

From left: Anne Morrison, Joan Sommantico, Homer Smith III, Jim Maupin, Rebecca Beebe, Ryan Smith and May Smith.

MEAN BEAN COFFEE COMPANY1300 W. Sims Way • QFC Parking Lot

$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$$$

$$

The best damn coffee ever!

Voted BEST COFFEE in Jeff erson County

5 years in a row and counting!


In Brinnon, McKay Shrimp and Crab Gear has been a vital part of sport fi shery since the 1970s. Production manager Tony Wihley and owner Fay Beck pose by the custom sign made by a friend. Photo by Viviann Kuehl

McKay captures craband shrimp

Business: McKay Shrimp and Crab Gear, ownedby Fay Beck; production manager, Tony WihleyHow long in business? Current owner, eightyears; business established around 1972

How do you encourage people to shop with you?“A lot of our business comes through word of mouth, through recommendations,” says Beck. “It’s our quality that encourages people. We are right here on Hood Canal, and we do business over the Internet, put ads in specialty newspapers, and in the Fish & Wildlife regulations booklet.”“Some people get 10 to 15 years’ use out of their pots, some come every year for new pots, and some throw them overboard with nothing attached. We can’t help that, but it might be good for business.”

What do people like about your products?“The pots are lightweight, made out of quality wire and materials. They’re all handmade here, and we have three good designs,” notes Beck. “We sell most of the products you need for shellfi shing: ropes, weights, pulleys, electric and gas pullers, fl oats, and bait, in pellets and fi sh oil.”

What do you provide that’s different?“There are not too many places that make the pots and sell them retail. Commercial pots are so big and heavy, and they are sold wholesale. Ours are light and they fi sh really well. Our customers come from as far away as Bellingham to Oregon, and we supply to some California stores.”

What do you shop for locally?“Gas and groceries. I wish it was different, but there’s not much I can get locally for my business. I get some things from Henery’s Hardware in Quilcene, but that’s only about $1,000 a year.”

— Viviann Kuehl

24 • 2012 Local Port Townsend & Jefferson County Leader24 • 2012 Local Port Townsend & Je� erson County Leader Port Townsend & Je� erson County Leader 2012 Local • 25

PERSONALDETAILEDCOMPLETE

WEDDINGS BY DESIGN

Wedding Planningand

Coordination Services

full-service&planningcoordination

Karle CoppenrathMember of the Association of Certi� ed

Professional Wedding Consultants

• Weddings By Design o� ers professional services, expert advice, and is the best resource for individuals wanting to create a memorable celebration that re ects their personal style and distinct tastes.

• � e initial complimentary consultation gives us an opportunity to discuss how you envision your wedding, address epectations regarding our services, and provide insight on local services available.

• Services include:

• Complete Wedding Package

• Wedding Day Management Package

• � e best part is that YOU decide how much (or how little) service you need.

P.O. Box 408, Port Townsend, WA 98368Phone: 360.385.6416

www.porttownsendweddings.com

Port Townsend & Jefferson County Leader 2012 Local • 2524 • 2012 Local Port Townsend & Je� erson County Leader Port Townsend & Je� erson County Leader 2012 Local • 25

PERSONALDETAILEDCOMPLETE

WEDDINGS BY DESIGN

Wedding Planningand

Coordination Services

full-service&planningcoordination

Karle CoppenrathMember of the Association of Certi� ed

Professional Wedding Consultants

• Weddings By Design o� ers professional services, expert advice, and is the best resource for individuals wanting to create a memorable celebration that re ects their personal style and distinct tastes.

• � e initial complimentary consultation gives us an opportunity to discuss how you envision your wedding, address epectations regarding our services, and provide insight on local services available.

• Services include:

• Complete Wedding Package

• Wedding Day Management Package

• � e best part is that YOU decide how much (or how little) service you need.

