ryu documentation - read the docs...about openflow, ryu supports fully 1.0, 1.2, 1.3, 1.4, 1.5 and...
TRANSCRIPT
ryu DocumentationRelease 412
ryu development team
Mar 30 2017
Contents
1 Getting Started 311 Whatrsquos Ryu 312 Quick Start 313 Optional Requirements 314 Support 4
2 Writing Your Ryu Application 521 The First Application 522 Components of Ryu 723 Ryu application API 924 Library 1125 OpenFlow protocol API Reference 1726 Nicira Extension Structures 2327 Ryu API Reference 23
3 Configuration 2531 Setup TLS Connection 2532 Topology Viewer 26
4 Tests 2941 Testing VRRP Module 2942 Testing OF-config support with LINC 33
5 Snort Intergration 3751 Overview 3752 Installation Snort 3853 Configure Snort 3854 Usage 38
6 Built-in Ryu applications 4161 ryuappofctl 4162 ryuappofctl_rest 4263 ryuapprest_vtep 92
7 Indices and tables 93
Python Module Index 95
i
ii
ryu Documentation Release 412
Contents
Contents 1
ryu Documentation Release 412
2 Contents
CHAPTER 1
Getting Started
Whatrsquos Ryu
Ryu is a component-based software defined networking framework
Ryu provides software components with well defined API that make it easy for developers to create new network man-agement and control applications Ryu supports various protocols for managing network devices such as OpenFlowNetconf OF-config etc About OpenFlow Ryu supports fully 10 12 13 14 15 and Nicira Extensions
All of the code is freely available under the Apache 20 license Ryu is fully written in Python
Quick Start
Installing Ryu is quite easy
pip install ryu
If you prefer to install Ryu from the source code
git clone gitgithubcomosrgryugit cd ryu pip install
If you want to write your Ryu application have a look at Writing ryu application document After writing yourapplication just type
ryu-manager yourapppy
Optional Requirements
Some functionalities of ryu requires extra packages
3
ryu Documentation Release 412
bull OF-Config requires lxml and ncclient
bull NETCONF requires paramiko
bull BGP speaker (SSH console) requires paramiko
bull Zebra protocol service (database) requires SQLAlchemy
If you want to use the functionalities please install requirements
pip install -r toolsoptional-requires
Please refer to toolsoptional-requires for details
Support
Ryu Official site is httposrggithubioryu
If you have any questions suggestions and patches the mailing list is available at ryu-devel ML The ML archive atGmane is also available
4 Chapter 1 Getting Started
CHAPTER 2
Writing Your Ryu Application
The First Application
Whetting Your Appetite
If you want to manage the network gears (switches routers etc) at your way you need to write your Ryu applicationYour application tells Ryu how you want to manage the gears Then Ryu configures the gears by using OpenFlowprotocol etc
Writing Ryu application is easy Itrsquos just Python scripts
Start Writing
We show a Ryu application that make OpenFlow switches work as a dumb layer 2 switch
Open a text editor creating a new file with the following content
from ryubase import app_manager
class L2Switch(app_managerRyuApp)def __init__(self args kwargs)
super(L2Switch self)__init__(args kwargs)
Ryu application is just a Python script so you can save the file with any name extensions and any place you wantLetrsquos name the file lsquol2pyrsquo at your home directory
This application does nothing useful yet however itrsquos a complete Ryu application In fact you can run this Ryuapplication
ryu-manager ~l2pyloading app Usersfujital2pyinstantiating app Usersfujital2py
5
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
Contents
1 Getting Started 311 Whatrsquos Ryu 312 Quick Start 313 Optional Requirements 314 Support 4
2 Writing Your Ryu Application 521 The First Application 522 Components of Ryu 723 Ryu application API 924 Library 1125 OpenFlow protocol API Reference 1726 Nicira Extension Structures 2327 Ryu API Reference 23
3 Configuration 2531 Setup TLS Connection 2532 Topology Viewer 26
4 Tests 2941 Testing VRRP Module 2942 Testing OF-config support with LINC 33
5 Snort Intergration 3751 Overview 3752 Installation Snort 3853 Configure Snort 3854 Usage 38
6 Built-in Ryu applications 4161 ryuappofctl 4162 ryuappofctl_rest 4263 ryuapprest_vtep 92
7 Indices and tables 93
Python Module Index 95
i
ii
ryu Documentation Release 412
Contents
Contents 1
ryu Documentation Release 412
2 Contents
CHAPTER 1
Getting Started
Whatrsquos Ryu
Ryu is a component-based software defined networking framework
Ryu provides software components with well defined API that make it easy for developers to create new network man-agement and control applications Ryu supports various protocols for managing network devices such as OpenFlowNetconf OF-config etc About OpenFlow Ryu supports fully 10 12 13 14 15 and Nicira Extensions
All of the code is freely available under the Apache 20 license Ryu is fully written in Python
Quick Start
Installing Ryu is quite easy
pip install ryu
If you prefer to install Ryu from the source code
git clone gitgithubcomosrgryugit cd ryu pip install
If you want to write your Ryu application have a look at Writing ryu application document After writing yourapplication just type
ryu-manager yourapppy
Optional Requirements
Some functionalities of ryu requires extra packages
3
ryu Documentation Release 412
bull OF-Config requires lxml and ncclient
bull NETCONF requires paramiko
bull BGP speaker (SSH console) requires paramiko
bull Zebra protocol service (database) requires SQLAlchemy
If you want to use the functionalities please install requirements
pip install -r toolsoptional-requires
Please refer to toolsoptional-requires for details
Support
Ryu Official site is httposrggithubioryu
If you have any questions suggestions and patches the mailing list is available at ryu-devel ML The ML archive atGmane is also available
4 Chapter 1 Getting Started
CHAPTER 2
Writing Your Ryu Application
The First Application
Whetting Your Appetite
If you want to manage the network gears (switches routers etc) at your way you need to write your Ryu applicationYour application tells Ryu how you want to manage the gears Then Ryu configures the gears by using OpenFlowprotocol etc
Writing Ryu application is easy Itrsquos just Python scripts
Start Writing
We show a Ryu application that make OpenFlow switches work as a dumb layer 2 switch
Open a text editor creating a new file with the following content
from ryubase import app_manager
class L2Switch(app_managerRyuApp)def __init__(self args kwargs)
super(L2Switch self)__init__(args kwargs)
Ryu application is just a Python script so you can save the file with any name extensions and any place you wantLetrsquos name the file lsquol2pyrsquo at your home directory
This application does nothing useful yet however itrsquos a complete Ryu application In fact you can run this Ryuapplication
ryu-manager ~l2pyloading app Usersfujital2pyinstantiating app Usersfujital2py
5
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ii
ryu Documentation Release 412
Contents
Contents 1
ryu Documentation Release 412
2 Contents
CHAPTER 1
Getting Started
Whatrsquos Ryu
Ryu is a component-based software defined networking framework
Ryu provides software components with well defined API that make it easy for developers to create new network man-agement and control applications Ryu supports various protocols for managing network devices such as OpenFlowNetconf OF-config etc About OpenFlow Ryu supports fully 10 12 13 14 15 and Nicira Extensions
All of the code is freely available under the Apache 20 license Ryu is fully written in Python
Quick Start
Installing Ryu is quite easy
pip install ryu
If you prefer to install Ryu from the source code
git clone gitgithubcomosrgryugit cd ryu pip install
If you want to write your Ryu application have a look at Writing ryu application document After writing yourapplication just type
ryu-manager yourapppy
Optional Requirements
Some functionalities of ryu requires extra packages
3
ryu Documentation Release 412
bull OF-Config requires lxml and ncclient
bull NETCONF requires paramiko
bull BGP speaker (SSH console) requires paramiko
bull Zebra protocol service (database) requires SQLAlchemy
If you want to use the functionalities please install requirements
pip install -r toolsoptional-requires
Please refer to toolsoptional-requires for details
Support
Ryu Official site is httposrggithubioryu
If you have any questions suggestions and patches the mailing list is available at ryu-devel ML The ML archive atGmane is also available
4 Chapter 1 Getting Started
CHAPTER 2
Writing Your Ryu Application
The First Application
Whetting Your Appetite
If you want to manage the network gears (switches routers etc) at your way you need to write your Ryu applicationYour application tells Ryu how you want to manage the gears Then Ryu configures the gears by using OpenFlowprotocol etc
Writing Ryu application is easy Itrsquos just Python scripts
Start Writing
We show a Ryu application that make OpenFlow switches work as a dumb layer 2 switch
Open a text editor creating a new file with the following content
from ryubase import app_manager
class L2Switch(app_managerRyuApp)def __init__(self args kwargs)
super(L2Switch self)__init__(args kwargs)
Ryu application is just a Python script so you can save the file with any name extensions and any place you wantLetrsquos name the file lsquol2pyrsquo at your home directory
This application does nothing useful yet however itrsquos a complete Ryu application In fact you can run this Ryuapplication
ryu-manager ~l2pyloading app Usersfujital2pyinstantiating app Usersfujital2py
5
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
Contents
Contents 1
ryu Documentation Release 412
2 Contents
CHAPTER 1
Getting Started
Whatrsquos Ryu
Ryu is a component-based software defined networking framework
