proteins and amino acids
DESCRIPTION
Proteins and Amino Acids. Biological Functions of Proteins. Facilitate biochemical reactions Structural support Storage and Transport Immune protection Generate movement Transmission of nerve impulses Control growth and differentiation. Key Properties of Proteins. - PowerPoint PPT PresentationTRANSCRIPT
![Page 1: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/1.jpg)
Proteins and Amino Acids
1
![Page 2: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/2.jpg)
Biological Functions of Proteins• Facilitate biochemical reactions• Structural support• Storage and Transport• Immune protection• Generate movement• Transmission of nerve impulses• Control growth and differentiation
2
![Page 3: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/3.jpg)
Key Properties of Proteins
• Linear polymers of amino acids• Contains a wide range of functional groups• Forms complex assemblies of more than
one polypeptide chain• Versatile structure – some are rigid while
others are flexible
3
![Page 4: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/4.jpg)
Globular and Fibrous Proteins• Globular protein• Usually water soluble,
compact, roughly spherical
• Hydrophobic interior, hydrophilic surface
• Globular proteins include enzymes,carrier and regulatory proteins
• Fibrous protein• Provide mechanical support• Often assembled into large
cables or threads• α-Keratins: major components
of hair and nails• Collagen: major component of
tendons, skin, bones and teeth
4
![Page 5: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/5.jpg)
General Structure of Proteins• Twenty common a-amino acids have
carboxyl and amino groups bonded to the α-carbon atom• A hydrogen atom and a side chain (R) are
also attached to the α-carbon atom
5
![Page 6: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/6.jpg)
6
![Page 7: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/7.jpg)
Zwitterions • Under normal cellular conditions amino
acids are zwitterions (dipolar ions):Amino group = -NH3+
Carboxyl group = -COO-
7
![Page 8: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/8.jpg)
Stereochemistry of amino acids• 19 of the 20 common amino acids have a
chiral a-carbon atom (Gly does not)
• Threonine and isoleucine have 2 chiral carbons each (4 possible stereoisomers each)
• Mirror image pairs of amino acids are designated L (levo) and D (dextro)
• Proteins are assembled from L-amino acids (a few D-amino acids occur in nature)
8
![Page 9: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/9.jpg)
Amino acid side chains
• Nine non-polar aa• Six polar uncharged aa• Five charged aa• Three basic aa• Two acidic aa• Two aa with sulfur groups• Four ring-forming aa• Three have aromatic rings 9
![Page 10: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/10.jpg)
Hydropathy• Relative hydrophobicity of the
amino acid
• The larger the hydropathy, the greater the tendency of an amino acid to prefer a hydrophobic environment
• Hydropathy affects protein folding: hydrophobic side chains tend to be in the interiorhydrophilic residues tend to be on the surface
10
![Page 11: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/11.jpg)
Acid-base chemistry of amino acids
11
![Page 12: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/12.jpg)
Isoelectric point
12
• pH at which the amino acid bears zero net charge
![Page 13: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/13.jpg)
Titration curve of Histidine
13
![Page 14: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/14.jpg)
Polymer of amino acid• Peptide bond -
linkage between amino acids is a secondary amide bond
• Formed by condensation of the α-carboxyl of one amino acid with the α-amino of another amino acid (loss of H2O molecule)
14
![Page 15: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/15.jpg)
Resonance Structure of the peptide bond
15
![Page 16: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/16.jpg)
Trans and Cis configuration of peptide bond• Usually in the trans configuration
16
![Page 17: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/17.jpg)
Dihedral Angle
17
![Page 18: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/18.jpg)
Dihedral angle of proteins
• The phi angle is the angle around the -N-Cα- bond• The psi angle is the angle around the -Cα-C- bond• The omega angle is the angle around the -C1-N- bond (i.e. the
peptide bond)18
![Page 19: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/19.jpg)
LEVELS OF PROTEIN STRUCTURE 19
![Page 20: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/20.jpg)
Primary structure
20
>2CQG:A|PDBID|CHAIN|SEQUENCEGSSGSSGVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDSGPSSG
![Page 21: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/21.jpg)
Secondary Structure
21
![Page 22: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/22.jpg)
Alpha-helix
22
![Page 23: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/23.jpg)
Right-handed and Left-handed α-Helix
23
![Page 24: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/24.jpg)
Right-handed and Left-handed α-Helix
24
![Page 25: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/25.jpg)
Beta-sheet
25
![Page 26: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/26.jpg)
Determining 2o structure: Ramanchandran Plot
26
![Page 27: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/27.jpg)
Supersecondary structure: Motifs• Secondary
structures often group together to form a specific geometric arrangements known as motifs
• Since motifs contain more than one secondary structural element, these are referred to as super secondary structures 27
![Page 28: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/28.jpg)
Domains• stable, independently folding, compact
structural units within a protein, formed by segments of the polypeptide chain, with relative independent structure and function distinguishable from other regions and stabilized through the same kind of linkages than the tertiary level
• Often each domain has a separate function to perform for the protein, such as:• Bind a small ligand• Spanning the plasma membrane
(transmembrane proteins)• Contain the catalytic site (enzymes)• DNA-binding (in transcription factors)• Providing a surface to bind specifically to
another protein• In some (but not all) cases, each domain in a
protein is encoded by a separate exon in the gene encoding that protein.
28
![Page 29: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/29.jpg)
Tertiary Structure
• Forces holding the tertiary (and higher order) structure together• Salt bridge• Covalent bond
(disulfide bridges)• Hydrophobic
interaction• Hydrogen bonding 29
![Page 30: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/30.jpg)
Quaternary Structure
30
![Page 31: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/31.jpg)
31
![Page 32: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/32.jpg)
Protein Folding
32
![Page 33: Proteins and Amino Acids](https://reader036.vdocuments.net/reader036/viewer/2022081507/56815e70550346895dccf26f/html5/thumbnails/33.jpg)
33