P.O. Box 408, Port Townsend, WA 98368Phone: 360.385.6416

www.porttownsendweddings.com


Hans and Mia Frederickson have purchased Frederickson Electric, a family enterprise started by his father. Lola, 5, and Rowan, 8, joined their parents at the business in Glen Cove. Photo by Allison Arthur

Next generation takes helm at Frederickson Electric

Business: Frederickson Electric,owned by Hans and Mia Frederickson

How did you get started? “We bought [the business] in January 2012 from Erik Frederickson, who had been in business 33 years in Port Townsend,” says Mia Frederickson, referring to husband Hans, son of the founder.

What does “shopping” locally mean to your business? “For me, doing business locally is how we strengthen our community,” says Hans. “We care for our customers, and they care for us. We have stronger connections when we see the people we do business with around the community.”

Do you hire locally? “Including myself, we have eight full-time and three part-time employees. We all live in Jefferson County. Many of us were born and raised here.”

What service do you provide that you think people don’t know about?“In addition to our core electrical contracting business, we’ve been doing a lot of work around energy-effi cient lighting and solar electric systems over the past few years.”

Do you shop locally as well? “Yes! I’ve always hated driving to Silverdale to get stuff that isn’t available here. I remember when the Food Co-op was in that little space Uptown with a very limited selection. I love going there now and seeing all of the food produced by local farmers. I’m also looking forward to the opening of Quimper Mercantile.”

Are you ever surprised by what you fi nd here?“The ‘City of Dreams’ is an appropriate name for Port Townsend. I’m always excited and hopeful when I see a new and creative business starting up. I’ve seen several like that this year.”

— Allison Arthur

Next generation takes helm at Frederickson Electric

“We bought [the business] in January 2012 from Erik


Present this coupon and add

ONE FREE PHOTOto your print classifi ed ad!

Leader Classifi eds226 Adams Street, Port Townsend360-385-2900 • classifi [email protected]

Single insertion. Offer expires 10/31/13.Limit one per customer.

Two room minimum. • Not combined with any other offer.

$30* Carpet Cleaning

Serving Jefferson County Free Phone Estimates

360 385-7755www.NaturalistCarpetCleaning.com

Free Air Duct Video Inspectionand/or 10% Off Air Duct Cleaning

*$30 per room (200 sq. ft. max)

SEAMS TO LASTSpecializing in

hand-crafted clothing10% Off

Purchaseof non-sale items, with this ad

1034 Water StreetPort Townsend360-385-5899

Established in 1985

Whimsical, Sweet, Elegant or FormalWhimsical, Sweet, Elegant or Formal

10% Off Any One Item(Excluding consignment items)

Mon-Fri: 10-5, Sat: 10-41031 Lawrence St., Port Townsend, WA • 360 385-5289


Present this coupon and get

15% OFFa celebration display ad!

Person-to-person, single insertion, minimum 4 column inches. Offer expires 10/31/13. Limit one per customer.

Wish someone a happy birthday, anniversary or congratulations with an announcement in The Leader!

Naturalist Carpet Cleaning is a family-owned and operated carpet, upholstery, and air duct cleaning business. We take pride in our customer service and outstanding cleaning. We were established in

2002 and serve all of Clallam, Jefferson, and Kitsap Counties. Naturalist Carpet Cleaning provides a drier and healthier way of cleaning, using minimal water and all-natural cleaners. Our non-toxic, enzyme-based solutions contain a stain-remover, deodorizer, and a sanitizer. Craig and Alison are a father/daughter team joined by Ron, Area Manager and Tamie, Customer Service.

Sweet P.T.1034 Water St.

[email protected]

10% OffStorewide!

SWEET P.T.• Unique candy gifts

• Ten different fudge fl avors• Old-fashioned candy, taffy & caramels

and much, much more!

Petals Flower Shop is located in beautiful Uptown Port Townsend. Nestled in a refurbished historical 1920s gas station, Petals is a floral studio and a French-feeling home and garden shop. We craft custom floral designs in collectible containers with love.

www.ptpetals.com


Muskan Indianrestaurant & bar

Authentic Indian Cuisine

Free Vegetable Pakoras

when you purchase2 Dinner Entreés

LunchBuff et$8.99

2330 Washington St. • Port Townsend, WA (across from Aladdin Motor Inn) 360-379-9275Open 7 Days a Week www.muskanpt.com

Vegan & Vegetarian Options

Pane d’AmoreArtisan Bakery

For bread only at Port Townsend store onlyOpen 7 days a week

Buy one loaf, get the second 50% Off!