Ryu provides software components with well defined API that make it easy for developers to create new network man-agement and control applications Ryu supports various protocols for managing network devices such as OpenFlowNetconf OF-config etc About OpenFlow Ryu supports fully 10 12 13 14 15 and Nicira Extensions
All of the code is freely available under the Apache 20 license Ryu is fully written in Python
Quick Start
Installing Ryu is quite easy
pip install ryu
If you prefer to install Ryu from the source code
git clone gitgithubcomosrgryugit cd ryu pip install
If you want to write your Ryu application have a look at Writing ryu application document After writing yourapplication just type
ryu-manager yourapppy
Optional Requirements
Some functionalities of ryu requires extra packages
3
ryu Documentation Release 412
bull OF-Config requires lxml and ncclient
bull NETCONF requires paramiko
bull BGP speaker (SSH console) requires paramiko
bull Zebra protocol service (database) requires SQLAlchemy
If you want to use the functionalities please install requirements
pip install -r toolsoptional-requires
Please refer to toolsoptional-requires for details
Support
Ryu Official site is httposrggithubioryu
If you have any questions suggestions and patches the mailing list is available at ryu-devel ML The ML archive atGmane is also available
4 Chapter 1 Getting Started
CHAPTER 2
Writing Your Ryu Application
The First Application
Whetting Your Appetite
If you want to manage the network gears (switches routers etc) at your way you need to write your Ryu applicationYour application tells Ryu how you want to manage the gears Then Ryu configures the gears by using OpenFlowprotocol etc
Writing Ryu application is easy Itrsquos just Python scripts
Start Writing
We show a Ryu application that make OpenFlow switches work as a dumb layer 2 switch
Open a text editor creating a new file with the following content
from ryubase import app_manager
class L2Switch(app_managerRyuApp)def __init__(self args kwargs)
super(L2Switch self)__init__(args kwargs)
Ryu application is just a Python script so you can save the file with any name extensions and any place you wantLetrsquos name the file lsquol2pyrsquo at your home directory
This application does nothing useful yet however itrsquos a complete Ryu application In fact you can run this Ryuapplication
ryu-manager ~l2pyloading app Usersfujital2pyinstantiating app Usersfujital2py
5
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
2 Contents
CHAPTER 1
Getting Started
Whatrsquos Ryu
Ryu is a component-based software defined networking framework
Ryu provides software components with well defined API that make it easy for developers to create new network man-agement and control applications Ryu supports various protocols for managing network devices such as OpenFlowNetconf OF-config etc About OpenFlow Ryu supports fully 10 12 13 14 15 and Nicira Extensions
All of the code is freely available under the Apache 20 license Ryu is fully written in Python
Quick Start
Installing Ryu is quite easy
pip install ryu
If you prefer to install Ryu from the source code
git clone gitgithubcomosrgryugit cd ryu pip install
If you want to write your Ryu application have a look at Writing ryu application document After writing yourapplication just type
ryu-manager yourapppy
Optional Requirements
Some functionalities of ryu requires extra packages
3
ryu Documentation Release 412
bull OF-Config requires lxml and ncclient
bull NETCONF requires paramiko
bull BGP speaker (SSH console) requires paramiko
bull Zebra protocol service (database) requires SQLAlchemy
If you want to use the functionalities please install requirements
pip install -r toolsoptional-requires
Please refer to toolsoptional-requires for details
Support
Ryu Official site is httposrggithubioryu
If you have any questions suggestions and patches the mailing list is available at ryu-devel ML The ML archive atGmane is also available
4 Chapter 1 Getting Started
CHAPTER 2
Writing Your Ryu Application
The First Application
Whetting Your Appetite
If you want to manage the network gears (switches routers etc) at your way you need to write your Ryu applicationYour application tells Ryu how you want to manage the gears Then Ryu configures the gears by using OpenFlowprotocol etc
Writing Ryu application is easy Itrsquos just Python scripts
Start Writing
We show a Ryu application that make OpenFlow switches work as a dumb layer 2 switch
Open a text editor creating a new file with the following content
from ryubase import app_manager
class L2Switch(app_managerRyuApp)def __init__(self args kwargs)
super(L2Switch self)__init__(args kwargs)
Ryu application is just a Python script so you can save the file with any name extensions and any place you wantLetrsquos name the file lsquol2pyrsquo at your home directory
This application does nothing useful yet however itrsquos a complete Ryu application In fact you can run this Ryuapplication
ryu-manager ~l2pyloading app Usersfujital2pyinstantiating app Usersfujital2py
5
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
CHAPTER 1
Getting Started
Whatrsquos Ryu
Ryu is a component-based software defined networking framework
Ryu provides software components with well defined API that make it easy for developers to create new network man-agement and control applications Ryu supports various protocols for managing network devices such as OpenFlowNetconf OF-config etc About OpenFlow Ryu supports fully 10 12 13 14 15 and Nicira Extensions
All of the code is freely available under the Apache 20 license Ryu is fully written in Python
Quick Start
Installing Ryu is quite easy
pip install ryu
If you prefer to install Ryu from the source code
git clone gitgithubcomosrgryugit cd ryu pip install
If you want to write your Ryu application have a look at Writing ryu application document After writing yourapplication just type
ryu-manager yourapppy
Optional Requirements
Some functionalities of ryu requires extra packages
3
ryu Documentation Release 412
bull OF-Config requires lxml and ncclient
bull NETCONF requires paramiko
bull BGP speaker (SSH console) requires paramiko
bull Zebra protocol service (database) requires SQLAlchemy
If you want to use the functionalities please install requirements
pip install -r toolsoptional-requires
Please refer to toolsoptional-requires for details
Support
Ryu Official site is httposrggithubioryu
If you have any questions suggestions and patches the mailing list is available at ryu-devel ML The ML archive atGmane is also available
4 Chapter 1 Getting Started
CHAPTER 2
Writing Your Ryu Application
The First Application
Whetting Your Appetite
If you want to manage the network gears (switches routers etc) at your way you need to write your Ryu applicationYour application tells Ryu how you want to manage the gears Then Ryu configures the gears by using OpenFlowprotocol etc
Writing Ryu application is easy Itrsquos just Python scripts
Start Writing
We show a Ryu application that make OpenFlow switches work as a dumb layer 2 switch
Open a text editor creating a new file with the following content
from ryubase import app_manager
class L2Switch(app_managerRyuApp)def __init__(self args kwargs)
super(L2Switch self)__init__(args kwargs)
Ryu application is just a Python script so you can save the file with any name extensions and any place you wantLetrsquos name the file lsquol2pyrsquo at your home directory
This application does nothing useful yet however itrsquos a complete Ryu application In fact you can run this Ryuapplication
ryu-manager ~l2pyloading app Usersfujital2pyinstantiating app Usersfujital2py
5
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
bull OF-Config requires lxml and ncclient
bull NETCONF requires paramiko
bull BGP speaker (SSH console) requires paramiko
bull Zebra protocol service (database) requires SQLAlchemy
If you want to use the functionalities please install requirements
pip install -r toolsoptional-requires
Please refer to toolsoptional-requires for details
Support
Ryu Official site is httposrggithubioryu
If you have any questions suggestions and patches the mailing list is available at ryu-devel ML The ML archive atGmane is also available
4 Chapter 1 Getting Started
CHAPTER 2
Writing Your Ryu Application
The First Application
Whetting Your Appetite
If you want to manage the network gears (switches routers etc) at your way you need to write your Ryu applicationYour application tells Ryu how you want to manage the gears Then Ryu configures the gears by using OpenFlowprotocol etc
Writing Ryu application is easy Itrsquos just Python scripts
Start Writing
We show a Ryu application that make OpenFlow switches work as a dumb layer 2 switch
Open a text editor creating a new file with the following content
from ryubase import app_manager
class L2Switch(app_managerRyuApp)def __init__(self args kwargs)
super(L2Switch self)__init__(args kwargs)
Ryu application is just a Python script so you can save the file with any name extensions and any place you wantLetrsquos name the file lsquol2pyrsquo at your home directory
This application does nothing useful yet however itrsquos a complete Ryu application In fact you can run this Ryuapplication
ryu-manager ~l2pyloading app Usersfujital2pyinstantiating app Usersfujital2py
5
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
CHAPTER 2
Writing Your Ryu Application
The First Application
Whetting Your Appetite
If you want to manage the network gears (switches routers etc) at your way you need to write your Ryu applicationYour application tells Ryu how you want to manage the gears Then Ryu configures the gears by using OpenFlowprotocol etc
Writing Ryu application is easy Itrsquos just Python scripts
Start Writing
We show a Ryu application that make OpenFlow switches work as a dumb layer 2 switch