617 Tyler Street

Box of 6 Cupcakes

$5 OffRestrictions apply • expires 5/31/13

Perfect Dreams CupcakesCUPCAKES FOR ALL OCCASIONS

909 Water Street • 360-385-2332

Buy 1 Sandwich

get 2nd 1/2 Off*11 Years

BestSandwich

Award

929 Water St.,Port Townsend360.385.2037

50%OFF*

* of equal or lesser value

Homemade Soups

& Desserts, Too!

CHIC

AGO

STY

LE S

UBS

• BEE

R • W

INE

COFFEE • SALADS • SOUPS • DECK DINING

Call Us for Catering!929 Water St.,Port Townsend


Muskan Indianrestaurant & bar

Thank you for supporting Port Townsend’s only authentic

Indian Restaurant!We are pleased to present delicacies from the Punjab region of northwestern India. Indian food, like Indian culture, is both diverse and distinctive. Every corner of India offers a vast range of culinary delights and has been influenced by many different cultures. Indian food is comprised of six basic tastes: sweet, sour, salty, spicy, bitter and astringent. A well balanced Indian meal contains many of these flavors. This principle explains the use of numerous spice combinations and depth of flavor. Thank you for supporting us in our second year!

Deepika and Manoj Kumar

Pane d’AmoreWe built a bakery because we love good bread, hard work, and our community. Feeding people the very best product we can make, using the very best ingredients we can find, never gets old or uninteresting. We continually strive for a better product, a kinder approach to using our resources and keeping our tra-

dition of sharing a priority.

www.panedamore.com

Perfect Dreams CupcakesCUPCAKES FOR ALL OCCASIONS

909 Water Street • 360-385-2332

Free local Sunrise Coffee & Free Seasonal Cupcake Samples

Cupcake Happy Hour last 1/2 hr. of every day!

Open Mon-Sat: 10-4


A taste of localwine, history

Name of business: Ajax CaféHow long in business: Ajax Café has been in operating since 1977. Kristan McCary took ownership in 2004.

How do you encourage people to shop locally?“Supporting locals is our value system,” McCary says. “We purchase as many of our menu items locally as possible and make a point to educate our customers on the abundance and truly amazing quality of ingredients grown and raised here in Jefferson County.”

What do you provide that’s special?“Ajax is a piece of the area’s history, having been in the same Port Hadlock location for more than 30 years. The restaurant was founded by a group of gentlemen so that their band, and the community, would have a place to gather and play music. We keep this tradition alive with live performances by local artists every weekend.”

What do you like about The Local coupons?“In the summertime we see a lot of new faces, and in the winter it’s our regulars, but everyone enjoys a good deal.”

What do you want people to know about your business that you don’t think they know?“We put on a special wine dinner each month with the night’s menu highlighting a local food producer,” McCary says. “We also have events where a portion of the evening proceeds are donated to a local nonprofi t, or nights where customers are encouraged to bring in donations for the food bank.”

What do you shop for locally?“What don’t we shop for locally? Produce, cheese, beef and seafood whenever possible – you name it.”

– Megan Clafl in

Kristan McCary and her son Grady at the Ajax Café. Submitted photo

A taste of localwine, history

Ajax Café has been in operating

Submitted photo


Spinning, expanding alocal business

How long have you been in business?Kevin Hansen built the fi rst electric miniSpinnerprototype, “Mark 1,” for his wife and businesspartner, Beth, in 2003. Originally based in Glen Cove,the Hansens recently opened a new manufacturing space in the Port Townsend Business Park.

How do you encourage people to shop locally?“All of our retail business is based online, as we sell our spinners worldwide, but we regularly host spinners’ workshops, which bring people from all over the U.S. and Canada to Port Townsend. We put these folks up at the Bishop Hotel and give each of them a goody bag that includes items from several local businesses. We also regularly collaborate with other local businesses like Taylored Fibers and Diva Yarns through the WSU Jefferson County Extension Fiber Farm Tour.”

What do you provide that’s special?“Great for spinners who travel, the one-of-a-kind miniSpinner is as powerful, yet as quiet, as a conventional treadle-drive wheel. With an improved speed controller, the newest design of the miniSpinner is prettier and more sophisticated.”

What do you want people to know about your business that you don’t think they know?“We started as a cottage industry right about the time of the recession. Despite a challenged economy, we were able to identify a niche and our company blossomed and grew.”

What do you shop for locally?“We are fortunate to work with the great staff at Edensaw Woods, where we purchase traditional cherry and maple woods as well as more exotic varieties like bloodwood and lacewood.”

– Megan Clafl in

Beth and Kevin Hansen take a break at their new 5,000-square-foot facility in the Port Townsend Business Park. Photo by Megan Clafl in

partner, Beth, in 2003. Originally based in Glen Cove,the Hansens recently opened a new manufacturing space in the


Website DesignChoose from a variety of template options to create an online presence for your business. Just provide us with the content, and we can take care of the rest!

Print Subscriptionto the Leader(52 weeks in-county)

Je� erson County’s only home-owned newspaper –also a digital marketing company.

Subscription to the Leader E-editionA digital replica of the Leader, available anywhere online, every Wednesday at 5:00 a.m.

$5OFF

OFF

$10

OFF

$20

O� er expires 10/31/13226 Adams St. • Port Townsend

360-385-2900

Reg. $149/page; $129/page with coupon.Does not include domain and hosting fees.

Social MediaPro� le SetupEngage in the online conversation! We will tailor a pro� le that best represents your business on a social media platform, including personalized page layout and features, images relevant to your business, and descriptions and captions tailored for social media.

Facebook Page: Reg. $129; $99 with couponGoogle Place Page: Reg. $99; $79 with coupon

Twitter pro le: Reg. $49; $39 with coupon

OFF

MORETHAN

20%


360-385-2900


360-385-2900


360-385-2900


The Leader – Locally operated since 1889, the Leader is devoted to telling Jefferson County’s story every week. No relic, the Leader also builds websites, does social media marketing, e-newsletters and other marketing graphic materials.

The a

ll-lo

cal L

eade

r cre

w, fr

om le

ft: D

onna

Ros

mai

er, S

cott

Wils

on, C

hris

Hawl

ey, S

teve

Pete

rs, M

aria

n Roh

, Jen

nife

r Jam

es-W

ilson

, Nan

cy Fi

tch, F

red O

bee,

Trist

an H

iegle

r, Lyn

n No

wak,

Sar

a Ra

dka,

Car

la P

atto

n, R

obin

Dud

ley, M

egan

Cla

� in,

Dre

w Eli

cker

, Cat

herin

e Br

ewer

, Sun

ny P

arso

ns, J

ohn

Stan

ger,

Susa

n Ja

ckso

n, Ta

mi H

ewitt

, Pat

rick

Sulli

van,

M

eliss

a Bixb

y. No

t pict

ured

: Alli

son A

rthur

, Kat

hy B

usic,

Felic

e Tho

mps

on, F

reez

e Luo

lla, C

hrist

ophe

r Ove

rman

, Eliz

abet

h Lai

ng, B

etty

Gre

well.

Phot

o by J

im M

aupin

Be Local. READ LOCAL.

Call or email!(360) 385-2900

[email protected]


$2OFF*

Pet TownMon-Sat 9-6 • Sun 10-5

2427 Sims Way (Old Dollar Store) 360-379-3262

With purchase of $20 or more

Expires 3/31/13

Winter MarketNovember 3- Dec 21

Saturdays 10-1

buy a market tote and get a $5 token to start filling it

20 years

in 2012

Tyler St, Uptown

ptfarmersmarket.org

BuyLocaL EatSEaSonaL

3 timES a wEEk at thE JEffErSon county farmErS markEtS

Saturdays Sundays WednesdaysOpens April 6th!