Open a text editor creating a new file with the following content
from ryubase import app_manager
class L2Switch(app_managerRyuApp)def __init__(self args kwargs)
super(L2Switch self)__init__(args kwargs)
Ryu application is just a Python script so you can save the file with any name extensions and any place you wantLetrsquos name the file lsquol2pyrsquo at your home directory
This application does nothing useful yet however itrsquos a complete Ryu application In fact you can run this Ryuapplication
ryu-manager ~l2pyloading app Usersfujital2pyinstantiating app Usersfujital2py
5
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
All you have to do is defining needs a new subclass of RyuApp to run your Python script as a Ryu application
Next letrsquos add the functionality of sending a received packet to all the ports
from ryubase import app_managerfrom ryucontroller import ofp_eventfrom ryucontrollerhandler import MAIN_DISPATCHERfrom ryucontrollerhandler import set_ev_clsfrom ryuofproto import ofproto_v1_0
class L2Switch(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_0OFP_VERSION]
def __init__(self args kwargs)super(L2Switch self)__init__(args kwargs)
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def packet_in_handler(self ev)
msg = evmsgdp = msgdatapathofp = dpofprotoofp_parser = dpofproto_parser
actions = [ofp_parserOFPActionOutput(ofpOFPP_FLOOD)]out = ofp_parserOFPPacketOut(
datapath=dp buffer_id=msgbuffer_id in_port=msgin_portactions=actions)
dpsend_msg(out)
A new method lsquopacket_in_handlerrsquo is added to L2Switch class This is called when Ryu receives an OpenFlowpacket_in message The trick is lsquoset_ev_clsrsquo decorator This decorator tells Ryu when the decorated function shouldbe called
The first argument of the decorator indicates an event that makes function called As you expect easily every timeRyu gets a packet_in message this function is called
The second argument indicates the state of the switch Probably you want to ignore packet_in messages before thenegotiation between Ryu and the switch finishes Using lsquoMAIN_DISPATCHERrsquo as the second argument means thisfunction is called only after the negotiation completes
Next letrsquos look at the first half of the lsquopacket_in_handlerrsquo function
bull evmsg is an object that represents a packet_in data structure
bull msgdp is an object that represents a datapath (switch)
bull dpofproto and dpofproto_parser are objects that represent the OpenFlow protocol that Ryu and the switchnegotiated
Ready for the second half
bull OFPActionOutput class is used with a packet_out message to specify a switch port that you want to send thepacket out of This application need a switch to send out of all the ports so OFPP_FLOOD constant is used
bull OFPPacketOut class is used to build a packet_out message
bull If you call Datapath classrsquos send_msg method with a OpenFlow message class object Ryu builds and send theon-wire data format to the switch
Here you finished implementing your first Ryu application You are ready to run this Ryu application that doessomething useful
6 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
A dumb l2 switch is too dumb You want to implement a learning l2 switch Move to the next step You can learnfrom the existing Ryu applications at ryuapp directory and integrated tests directory
Components of Ryu
Executables
binryu-manager
The main executable
Base components
ryubaseapp_manager
OpenFlow controller
ryucontrollercontroller
ryucontrollerdpset
ryucontrollerofp_event
ryucontrollerofp_handler
OpenFlow wire protocol encoder and decoder
ryuofprotoofproto_v1_0
ryuofprotoofproto_v1_0_parser
ryuofprotoofproto_v1_2
ryuofprotoofproto_v1_2_parser
ryuofprotoofproto_v1_3
ryuofprotoofproto_v1_3_parser
ryuofprotoofproto_v1_4
ryuofprotoofproto_v1_4_parser
ryuofprotoofproto_v1_5
ryuofprotoofproto_v1_5_parser
Ryu applications
22 Components of Ryu 7
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
ryuappcbench
ryuappsimple_switch
ryutopology
Switch and link discovery module Planned to replace ryucontrollerdpset
Libraries
ryulibpacket
ryulibovs
ovsdb interaction library
ryulibof_config
OF-Config implementation
ryulibnetconf
NETCONF definitions used by ryulibof_config
ryulibxflow
An implementation of sFlow and NetFlow
Third party libraries
ryucontribovs
Open vSwitch python binding Used by ryulibovs
ryucontribosloconfig
Oslo configuration library Used for ryu-managerrsquos command-line options and configuration files
ryucontribncclient
Python library for NETCONF client Used by ryulibof_config
8 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
Ryu application API
Ryu application programming model
Threads events and event queues
Ryu applications are single-threaded entities which implement various functionalities in Ryu Events are messagesbetween them
Ryu applications send asynchronous events each other Besides that there are some Ryu-internal event sources whichare not Ryu applications One of examples of such event sources is OpenFlow controller While an event can currentlycontain arbitrary python objects itrsquos discouraged to pass complex objects (eg unpickleable objects) between Ryuapplications
Each Ryu application has a receive queue for events The queue is FIFO and preserves the order of events Each Ryuapplication has a thread for event processing The thread keep draining the receive queue by dequeueing an event andcalling the appropritate event handler for the event type Because the event handler is called in the context of the eventprocessing thread it should be careful for blocking Ie while an event handler is blocked no further events for theRyu application will be processed
There are kinds of events which are used to implement synchronous inter-application calls between Ryu applicationsWhile such requests uses the same machinary as ordinary events their replies are put on a queue dedicated to thetransaction to avoid deadlock
While threads and queues is currently implemented with eventletgreenlet a direct use of them in a Ryu application isstrongly discouraged
Contexts
Contexts are ordinary python objects shared among Ryu applications The use of contexts are discouraged for newcode
Create a Ryu application
A Ryu application is a python module which defines a subclass of ryubaseapp_managerRyuApp If two or moresuch classes are defined in a module the first one (by name order) will be picked by app_manager Ryu application issingleton only single instance of a given Ryu application is supported
Observe events
A Ryu application can register itself to listen for specific events using ryucontrollerhandlerset_ev_cls decorator
Generate events
A Ryu application can raise events by calling appropriate ryubaseapp_managerRyuApprsquos methods like send_eventor send_event_to_observers
23 Ryu application API 9
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
Event classes
An event class describes a Ryu event generated in the system By convention event class names are prefixed byldquoEventrdquo Events are generated either by the core part of Ryu or Ryu applications A Ryu application can register itsinterest for a specific type of event by providing a handler method using ryucontrollerhandlerset_ev_cls decorator
OpenFlow event classes
ryucontrollerofp_event module exports event classes which describe receptions of OpenFlow messages from con-nected switches By convention they are named as ryucontrollerofp_eventEventOFPxxxx where xxxx is the nameof the corresponding OpenFlow message For example EventOFPPacketIn for packet-in message The OpenFlowcontroller part of Ryu automatically decodes OpenFlow messages received from switches and send these events toRyu applications which expressed an interest using ryucontrollerhandlerset_ev_cls OpenFlow event classes aresubclass of the following class
See OpenFlow protocol API Reference for more info about OpenFlow messages
ryubaseapp_managerRyuApp
See Ryu API Reference
ryucontrollerhandlerset_ev_cls
ryucontrollerhandlerset_ev_cls(ev_cls dispatchers=None)A decorator for Ryu application to declare an event handler
Decorated method will become an event handler ev_cls is an event class whose instances this RyuApp wantsto receive dispatchers argument specifies one of the following negotiation phases (or a list of them) for whichevents should be generated for this handler Note that in case an event changes the phase the phase before thechange is used to check the interest
Negotiation phase DescriptionryucontrollerhandlerHANDSHAKE_DISPATCHER Sending and waiting for hello messageryucontrollerhandlerCONFIG_DISPATCHER Version negotiated and sent features-request
messageryucontrollerhandlerMAIN_DISPATCHER Switch-features message received and sent
set-config messageryucontrollerhandlerDEAD_DISPATCHER Disconnect from the peer Or disconnecting due to
some unrecoverable errors
ryucontrollercontrollerDatapath
ryucontrollereventEventBase
class ryucontrollereventEventBaseThe base of all event classes
A Ryu application can define its own event type by creating a subclass
10 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
ryucontrollereventEventRequestBase
class ryucontrollereventEventRequestBaseThe base class for synchronous request for RyuAppsend_request
ryucontrollereventEventReplyBase
class ryucontrollereventEventReplyBase(dst)The base class for synchronous request reply for RyuAppsend_reply
ryucontrollerofp_eventEventOFPStateChange
ryucontrollerofp_eventEventOFPPortStateChange
ryucontrollerdpsetEventDP
ryucontrollerdpsetEventPortAdd
ryucontrollerdpsetEventPortDelete
ryucontrollerdpsetEventPortModify
ryucontrollernetworkEventNetworkPort
ryucontrollernetworkEventNetworkDel
ryucontrollernetworkEventMacAddress
ryucontrollertunnelsEventTunnelKeyAdd
ryucontrollertunnelsEventTunnelKeyDel
ryucontrollertunnelsEventTunnelPort
Library