9-2 Tyler St. UptownOpens July 3rd!

2-6 Polk St. UptownOpens June 2nd!

10-3 Chimacum Corner

IN 2013


For all of your pet needs and

wants!Pet Town has

everything for dogs, cats, � sh

and more!

Food, Toys, Treats, Grooming Products –

We Have It All!

(DogsPaw Grooming & Dog Wash is right next door too)

Now Carrying

buy a Port Townsend Farmers Market Tote Bag and get a $5 token to start filling it. Offer good thru Dec 21, 2012!

Only good at the Marketredeem at info booth

buy a Jefferson County Farmers Market T-Shirt or Tote and get a $5 token to start filling it. Offer good only on the Opening Day of each market in 2013. See other side for exact dates.

oPEninG DayS GiVEawayS


save50%

Offer expires 3/31/13

AuthenticHomestyle

Thai CuisineBuy one meal & get the

2nd meal1/2 price

of equal or lesser value225 Adams St. • Port Townsend

360385-5023 www.khularbthai.comLocally owned since 1989.

1121 Water Street,Port Townsend360-379-4693

- p o n - p o n - p o n - p o n

- p o n - p o n - p o n - p o n

$5OFF

Any Purchase of $25 or More!

No expiration date.

The Olympic Peninsula’s “Crepe Escape”

espresso • free wi� • gluten & dairy free crepes available

“Crepe Escape”“Crepe Escape”

espresso • free wi� • gluten & dairy free crepes available

CrepesBREAKFAST • SWEET • SAVORY

* O� er expires 3/31/13

360-385-1151• www.waterstreetcreperie.com Open 7 Days a Week • 1046 Water Street • We deliver to downtown locations!

360-385-1151• www.waterstreetcreperie.com

$10 DEAL!1/2 size Crepe, & Cup of Soup(no substitutions)


save50%

50% O� Soup with purchase of $5 Lunch Special*(360) 379-9979

227 Adams St. next to Khu Larb Thai

Expires March 31,

2013.

Locally owned since 2008.* 11 am-2 pm only. Closed Tuesday.

Thank you for the support that has created our store. Nearly 900 shareholders have invested over $575,000 in the community corporation to date. This generous vote of confidence has allowed the Quimper Team to take action on the business plan presented in our Prospectus. Our fall 2012 opening is a testament to hard, persistent work inspired by our neighbors’ deep support and happy expectations.

Brandon Ellard & Jim Larson opened the Water St. Creperie in March 2010, in downtown Port Townsend, optimistic about Water

Street’s future. A crêpe is a type of very thin, cooked pancake usually made from wheat � our. Creperies are popping up as a fast

food alternative in other parts of the country.

A LOCAL FAVORITE!“We wanted a creperie because it was unique

to Port Townsend. Come enjoy our comfortable atmosphere and seating, our monthly art

exhibits and free Wi-Fi!”Become a fan on Facebook!


Townsend Bay Soapsuds up service

Business: Townsend Bay Soap Companyowned by Carol and Bob Middelburg andPatricia GraingerHow long in business? 13 years

How do you encourage people to shop with you? “I think the best way we encourage people to shop locally is our customer service. Carol in particular stays in constant contact with the retailers that are here in Port Townsend and makes sure they always have the inventory they want ... and I think customer service is a particularly strong part of the business,” says Grainger.

What do people like about your products? “I think they like that they’re made locally; they like that they say Port Townsend. I hear all the time from people who bring out of town guests to places that carry our products to shop...They get sent all over the country as a way to say thank you or happy birthday,” says Carol Middelburg.

What do you provide that’s different?“We’ve expanded our line within the last fi ve years to include refi lls, liquid soap refi lls,” says Middelburg. “We’ve worked hard to get to zero waste,” agrees Grainger. Townsend Bay Soap Company also donates waste cuts of soap as single-use bars to Dove House, the American Legion, the Port Townsend Food Bank and other charities.

What do you shop for locally? “I buy sandalwood powder for sandalwood soap and I buy it from a woman here. Mountain Spirit Herb Co. is the name of her company. Every chance we get, we buy locally. I buy my peppermint leaves locally. I buy as many essential oils from the Pacifi c Northwest as possible – which is actually quite a few,” says Middelburg.

— Tristan Hiegler

Townsend Bay Soap Company partners Bob Middelburg (left), Patricia Grainger and Carol Middelburg display some of their products. Behind them are racks containing drying soap bars that are waiting to be packaged. Photo by Tristan Hiegler


The Plaid Pepperdoes Facebook

Owners: Debbie and Larry Williams Business: The Plaid Pepper

How long have you been in business?“Three years, started in new location Sept. 15, 2012.”

How do you encourage people to shop with you?“I’m on Facebook a lot and there’s a couple of sites; ‘I’ve Heard of Quilcene’ is one of them on Facebook. So a lot of people go there just to advertise what they have. And we have a knitting group that comes in here every Thursday, which we started at the old place. Then we have a book club that meets once a month.”

What do you provide that’s different?“I make bags, mesh bags. I’ve sold a lot of these, at Christmastime especially. I make spice mats ... you put a hot dish on it that brings the fragrance out.”(Debbie and Larry also run a hot dog cart outside the shop on weekends and added a mobile espresso bar after moving to the new location.)

What do you shop for locally?“Princess Valiant Coffee out of Port Angeles, with a special roast only for The Plaid Pepper called Dabob Bay Roast. A Kingston metal artist, whose work decorates the shop. Lopez Larry’s Gourmet products, out of Lopez Island. Benchmark Woods custom wood pieces out of Chimacum. Keith Lazelle calendars, a Quilcene nature photographer. Members of the knitting group also submit pieces to sell, such as baby clothes and hats.”

Ever had an “ah-ha moment” shopping locally?“The metal workings around the shop, by TecWeld in Kingston, fi t in well with the shop’s celebration of marine life and Quilcene aquaculture.”

– Tristan Hiegler

Debbie and Larry Williams display some of the art pieces and coffee brews available at The Plaid Pepper’s new location at 294963, Highway 101, across from the Quilcene Community Center.

Photo by Tristan Hiegler


10%OFF

Four Sisters122 Harrison St. • Port Townsend • 360-531-1788 • foursistersgbs.com

From painted furniture to garden items, rusty and shiny, new and used.

Tuesday thru Saturday 11:00 am – 5:30 pmAdjacent to the ferry – near Don’s Pharmacy

We also enjoy repurposing itemsin order to breathe new life into them.

One regularlypriced item!

1010 Water Street • Port TownsendOpen 7 Days a Week • 360/385-7673 • Open 7 Days a Week

Buy 1, Get 2nd Wine(s)/Item(s)mix or match of equal or lesser value

25% O� *The “small-town” wine shopwith the “big city” selection!

www.PTWineSeller.com

Wine Not Mix A Case – Even Better Deals! (Special orders, too!) Some restrictions apply. See Store.

Cash & Checks preferred. 3% less discount for Credit Cards.Leonetti & & other rare wines & older vintages

*With this couponthru 10/31/13

Bob Carter, as local as you can get.

I’ve lived here my whole life. I’ve been doing business in

Jefferson County for 34 years.

Bob Carter, Broker (360) 385-9550

2409 Jefferson Street, Suite C Free Portfolio Analysis

LuLu’s B&B for DogsCozy resort for small dogs, the next best thing to home! No cages or kennels, just soft comfy beds, green gardens, fun walks and good food. References furnished.

Also: House calls for any size pets or livestock!

www.lulusfordogs.com • 360 379-5248 or 301-5151 *See back. Exp. 10/31/13

20%off*


We are actually four sisters doing this business. We all love going to antique shops, thrift shops, garage and estate sales. We are always on the lookout for a good sale. All four of us also love to decorate our homes. Because we are continually shopping and buying things, our home decor is constantly changing and as a result, things are always moving in and out of our homes. We

thought it was time to share our great finds with you. You will find a variety of items in our inventory, from painted furniture to garden items, rusty and shiny, new and used. We also enjoy repurposing items in order to breathe new life into them.