Ryu provides some useful library for your network applications
Packet library
Introduction
Ryu packet library helps you to parse and build various protocol packets dpkt is the popular library for the samepurpose however it is not designed to handle protocols that are interleaved vlan mpls gre etc So we implementedour own packet library
24 Library 11
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
Network Addresses
Unless otherwise specified MACIPv4IPv6 addresses are specified using human readable strings for this library Forexample lsquo08606e7f74e7rsquo lsquo192021rsquo lsquofe80a606efffe7f74e7rsquo
Parsing Packet
First letrsquos look at how we can use the library to parse the received packets in a handler for OFPPacketIn messages
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pktprotocols
print p
You can create a Packet class instance with the received raw data Then the packet library parses the data and createsprotocol class instances included the data The packet class lsquoprotocolsrsquo has the protocol class instances
If a TCP packet is received something like the following is printed
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketvlanvlan object at 0x107a5d7d0gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
If vlan is not used you see something like
ltryulibpacketethernetethernet object at 0x107a5d790gtltryulibpacketipv4ipv4 object at 0x107a5d810gtltryulibpackettcptcp object at 0x107a5d850gt
You can access to a specific protocol class instance by using the packet class iterator Letrsquos try to check VLAN id ifVLAN is used
from ryulibpacket import packet
handlerset_ev_cls(ofp_eventEventOFPPacketIn handlerMAIN_DISPATCHER)def packet_in_handler(self ev)
pkt = packetPacket(arrayarray(B evmsgdata))for p in pkt
print pprotocol_name pif pprotocol_name == vlan
print vid = pvid
You see something like
ethernet ltryulibpacketethernetethernet object at 0x107a5d790gtvlan ltryulibpacketvlanvlan object at 0x107a5d7d0gtvid = 10ipv4 ltryulibpacketipv4ipv4 object at 0x107a5d810gttcp ltryulibpackettcptcp object at 0x107a5d850gt
12 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
Building Packet
You need to create protocol class instances that you want to send add them to a packet class instance via add_protocolmethod and then call serialize method You have the raw data to send The following example is building an arppacket
from ryuofproto import etherfrom ryulibpacket import ethernet arp packet
e = ethernetethernet(dst=ffffffffffffsrc=08606e7f74e7ethertype=etherETH_TYPE_ARP)
a = arparp(hwtype=1 proto=0x0800 hlen=6 plen=4 opcode=2src_mac=08606e7f74e7 src_ip=192021dst_mac=000000000000 dst_ip=192022)
p = packetPacket()padd_protocol(e)padd_protocol(a)pserialize()print repr(pdata) the on-wire packet
Packet library API Reference
Packet class
Stream Parser class
Protocol Header classes
PCAP file library
Introduction
Ryu PCAP file library helps you to readwrite PCAP file which file format are described in The Wireshark Wiki
Reading PCAP file
For loading the packet data containing in PCAP files you can use pcaplibReader
class ryulibpcaplibReader(file_obj)PCAP file reader
Argument Descriptionfile_obj File object which reading PCAP file in binary mode
Example of usage
from ryulib import pcaplibfrom ryulibpacket import packet
frame_count = 0 iterate pcaplibReader that yields (timestamp packet_data) in the PCAP filefor ts buf in pcaplibReader(open(testpcap rb))
frame_count += 1
24 Library 13
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
pkt = packetPacket(buf)print(d f s (frame_count ts pkt))
Writing PCAP file
For dumping the packet data which your RyuApp received you can use pcaplibWriter
class ryulibpcaplibWriter(file_obj snaplen=65535 network=1)PCAP file writer
Argument Descriptionfile_obj File object which writing PCAP file in binary modesnaplen Max length of captured packets (in octets)network Data link type (eg 1 for Ethernet see tcpdumporg for details)
Example of usage
from ryulib import pcaplib
class SimpleSwitch13(app_managerRyuApp)OFP_VERSIONS = [ofproto_v1_3OFP_VERSION]
def __init__(self args kwargs)super(SimpleSwitch13 self)__init__(args kwargs)selfmac_to_port =
Create pcaplibWriter instance with a file object for the PCAP fileselfpcap_writer = pcaplibWriter(open(mypcappcap wb))
set_ev_cls(ofp_eventEventOFPPacketIn MAIN_DISPATCHER)def _packet_in_handler(self ev)
Dump the packet data into PCAP fileselfpcap_writerwrite_pkt(evmsgdata)
OF-Config support
Ryu has a library for OF-Config support
XML schema files for NETCONFIG and OFConfig
XML schema files for NETCONF and OFConfig are stolen from LINC whose licence is Apache 20 It supports onlypart of OFConfig so that its schema files are (intentionally) limited such that operation attributes are allowed only inseveral limited places Once our library is tested with other OFConfig switches the schema files should be updated toallow operation attribute in more places
14 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
References
bull NETCONF ietf
bull NETCONF ietf wiki
bull OF-Config spec
bull ncclient
bull ncclient repo
bull LINC git repo
BGP speaker library
Introduction
Ryu BGP speaker library helps you to enable your code to speak BGP protocol The library supports IPv4 IPv4MPLS-labeled VPN IPv6 MPLS-labeled VPN and L2VPN EVPN address families
Example
The following simple code creates a BGP instance with AS number 64512 and Router ID 10001 It tries to establish abgp session with a peer (its IP is 19216817732 and the AS number is 64513) The instance advertizes some prefixes
import eventlet
BGPSpeaker needs sockets patchedeventletmonkey_patch()
initialize a log handler this is not strictly necessary but useful if you get messages like No handlers could be found for logger ryulibhubimport loggingimport syslog = logginggetLogger()logaddHandler(loggingStreamHandler(sysstderr))
from ryuservicesprotocolsbgpbgpspeaker import BGPSpeaker
def dump_remote_best_path_change(event)print the best path changed eventremote_as eventprefix
eventnexthop eventis_withdraw
def detect_peer_down(remote_ip remote_as)print Peer down remote_ip remote_as
if __name__ == __main__speaker = BGPSpeaker(as_number=64512 router_id=10001
best_path_change_handler=dump_remote_best_path_changepeer_down_handler=detect_peer_down)
speakerneighbor_add(19216817732 64513) uncomment the below line if the speaker needs to talk with a bmp server speakerbmp_server_add(1921681772 11019)count = 1
24 Library 15
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-
ryu Documentation Release 412
while Trueeventletsleep(30)prefix = 1020 + str(count) + 024print add a new prefix prefixspeakerprefix_add(prefix)count += 1if count == 4
speakershutdown()break
BGP speaker library API Reference
BGPSpeaker class
MRT file library
Introduction
Ryu MRT file library helps you to readwrite MRT (Multi-Threaded Routing Toolkit) Routing Information ExportFormat [RFC6396]
Reading MRT file
For loading the routing information contained in MRT files you can use mrtlibReader
Writing MRT file
For dumping the routing information which your RyuApp generated you can use mrtlibWriter
OVSDB Manager library
Introduction
Ryu OVSDB Manager library allows your code to interact with devices speaking the OVSDB protocol This enablesyour code to perform remote management of the devices and react to topology changes on them
Example
The following logs all new OVSDB connections and allows creating a port on a bridge
import uuid
from ryubase import app_managerfrom ryuservicesprotocolsovsdb import api as ovsdbfrom ryuservicesprotocolsovsdb import event as ovsdb_event
class MyApp(app_managerRyuApp)set_ev_cls(ovsdb_eventEventNewOVSDBConnection)def handle_new_ovsdb_connection(self ev)
16 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
system_id = evsystem_idselfloggerinfo(New OVSDB connection from system id s
systemd_id)
def create_port(self systemd_id bridge_name name)new_iface_uuid = uuiduuid4()new_port_uuid = uuiduuid4()
def _create_port(tables insert)bridge = ovsdbrow_by_name(self system_id bridge_name)
iface = insert(tables[Interface] new_iface_uuid)ifacename = nameifacetype = internal
port = insert(tables[Port] new_port_uuid)portname = nameportinterfaces = [iface]
brdigeports = bridfeports + [port]
return (new_port_uuid new_iface_uuid)
req = ovsdb_eventEventModifyRequest(system_id _create_port)rep = selfsend_request(req)
if repstatus = successselfloggererror(Error creating port s on bridge s s
name bridge repstatus)return None
return replyinsert_uuid[new_port_uuid]
OpenFlow protocol API Reference
OpenFlow version independent classes and functions
Base class for OpenFlow messages
Functions
OpenFlow v10 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
25 OpenFlow protocol API Reference 17
ryu Documentation Release 412
Queue Configuration Messages
Read State Messages
Send Packet Message
Barrier Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Vendor
Port Structures
Flow Match Structure
Action Structures
OpenFlow v12 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
Read State Messages
18 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v13 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Flow Table Configuration
Modify State Messages
25 OpenFlow protocol API Reference 19
ryu Documentation Release 412
Multipart Messages
Queue Configuration Messages
Packet-Out Message
Barrier Message
Role Request Message
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Error Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
Action Structures
OpenFlow v14 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
20 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Symmetric Messages
Hello
Echo Request
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Instruction Structures
25 OpenFlow protocol API Reference 21
ryu Documentation Release 412
Action Structures