Four Sisters122 Harrison Street, Port Townsend • 360-531-1788 • foursistersgbs.com

LuLu’s B&B for DogsCozy resort for small dogs, the next best thing to home! No cages or kennels, just soft comfy beds, green gardens, fun walks and good food. References furnished.

*Dogs must be under 25 pounds, non-aggressive, and up to date

on innoculations.

www.lulusfordogs.com360 379-5248 or 301-5151

Large Inventory of Estate Jewelry Free Cleaning & Inspection

Jewelry Repair Ring repair & sizing Custom orders

Chain repair Stone setting Watch repair Watch batteries Watch repair

Buyer of gold & silverOpen Daily 10-5, Closed Tuesday

Come and see me at 1017A Water St.,Below Fins • Port Townsend

360-385-0167 • 360-302-0427

Buy 1, Get 2nd Wine(s)/Item(s)mix or match of equal or lesser value

25% O� * Owner Joe Euro has a “big city” selection of wines, champagne, port and beer at competitive prices! The Wine Seller will generally meet, often beat or

come darn close to prices at Costco, Central Market and the supermarkets. (WINEAUX GREGARIOUS members always $AVE BIG!!)You can stop in and custom order by the bottle, case or carload. He has operated his shop in downtown Port Townsend for over 30 years. Browsers welcome!For your wedding or private and corporate parties, Joe Euro is a professional guitarist/recording artist who has played at hundreds of events over the years and would love to play at yours. WINE NOT have Joe provide wine, champagne, beer and live music? Regular wine tastings October trough June.www.PTwineSeller.com Independent/Locally owned since 1982.


1/2 O� Entrée!*

* Buy one, get second one of equal or lesser value for 1/2 price. Valid Mon-Thurs.

Expires 3/31/13.

Open @ 11:30am Daily1038 Water St., Port Townsend360-385-9708

Coolant Check –1 hr. service call & 1 gal. glycol

$75 Solar Hot Water

Kenny Schordine360-301-9870

360.385.3809www.frameworksNW.com118 Taylor Street, Downtown P.T.

G a l l e r y o f L o c a l A r t w o r k

www.frameworksNW.com 118 Taylor Street, Downtown Port Townsend

www.frameworksNW.comwww.frameworksNW.comwww.frameworksNW.com

Limit one coupon per customer. Does not apply to previously placed orders.

C U S T O M F R A M I N G15%

OFF

R e a d y - M a d e F r a m e s

O v e r s i z e P r i n t i n g & M o u n t i n g

360.385.3809

15%OFF

Your NextClothingPurchase

(sale items exempt)

Open 7 Days a Week, 10am to 5:30pm913 Water Street • Port Townsend

Casual,unique

clothingfor women of all ages.


Over four years ago the six of us bought the Public House Grill. We are happy to be a part of the Port Townsend community and support local farmers and seafood companies whenever possible. We have come to enjoy our “regulars” and meeting the new people in town.

Thanks for supporting our restaurant!The Davis and Conrads families


Let the sun pre-heat your waterSunlight, the Earth’s most abundant energy source, can be harnessed to pre-heat water for domestic or commercial uses. Flat-plate or evacuated tube collectors capture heat that is transferred to a storage tank. That heated water then goes to your conventional water heater. You use less energy; 60% less, at least. All for about a dollar-a-watt, installed. A fifty-gallon water heater uses about 5,000 kilowatt/hours per year to serve two people. A $6,000 investment can give those two people an $1,800 Income Tax credit, and the majority of their hot water for the next 20-plus years. A little help from the sun can reduce energy bills for you, and carbon dioxide emissions for all of us.