OpenFlow v15 Messages and Structures
Controller-to-Switch Messages
Handshake
Switch Configuration
Modify State Messages
Multipart Messages
Packet-Out Message
Barrier Message
Role Request Message
Bundle Messages
Set Asynchronous Configuration Message
Asynchronous Messages
Packet-In Message
Flow Removed Message
Port Status Message
Controller Role Status Message
Table Status Message
Request Forward Message
Controller Status Message
Symmetric Messages
Hello
Echo Request
22 Chapter 2 Writing Your Ryu Application
ryu Documentation Release 412
Echo Reply
Error Message
Experimenter
Port Structures
Flow Match Structure
Flow Stats Structures
Flow Instruction Structures
Action Structures
Controller Status Structure
Nicira Extension Structures
Nicira Extension Actions Structures
The followings shows the supported NXAction classes only in OpenFlow10
The followings shows the supported NXAction classes in OpenFlow10 or later
Nicira Extended Match Structures
Ryu API Reference
26 Nicira Extension Structures 23
ryu Documentation Release 412
24 Chapter 2 Writing Your Ryu Application
CHAPTER 3
Configuration
Setup TLS Connection
If you want to use secure channel to connect OpenFlow switches you need to use TLS connection This documentdescribes how to setup Ryu to connect to the Open vSwitch over TLS
Configuring a Public Key Infrastructure
If you donrsquot have a PKI the ovs-pki script included with Open vSwitch can help you This section is based on theINSTALLSSL in the Open vSwitch source code
NOTE How to install Open vSwitch isnrsquot described in this document Please refer to the Open vSwitch documents
Create a PKI by using ovs-pki script
ovs-pki init(Default directory is usrlocalvarlibopenvswitchpki)
The pki directory consists of controllerca and switchca subdirectories Each directory contains CA files
Create a controller private key and certificate
ovs-pki req+sign ctl controller
ctl-privkeypem and ctl-certpem are generated in the current directory
Create a switch private key and certificate
ovs-pki req+sign sc switch
sc-privkeypem and sc-certpem are generated in the current directory
25
ryu Documentation Release 412
Testing TLS Connection
Configuring ovs-vswitchd to use CA files using the ovs-vsctl ldquoset-sslrdquo command eg
ovs-vsctl set-ssl etcopenvswitchsc-privkeypem etcopenvswitchsc-certpem usrlocalvarlibopenvswitchpkicontrollercacacertpem
ovs-vsctl add-br br0 ovs-vsctl set-controller br0 ssl1270016633
Substitute the correct file names if they differ from the ones used above You should use absolute file names
Run Ryu with CA files
ryu-manager --ctl-privkey ctl-privkeypem --ctl-cert ctl-certpem --ca-certs usrlocalvarlibopenvswitchpkiswitchcacacertpem --verbose
You can see something like
loading app ryucontrollerofp_handlerinstantiating app ryucontrollerofp_handlerBRICK ofp_event
CONSUMES EventOFPSwitchFeaturesCONSUMES EventOFPErrorMsgCONSUMES EventOFPHelloCONSUMES EventOFPEchoRequest
connected socketltSSLSocket fileno=4 sock=1270016633 peer=12700161302gt address(127001 61302)hello ev ltryucontrollerofp_eventEventOFPHello object at 0x1047806d0gtmove onto config modeswitch features ev version 0x1 msg_type 0x6 xid 0xb0bb34e5 port OFPPhyPort(port_no=65534 hw_addr=x16xdcxa2xe2K name=br0x00x00x00x00x00x00x00x00x00x00x00x00x00 config=0 state=0 curr=0 advertised=0 supported=0 peer=0)move onto main mode
Topology Viewer
ryuappgui_topologygui_topology provides topology visualization
This depends on following ryu applications
ryuapprest_topology Get node and link dataryuappws_topology Being notified change of link updownryuappofctl_rest Get flows of datapaths
Usage
Run mininet (or join your real environment)
$ sudo mn --controller remote --topo treedepth=3
Run GUI application
26 Chapter 3 Configuration
ryu Documentation Release 412
$ PYTHONPATH= binryu run --observe-links ryuappgui_topologygui_topologypy
Access httpltip address of ryu hostgt8080 with your web browser
Screenshot
32 Topology Viewer 27
ryu Documentation Release 412
28 Chapter 3 Configuration
CHAPTER 4
Tests
Testing VRRP Module
This page describes how to test Ryu VRRP service
Running integrated tests
Some testing scripts are available
bull ryutestsintegratedtest_vrrp_linux_multipy
bull ryutestsintegratedtest_vrrp_multipy
Each files include how to run in the comment Please refer to it
Running multiple Ryu VRRP in network namespace
The following command lines set up necessary bridges and interfaces
And then run RYU-VRRP
ip netns add gateway1 ip netns add gateway2
brctl addbr vrrp-br0 brctl addbr vrrp-br1
ip link add veth0 type veth peer name veth0-br0 ip link add veth1 type veth peer name veth1-br0 ip link add veth2 type veth peer name veth2-br0 ip link add veth3 type veth peer name veth3-br1 ip link add veth4 type veth peer name veth4-br1 ip link add veth5 type veth peer name veth5-br1
29
ryu Documentation Release 412
brctl addif vrrp-br0 veth0-br0 brctl addif vrrp-br0 veth1-br0 brctl addif vrrp-br0 veth2-br0 brctl addif vrrp-br1 veth3-br1 brctl addif vrrp-br1 veth4-br1 brctl addif vrrp-br1 veth5-br1
ip link set vrrp-br0 up ip link set vrrp-br1 up
ip link set veth0 up ip link set veth0-br0 up ip link set veth1-br0 up ip link set veth2-br0 up ip link set veth3-br1 up ip link set veth4-br1 up ip link set veth5 up ip link set veth5-br1 up
ip link set veth1 netns gateway1 ip link set veth2 netns gateway2 ip link set veth3 netns gateway1 ip link set veth4 netns gateway2
ip netns exec gateway1 ip link set veth1 up ip netns exec gateway2 ip link set veth2 up ip netns exec gateway1 ip link set veth3 up ip netns exec gateway2 ip link set veth4 up
ip netns exec gateway1 ryu-vrrp veth1 10002 254 ip netns exec gateway2 ryu-vrrp veth2 10003 100
Caveats
Please make sure that all interfaces and bridges are UP Donrsquot forget interfaces in netns gateway1gateway2
^ veth5|V veth5-br1
-----------------------|Linux Brirge vrrp-br1|-----------------------
veth3-br1^ ^ veth4-br1| |
veth3V V veth4---------- ----------|netns | |netns ||gateway1| |gateway2||ryu-vrrp| |ryu-vrrp|---------- ----------veth1^ ^ veth2
| |veth1-br0V V veth2-br0
-----------------------|Linux Brirge vrrp-br0|-----------------------
30 Chapter 4 Tests
ryu Documentation Release 412
^ veth0-br0|V veth0
Herersquos the helper executable ryu-vrrp
usrbinenv python Copyright (C) 2013 Nippon Telegraph and Telephone Corporation Copyright (C) 2013 Isaku Yamahata ltyamahata at valinux co jpgt Licensed under the Apache License Version 20 (the License) you may not use this file except in compliance with the License You may obtain a copy of the License at httpwwwapacheorglicensesLICENSE-20 Unless required by applicable law or agreed to in writing software distributed under the License is distributed on an AS IS BASIS WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND either express or implied See the License for the specific language governing permissions and limitations under the License
from ryulib import hubhubpatch()
TODO Right now we have our own patched copy of ovs python bindings Once our modification is upstreamed and widely deployed use it NOTE this modifies syspath and thus affects the following imports eg osloconfigcfgimport ryucontrib
from osloconfig import cfgimport loggingimport netaddrimport sysimport time
from ryu import loglogearly_init_log(loggingDEBUG)
from ryu import flagsfrom ryu import versionfrom ryubase import app_managerfrom ryucontroller import controllerfrom ryulib import mac as lib_macfrom ryulibpacket import vrrpfrom ryuservicesprotocolsvrrp import api as vrrp_apifrom ryuservicesprotocolsvrrp import event as vrrp_event
CONF = cfgCONF
_VRID = 7
41 Testing VRRP Module 31
ryu Documentation Release 412
_IP_ADDRESS = 10001_PRIORITY = 100
class VRRPTestRouter(app_managerRyuApp)def __init__(self args kwargs)
super(VRRPTestRouter self)__init__(args kwargs)print argsselfloggerdebug(vrrp_config s args)self_ifname = args[0]self_primary_ip_address = args[1]self_priority = int(args[2])
def start(self)print starthubspawn(self_main)
def _main(self)print selfinterface = vrrp_eventVRRPInterfaceNetworkDevice(
lib_macDONTCARE self_primary_ip_address None self_ifname)selfloggerdebug(s interface)
ip_addresses = [_IP_ADDRESS]config = vrrp_eventVRRPConfig(
version=vrrpVRRP_VERSION_V3 vrid=_VRID priority=self_priorityip_addresses=ip_addresses)
selfloggerdebug(s config)
rep = vrrp_apivrrp_config(self interface config)selfloggerdebug(s rep)
def main()vrrp_config = sysargv[-3]sysargv = sysargv[-3]CONF(project=ryu version=ryu-vrrp s version)
loginit_log() always enable ofp for nowapp_lists = [ryuservicesprotocolsvrrpmanager
ryuservicesprotocolsvrrpdumperryuservicesprotocolsvrrpsample_manager]
app_mgr = app_managerAppManagerget_instance()app_mgrload_apps(app_lists)contexts = app_mgrcreate_contexts()app_mgrinstantiate_apps(contexts)vrrp_router = app_mgrinstantiate(VRRPTestRouter vrrp_config contexts)vrrp_routerstart()
while Truetimesleep(999999)
app_mgrclose()
if __name__ == __main__
32 Chapter 4 Tests
ryu Documentation Release 412
main()
Testing OF-config support with LINC
This page describes how to setup LINC and test Ryu OF-config with it
The procedure is as follows Although all the procedure is written for readerrsquos convenience please refer to LINCdocument for latest informations of LINC
httpsgithubcomFlowForwardingLINC-Switch
The test procedure
bull install Erlang environment
bull build LINC
bull configure LINC switch
bull setup for LINC
bull run LINC switch
bull run Ryu test_of_config app
For gettinginstalling Ryu itself please refer to httposrggithubioryu
Install Erlang environment
Since LINC is written in Erlang you need to install Erlang execution environment Required version is R15B+
The easiest way is to use binary package from httpswwwerlang-solutionscomdownloadsdownload-erlang-otp
The distribution may also provide Erlang package
build LINC