Kenny Schordine • Solar Hot Water • 360-301-9870

Frameworks is a fun & efficient framing studio known for exceptional custom framing and delightful customer service. Frameworks also offers a wonderful selection of fine art prints, posters, photography and unique ready-made frames! This locally owned favorite has been a part of the Port Townsend arts community for 18 years. Megan was born & raised in Port Townsend (no kidding!) and enjoys helping her customers combine style, color, and artwork with the perfect frame. Come see the gallery at 118 Taylor Street, between About Time and The Surf. Locally owned since 1991.

Megan Foley Proprietor

Maricee Fashions I have run Maricee Fashions with the same faithful employee, Jean Schoessler, for 30 years. We prefer buying American-made or Canadian brand clothing, finding the fit and the quality far superior. The shop is

currently carrying many brands made in the USA and Canada. Local support enables us to be active in community activities & service clubs that give back to the community. Come on in. Our personal service will get you into an outfit that will make you look and feel your best. – Sue Arthur


Jean Schoessler and owner Sue Arthur.


20%OFFEntire

Purchase!*

Largest Supply of Locally, Regionally and American-made

Products in Port TownsendWe carry the best toys, treats, food,

beds, leashes and accessories.* Excludes pet food. Expires 10/26/13

Bonita’s Four-Legged Friends360-379-0436

1433 W. Sims WayMon-Sat 9:30-12 & 1:00-5:30 pm

50%OFF

Buy one dinner and 2 beverages at regular price getSECOND DINNER of equal or less value

1/2 Price!OPEN FOR LUNCH & DINNER • 7 DAYS A WEEKAll major credit cards accepted • Nonsmoking establishment O�

er e

xpire

s 4/3

0/20

13

360-379-9343 • 628 Water Street, Port Townsend

EXPIRES 10/24/13

Welcome Package

Think • Buy • Be LOCAL

Welcome Package



Craig Dotson has over 20 years experience in the pet service industry, and is pleased to be able to carry on Bonita’s exceptional reputation for great customer service.

Free BirthdaySerenade & Dessert!

With your meal.Call us for parties.

Margueritas • Mexican Beer • SodasEL SARAPE • 628 WATER STREET, PORT TOWNSEND

Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free Birthday Free Birthday Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free Birthday Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free Birthday Free Birthday

EL SARAPE • 628 WATER STREET, PORT TOWNSEND





Welcome Package



SQUAREdeal

10953 Rhody Drive 385-2070 www.circleandsquare.com

CIRCLEof quality

Home of the 3-year, 30,000 mile

W A R R A N T Y

• We o� er 4-Wheel Alignment, Suspension & Undercar Service and Repair.

• FREE Car Wash and Vacuum with most services• FREE AAA 40-Point Inspection with every visit• Ask about our Loaner Car Program & Shuttle Service

Front row: Zach Stratton, Jana Filli, Reto Filli, and Natalie Rutter. Back row: Drew Shimer, Trevor Ellis, Jaik Martin, Ken McMullen, and Mark Davis.

Our technicians are ASE-certi� ed Master Technicians. We practice Environmental Responsibilityand we treat your car as if it were our own.

#1 Top Shop


Please give from the HeartThe Day of Caring on Sept. 14 marked the beginning of the

2012-2013 UGN Campaign to raise $300,000. Over 70 volunteers participated in community service benefitting local non profits.

We are Stronger Together

Donate online at weareugn.org or call 360-385-3797 to find out how you can

help your community.

United Good NeighborsOF JEFFERSON COUNTY

Member of United Ways of Washington

Sponsors: Amy Mook & SOS Printing

benefitting local non profits.

Port Ludlow Associate employees prepare soil at a Habitat for Humanity house at Eddy Street in Port Townsend.

Mike and Judy Blair Campaign Chairs; Debbie

Reandeau UGN Board President; John Cantlon,

recipient of Day of Caring Award, and Port Townsend

Mayor David King.

Bill James, Port Townsend Rotary, making repairs

to OlyCap Haines Street Cottage.

local coupon book 2012

Documents

local bank

rd bargains

drdr bargains

c bargains

ab bargains

bo bargains

ob bargains

ea bargains