install necessary packages for build
install necessary build tools
On Ubuntu
apt-get install git-core bridge-utils libpcap08 libpcap-dev libcap2-bin uml-rarr˓utilities
On RedHatCentOS
yum install git sudo bridge-utils libpcap libpcap-devel libcap tunctl
Note that on RedHatCentOS 5x you need a newer version of libpcap
yum erase libpcap libpcap-devel yum install flex byacc wget httpwwwtcpdumporgreleaselibpcap-121targz tar xzf libpcap-121targz
42 Testing OF-config support with LINC 33
ryu Documentation Release 412
cd libpcap-121 configure make ampamp make install
get LINC repo and built
Clone LINC repo
git clone gitgithubcomFlowForwardingLINC-Switchgit
Then compile everything
cd LINC-Switch make
Note At the time of this writing test_of_config fails due to a bug of LINC You can try this test with LINC which isbuilt by the following methods
cd LINC-Switch make cd depsof_config git reset --hard f772af4b765984381ad024ca8e5b5b8c54362638 cd make offline
Setup LINC
edit LINC switch configuration file rellincreleases01sysconfig Here is the sample sysconfig fortest_of_configpy to run
[linc[of_configenabledcapable_switch_ports
[port1[interfacelinc-port]port2[interfacelinc-port2]port3[interfacelinc-port3]port4[interfacelinc-port4]]
capable_switch_queues[queue991[min_rate10max_rate120]queue992[min_rate10max_rate130]queue993[min_rate200max_rate300]queue994[min_rate400max_rate900]]
logical_switches[switch0
[backendlinc_us4controllers[Switch0-Default-Controller1270016633tcp]controllers_listener1270019998tcpqueues_statusenabledports[port1queues[]port2queues[991992]]]
34 Chapter 4 Tests
ryu Documentation Release 412
switch7[backendlinc_us3controllers[Switch7-Controller1270016633tcp]controllers_listenerdisabledqueues_statusenabledports[port4queues[]port3queues[993994]]]
]]enetconf
[capabilities[base10base11startup10writable-running10]
callback_modulelinc_ofconfigsshd_ip127001sshd_port1830sshd_user_passwords[linclinc]]
lager[handlers
[lager_console_backenddebuglager_file_backend
[logerrorlogerror10485760$D05logconsoleloginfo10485760$D05]]]
sasl[sasl_error_loggerfilelogsasl-errorlogerrlog_typeerrorerror_logger_mf_dirlogsaslerror_logger_mf_maxbytes10485760error_logger_mf_maxfiles5]
sync[excluded_modules[procket]]]
setup for LINC
As the above sysconfig requires some network interface create them
ip link add linc-port type veth peer name linc-port-peer ip link set linc-port up ip link add linc-port2 type veth peer name linc-port-peer2 ip link set linc-port2 up ip link add linc-port3 type veth peer name linc-port-peer3 ip link set linc-port3 up ip link add linc-port4 type veth peer name linc-port-peer4 ip link set linc-port4 up
After stopping LINC those created interfaces can be deleted
ip link delete linc-port ip link delete linc-port2 ip link delete linc-port3 ip link delete linc-port4
Starting LINC OpenFlow switch
Then run LINC
42 Testing OF-config support with LINC 35
ryu Documentation Release 412
rellincbinlinc console
Run Ryu test_of_config app
Run test_of_config app
ryu-manager --verbose ryutestsintegratedtest_of_config ryuapprest
If you donrsquot install ryu and are working in the git repo directly
PYTHONPATH= binryu-manager --verbose ryutestsintegratedtest_of_config ryurarr˓apprest
36 Chapter 4 Tests
CHAPTER 5
Snort Intergration
This document describes how to integrate Ryu with Snort
Overview
There are two options can send alert to Ryu controller The Option 1 is easier if you just want to demonstrate or testSince Snort need very large computation power for analyzing packets you can choose Option 2 to separate them
[Option 1] Ryu and Snort are on the same machine
+---------------------+| unixsock || Ryu == snort |+----eth0-----eth1----+
| |+-------+ +----------+ +-------+| HostA |---| OFSwitch |---| HostB |+-------+ +----------+ +-------+
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Unix Domain Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
[Option 2] Ryu and Snort are on the different machines
+---------------+| Snort eth0--|| Sniffer | |+-----eth1------+ |
| |+-------+ +----------+ +-----------+| HostA |---| OFSwitch |---| LAN (CP) |+-------+ +----------+ +-----------+
| |+----------+ +----------+
37
ryu Documentation Release 412
| HostB | | Ryu |+----------+ +----------+
CP Control Plane
The above depicts Ryu and Snort architecture Ryu receives Snort alert packet via Network Socket To monitorpackets between HostA and HostB installing a flow that mirrors packets to Snort
Installation Snort
Snort is an open source network intrusion prevention and detectionsystem developed by Sourcefire If you are notfamiliar with installingsetting up Snort please referto snort setup guides
httpwwwsnortorgdocuments
Configure Snort
The configuration example is below
bull Add a snort rules file into etcsnortrules named Myrulesrules
alert icmp any any -gt any any (msgPingingsid1000004)alert tcp any any -gt any 80 (msgPort 80 is accessing sid1000003)
bull Add the custom rules in etcsnortsnortconf
include $RULE_PATHMyrulesrules
Configure NIC as a promiscuous mode
$ sudo ifconfig eth1 promisc
Usage
[Option 1]
1 Modify the simple_switch_snortpy
socket_config = unixsock True True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application
$ sudo binryu-manager ryuappsimple_switch_snortpy
The incoming packets will all mirror to port 3 which should be connect to Snort network interface You can modifythe mirror port by assign a new value in the selfsnort_port = 3 of simple_switch_snortpy
3 Run Snort
38 Chapter 5 Snort Intergration
ryu Documentation Release 412
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
5 You can see the result under next section
[Option 2]
1 Modify the simple_switch_snortpy
socket_config = unixsock False True Unix Domain Socket Server [Option1] False Network Socket Server [Option2]
2 Run Ryu with sample application (On the Controller)
$ binryu-manager ryuappsimple_switch_snortpy
3 Run Snort (On the Snort machine)
$ sudo -i$ snort -i eth1 -A unsock -l tmp -c etcsnortsnortconf
4 Run pigrelaypy (On the Snort machine)
$ sudo python pigrelaypy
This program listening snort alert messages from unix domain socket and sending it to Ryu using network socket
You can clone the source code from this repo httpsgithubcomJohn-Linpigrelay
5 Send an ICMP packet from HostA (192168840) to HostB (192168850)
$ ping 192168850
6 You can see the alert message below
alertmsg Pingingicmp(code=0csum=19725data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=8)
ipv4(csum=42562dst=192168850flags=0header_length=5identification=724rarr˓offset=0option=Noneproto=1src=192168840tos=0total_length=60ttl=128rarr˓version=4)
ethernet(dst=0023545a0514ethertype=2048src=0023546c1d17)
alertmsg Pingingicmp(code=0csum=21773data=echo(data=array(B [97 98 99 100 101 102 103rarr˓104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119rarr˓97 98 99 100 101 102 103 104 105])id=1seq=78)type=0)
ipv4(csum=52095dst=192168840flags=0header_length=5identification=7575rarr˓offset=0option=Noneproto=1src=192168850tos=0total_length=60ttl=64rarr˓version=4)
54 Usage 39
ryu Documentation Release 412
40 Chapter 5 Snort Intergration
CHAPTER 6
Built-in Ryu applications
Ryu has some built-in Ryu applications Some of them are examples Others provide some functionalities to otherRyu applications
ryuappofctl
ryuappofctl provides a convenient way to use OpenFlow messages synchronously
OfctlService ryu application is automatically loaded if your Ryu application imports ofctlapi module
Example
import ryuappofctlapi
OfctlService application internally uses OpenFlow barrier messages to ensure message boundaries As OpenFlowmessages are asynchronous and some of messages does not have any replies on success barriers are necessary forcorrect error handling
api module
exceptions
exception ryuappofctlexceptionInvalidDatapath(result)Datapath is invalid
This can happen when the bridge disconnects
exception ryuappofctlexceptionOFError(result)OFPErrorMsg is received
exception ryuappofctlexceptionUnexpectedMultiReply(result)Two or more replies are received for reply_muiti=False request
41
ryu Documentation Release 412
ryuappofctl_rest
ryuappofctl_rest provides REST APIs for retrieving the switch stats and Updating the switch stats This applicationhelps you debug your application and get various statistics
This application supports OpenFlow version 10 12 13 14 and 15
Contents
bull ryuappofctl_rest
ndash Retrieve the switch stats
Get all switches
Get the desc stats
Get all flows stats
Get flows stats filtered by fields
Get aggregate flow stats
Get aggregate flow stats filtered by fields
Get table stats
Get table features
Get ports stats
Get ports description
Get queues stats
Get queues config
Get queues description
Get groups stats
Get group description stats
Get group features stats
Get meters stats
Get meter config stats
Get meter description stats
Get meter features stats
Get role
ndash Update the switch stats
Add a flow entry
Modify all matching flow entries
Modify flow entry strictly
Delete all matching flow entries
Delete flow entry strictly
42 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Delete all flow entries
Add a group entry
Modify a group entry
Delete a group entry
Modify the behavior of the port
Add a meter entry
Modify a meter entry
Delete a meter entry
Modify role
ndash Support for experimenter multipart
Send a experimenter message
ndash Reference Description of Match and Actions
Description of Match on request messages
Description of Actions on request messages
Retrieve the switch stats
Get all switches
Get the list of all switches which connected to the controller
Usage
Method GETURI statsswitches
Response message body
Attribute Description Exampledpid Datapath ID 1
Example of use
$ curl -X GET httplocalhost8080statsswitches
[123
]
Note The result of the REST command is formatted for easy viewing
Get the desc stats
Get the desc stats of the switch which specified with Datapath ID in URI
62 ryuappofctl_rest 43
ryu Documentation Release 412
Usage
Method GETURI statsdescltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquomfr_desc Manufacturer description ldquoNicira Incrdquohw_desc Hardware description ldquoOpen vSwitchrdquosw_desc Software description ldquo2390rdquoserial_num Serial number ldquoNonerdquodp_desc Human readable description of datapath ldquoNonerdquo
Example of use
$ curl -X GET httplocalhost8080statsdesc1
1
mfr_desc Nicira Inchw_desc Open vSwitchsw_desc 2390serial_num Nonedp_desc None
Get all flows stats
Get all flows stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsflowltdpidgt
Response message body(OpenFlow13 or earlier)
44 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0duration_sec Time flow has been alive in seconds 2dura-tion_nsec
Time flow has been alive in nanoseconds beyondduration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeout Number of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_count Number of packets in flow 0byte_count Number of bytes in flow 0match Fields to match ldquoin_portrdquo
1actions Instruction set [rdquoOUT-
PUT2rdquo]
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquolength Length of this entry 88table_id Table ID 0dura-tion_sec
Time flow has been alive in seconds 2
dura-tion_nsec
Time flow has been alive in nanosecondsbeyond duration_sec
676e+08
priority Priority of the entry 11111idle_timeout Number of seconds idle before expiration 0hard_timeoutNumber of seconds before expiration 0flags Bitmap of OFPFF_ flags 1cookie Opaque controller-issued identifier 1packet_countNumber of packets in flow 0byte_count Number of bytes in flow 0impor-tance
Eviction precedence 0
match Fields to match ldquoeth_typerdquo 2054instruc-tions
struct ofp_instruction_header [ldquotyperdquoGOTO_TABLErdquoldquotable_idrdquo1]
Example of use
$ curl -X GET httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111
62 ryuappofctl_rest 45
ryu Documentation Release 412
idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get flows stats filtered by fields
Get flows stats of the switch filtered by the OFPFlowStats fields This is POST method version of Get allflows stats
46 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage
Method POSTURI statsflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
priority Priority of the entry (int) (See Note) 11111 wild-carded
Note OpenFlow Spec does not allow to filter flow entries by priority but when with a largeamount of flow entries filtering by priority is convenient to get statistics efficiently So thisapp provides priority field for filtering
Response message body The same as Get all flows stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
httplocalhost8080statsflow1
Response (OpenFlow13 or earlier)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0
62 ryuappofctl_rest 47
ryu Documentation Release 412
match in_port 1
actions [OUTPUT2
]
]
Response (OpenFlow14 or later)
1 [
length 88table_id 0duration_sec 2duration_nsec 676e+08priority 11111idle_timeout 0hard_timeout 0flags 1cookie 1packet_count 0byte_count 0match eth_type 2054
importance 0instructions [type APPLY_ACTIONSactions [port 2max_len 0type OUTPUT
]
]
]
Get aggregate flow stats
Get aggregate flow stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsaggregateflowltdpidgt
Response message body
48 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquopacket_count Number of packets in flows 18byte_count Number of bytes in flows 756flow_count Number of flows 3
Example of use
$ curl -X GET httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get aggregate flow stats filtered by fields
Get aggregate flow stats of the switch filtered by the OFPAggregateStats fields This is POST methodversion of Get aggregate flow stats
Usage
Method POSTURI statsaggregateflowltdpidgt
Request message body
Attribute Description Example Defaulttable_id Table ID (int) 0 OF-
PTT_ALLout_port Require matching entries to include this as an
output port (int)2 OFPP_ANY
out_group Require matching entries to include this as anoutput group (int)
1 OFPG_ANY
cookie Require matching entries to contain this cookievalue (int)
1 0
cookie_maskMask used to restrict the cookie bits that mustmatch (int)
1 0
match Fields to match (dict) ldquoin_portrdquo1
wild-carded
Response message body The same as Get aggregate flow stats
Example of use
$ curl -X POST -d table_id 0out_port 2cookie 1cookie_mask 1match
in_port1
62 ryuappofctl_rest 49
ryu Documentation Release 412
httplocalhost8080statsaggregateflow1
1 [
packet_count 18byte_count 756flow_count 3
]
Get table stats
Get table stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstableltdpidgt
Response message body(OpenFlow10)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomax_entries Max number of entries supported 1e+06wildcards Bitmap of OFPFW_ wildcards that are
supported by the table[rdquoIN_PORTrdquordquoDL_VLANrdquo]
ac-tive_count
Number of active entries 0
lookup_count Number of packets looked up in table 8matched_countNumber of packets that hit table 0
Response message body(OpenFlow12)
50 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquoclassifierrdquomatch Bitmap of (1 ltlt OFPXMT_) that indicate the
fields the table can match on[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
wild-cards
Bitmap of (1 ltlt OFPXMT_) wildcards that aresupported by the table
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
write_actionsBitmap of OFPAT_ that are supported by thetable with OFPIT_WRITE_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
ap-ply_actions
Bitmap of OFPAT_ that are supported by thetable with OFPIT_APPLY_ACTIONS
[rdquoOUT-PUTrdquordquoSET_MPLS_TTLrdquo]
write_setfieldsBitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_WRITE_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
ap-ply_setfields
Bitmap of (1 ltlt OFPXMT_) header fields thatcan be set with OFPIT_APPLY_ACTIONS
[rdquoOFB_IN_PORTrdquordquoOFB_METADATArdquo]
meta-data_match
Bits of metadata table can match 18446744073709552000
meta-data_write
Bits of metadata table can write 18446744073709552000
instruc-tions
Bitmap of OFPIT_ values supported [rdquoGOTO_TABLErdquordquoWRITE_METADATArdquo]
config Bitmap of OFPTC_ values []max_entriesMax number of entries supported 1e+06ac-tive_count
Number of active entries 0
lookup_countNumber of packets looked up in table 0matched_countNumber of packets that hit table 8
Response message body(OpenFlow13)
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0active_count Number of active entries 0lookup_count Number of packets looked up in table 8matched_count Number of packets that hit table 0
Example of use
$ curl -X GET httplocalhost8080statstable1
Response (OpenFlow10)
1 [
table_id 0lookup_count 8max_entries 1e+06active_count 0name classifiermatched_count 0wildcards [IN_PORT
62 ryuappofctl_rest 51
ryu Documentation Release 412
DL_VLAN]
table_id 253lookup_count 0max_entries 1e+06active_count 0name table253matched_count 0wildcards [IN_PORTDL_VLAN]
]
Response (OpenFlow12)
1 [
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions[GOTO_TABLEWRITE_METADATA]table_id 0metadata_match 18446744073709552000lookup_count 8wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name classifiermatched_count 0apply_actions [OUTPUTSET_MPLS_TTL
52 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]active_count 0max_entries 1e+06
apply_setfields [OFB_IN_PORTOFB_METADATA]match [OFB_IN_PORTOFB_METADATA]metadata_write 18446744073709552000config []instructions [GOTO_TABLEWRITE_METADATA]table_id 253metadata_match 18446744073709552000lookup_count 0wildcards [OFB_IN_PORTOFB_METADATA]write_setfields [OFB_IN_PORTOFB_METADATA]write_actions [OUTPUTSET_MPLS_TTL]name table253matched_count 0apply_actions [OUTPUTSET_MPLS_TTL]active_count 0max_entries 1e+06
]
Response (OpenFlow13)
1 [
active_count 0table_id 0lookup_count 8matched_count 0
62 ryuappofctl_rest 53
ryu Documentation Release 412
active_count 0table_id 253lookup_count 0matched_count 0
]
Get table features
Get table features of the switch which specified with Datapath ID in URI
Usage
Method GETURI statstablefeaturesltdpidgt
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquotable_id Table ID 0name Name of Table ldquotable_0rdquometa-data_match
Bits of metadata table canmatch
18446744073709552000
meta-data_write
Bits of metadata table canwrite
18446744073709552000
config Bitmap of OFPTC_ values 0max_entries Max number of entries
supported4096
properties structofp_table_feature_prop_header
[ldquotyperdquoldquoINSTRUCTIONSrdquordquoinstruction_idsrdquo[]]
Example of use
$ curl -X GET httplocalhost8080statstablefeatures1
1 [
metadata_write 18446744073709552000config 0table_id 0metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
54 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
]
]name table_0
metadata_write 18446744073709552000config 0table_id 1metadata_match 18446744073709552000max_entries 4096properties [type INSTRUCTIONSinstruction_ids [len 4type 1
]
]name table_1
]
Get ports stats
Get ports stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsportltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
62 ryuappofctl_rest 55
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packets Number of received packets 9tx_packets Number of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_dropped Number of packets dropped by RX 0tx_dropped Number of packets dropped by TX 0rx_errors Number of receive errors 0tx_errors Number of transmit errors 0rx_frame_err Number of frame alignment errors 0rx_over_err Number of packets with RX overrun 0rx_crc_err Number of CRC errors 0collisions Number of collisions 0duration_sec Time port has been alive in seconds 12dura-tion_nsec
Time port has been alive in nanoseconds beyondduration_sec
976e+08
Response message body(OpenFlow14 or later)
At-tribute
Description Example
dpid Datapath ID ldquo1rdquoport_no Port number 1rx_packetsNumber of received packets 9tx_packetsNumber of transmitted packets 6rx_bytes Number of received bytes 738tx_bytes Number of transmitted bytes 252rx_droppedNumber of packets dropped by
RX0
tx_droppedNumber of packets dropped byTX
0
rx_errors Number of receive errors 0tx_errors Number of transmit errors 0dura-tion_sec
Time port has been alive inseconds
12
dura-tion_nsec
Time port has been alive innanoseconds beyond duration_sec
976e+08
proper-ties
structofp_port_desc_prop_header
[ldquorx_frame_errrdquo 0 ldquorx_over_errrdquo 0ldquorx_crc_errrdquo 0 ldquocollisionsrdquo 0]
Example of use
$ curl -X GET httplocalhost8080statsport1
Response (OpenFlow13 or earlier)
1 [
port_no 1rx_packets 9tx_packets 6
56 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0duration_sec 12duration_nsec 976e+08
]
Response (OpenFlow14 or later)
1 [
port_no 1rx_packets 9tx_packets 6rx_bytes 738tx_bytes 252rx_dropped 0tx_dropped 0rx_errors 0tx_errors 0duration_nsec 12duration_sec 976e+08properties [rx_frame_err 0rx_over_err 0rx_crc_err 0collisions 0type ETHERNET
bias_current 300flags 3rx_freq_lmda 1500rx_grid_span 500rx_offset 700rx_pwr 2000temperature 273tx_freq_lmda 1500tx_grid_span 500tx_offset 700tx_pwr 2000type OPTICAL
62 ryuappofctl_rest 57
ryu Documentation Release 412
data []exp_type 0experimenter 101type EXPERIMENTER
]
]
Get ports description
Get ports description of the switch which specified with Datapath ID in URI
Usage(OpenFlow14 or earlier)
Method GETURI statsportdescltdpidgt
Usage(OpenFlow15 or later)
Method GETURI statsportdescltdpidgt[ltportgt]
Note Specification of port number is optional
Response message body(OpenFlow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0curr Current features 2112advertised Features being advertised by the port 0supported Features supported by the port 0peer Features advertised by peer 0curr_speed Current port bitrate in kbps 1e+07max_speed Max port bitrate in kbps 0
Response message body(OpenFlow14 or later)
58 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1hw_addr Ethernet hardware address ldquo0ab6d00ce1d7rdquoname Name of port ldquos1-eth1rdquoconfig Bitmap of OFPPC_ flags 0state Bitmap of OFPPS_ flags 0length Length of this entry 168properties struct ofp_port_desc_prop_header [ldquolengthrdquo 32 ldquocurrrdquo 10248]
Example of use
$ curl -X GET httplocalhost8080statsportdesc1
Response (OpenFlow13 or earlier)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0curr 2112advertised 0supported 0peer 0curr_speed 1e+07max_speed 0
]
Response (OpenFlow14 or later)
1 [
port_no 1hw_addr 0ab6d00ce1d7name s1-eth1config 0state 0length 168properties [length 32curr 10248advertised 10240supported 10248peer 10248curr_speed 5000max_speed 5000
62 ryuappofctl_rest 59
ryu Documentation Release 412
type ETHERNETlength 40rx_grid_freq_lmda 1500tx_grid_freq_lmda 1500rx_max_freq_lmda 2000tx_max_freq_lmda 2000rx_min_freq_lmda 1000tx_min_freq_lmda 1000tx_pwr_max 2000tx_pwr_min 1000supported 1type OPTICAL
data []exp_type 0experimenter 101length 12type EXPERIMENTER
]
]
Get queues stats
Get queues stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsqueueltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueue1ALL1
Response message body(OpenFlow13 or earlier)
60 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0duration_sec Time queue has been alive in seconds 4294963425dura-tion_nsec
Time queue has been alive in nanoseconds beyondduration_sec
3912967296
Response message body(OpenFlow14 or later)
Attribute Description Exampledpid Datapath ID ldquo1rdquoport_no Port number 1queue_id Queue ID 0tx_bytes Number of transmitted bytes 0tx_packets Number of transmitted packets 0tx_errors Number of packets dropped due to overrun 0dura-tion_sec
Time queue has been alive in seconds 4294963425
dura-tion_nsec
Time queue has been alive in nanosecondsbeyond duration_sec
3912967296
length Length of this entry 104properties struct ofp_queue_stats_prop_header [ldquotyperdquo 65535rdquolengthrdquo
12]
Example of use
$ curl -X GET httplocalhost8080statsqueue1
Response (OpenFlow13 or earlier)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
port_no 1queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296
]
62 ryuappofctl_rest 61
ryu Documentation Release 412
Response (OpenFlow14 or later)
1 [
port_no 1queue_id 0tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 104properties [
OFPQueueStatsPropExperimenter
type 65535length 16data [
1]exp_type 1experimenter 101
]
port_no 2queue_id 1tx_bytes 0tx_packets 0tx_errors 0duration_sec 4294963425duration_nsec 3912967296length 48properties []
]
Get queues config
Get queues config of the switch which specified with Datapath ID and Port in URI
Usage
Method GETURI statsqueueconfigltdpidgt[ltportgt]
Note Specification of port number is optional
62 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Caution This message is deprecated in Openflow14 If OpenFlow 14 or later is in useplease refer to Get queues description instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoport Port which was queried 1queues struct ofp_packet_queuendashqueue_id
ID for the specific queue 2
ndash port Port this queue is attached to 0ndashproperties
struct ofp_queue_prop_headerproperties
[ldquopropertyrdquo ldquoMIN_RATErdquordquoraterdquo80]
Example of use
$ curl -X GET httplocalhost8080statsqueueconfig11
1 [
port 1queues [properties [property MIN_RATErate 80
]port 0queue_id 1
properties [property MAX_RATErate 120
]port 2queue_id 2
properties [property EXPERIMENTERdata []experimenter 999
]port 3queue_id 3
]
62 ryuappofctl_rest 63
ryu Documentation Release 412
]
Get queues description
Get queues description of the switch which specified with Datapath ID Port and Queue_id in URI
Usage
Method GETURI statsqueuedescltdpidgt[ltportgt[ltqueue_idgt]]
Note Specification of port number and queue id are optional
If you want to omitting the port number and setting the queue id please specify the keywordldquoALLrdquo to the port number
eg GET httplocalhost8080statsqueuedesc1ALL1
Caution This message is available in OpenFlow14 or later If Openflow13 or earlier isin use please refer to Get queues config instead
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquolen Length in bytes of this queue desc 88port_no Port which was queried 1queue_id Queue ID 1properties struct ofp_queue_desc_prop_header [ldquolengthrdquo 8 ]
Example of use
$ curl -X GET httplocalhost8080statsqueuedesc111
1 [
len 88port_no 1queue_id 1properties [length 8rate 300type MIN_RATE
length 8rate 900type MAX_RATE
64 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
length 16exp_type 0experimenter 101data [1]type EXPERIMENTER
]
]
Get groups stats
Get groups stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquolength Length of this entry 56group_id Group ID 1ref_count Number of flows or groups that directly forward to this
group1
packet_count Number of packets processed by group 0byte_count Number of bytes processed by group 0duration_sec Time group has been alive in seconds 161duration_nsec Time group has been alive in nanoseconds beyond
duration_sec303e+08
bucket_stats struct ofp_bucket_counterndashpacket_count
Number of packets processed by bucket 0
ndash byte_count Number of bytes processed by bucket 0
Example of use
$ curl -X GET httplocalhost8080statsgroup1
1 [
length 56group_id 1
62 ryuappofctl_rest 65
ryu Documentation Release 412
ref_count 1packet_count 0byte_count 0duration_sec 161duration_nsec 303e+08bucket_stats [packet_count 0byte_count 0
]
]
Get group description stats
Get group description stats of the switch which specified with Datapath ID in URI
Usage(Openflow14 or earlier)
Method GETURI statsgroupdescltdpidgt
Usage(Openflow15 or later)
Method GETURI statsgroupdescltdpidgt[ltgroup_idgt]
Note Specification of group id is optional
Response message body(Openflow13 or earlier)
Attribute Description Exampledpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1buckets struct ofp_bucketndash weight Relative weight of bucket (Only defined for select groups) 0ndashwatch_port
Port whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live (Onlyrequired for fast failover groups)
4294967295
ndash actions 0 or more actions associated with the bucket [rdquoOUT-PUT1rdquo]
Response message body(Openflow14 or later)
66 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotype One of OFPGT_ ldquoALLrdquogroup_id Group ID 1length Length of this entry 40buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined for selectgroups)
0
ndashwatch_port
Port whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndashwatch_group
Group whose state affects whether this bucket is live(Only required for fast failover groups)
4294967295
ndash len Length the bucket in bytes including this header andany adding to make it 64-bit aligned
32
ndashactions
0 or more actions associated with the bucket [ldquoOUTPUT1rdquoldquomax_lenrdquo 65535]
Example of use
$ curl -X GET httplocalhost8080statsgroupdesc1
Response (Openflow13 or earlier)
1 [
type ALLgroup_id 1buckets [weight 0watch_port 4294967295watch_group 4294967295actions [OUTPUT1
]
]
]
Response (Openflow14 or later)
1 [
type ALLgroup_id 1length 40buckets [weight 1watch_port 1watch_group 1len 32
62 ryuappofctl_rest 67
ryu Documentation Release 412
actions [
type OUTPUTmax_len 65535port 2
]
]
]
Get group features stats
Get group features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsgroupfeaturesltdpidgt
Response message body
At-tribute
Description Example
dpid Datapath ID ldquo1rdquotypes Bitmap of (1 ltlt OFPGT_)
values supported[]
capabil-ities
Bitmap of OFPGFC_capability supported
[rdquoSE-LECT_WEIGHTrdquordquoSELECT_LIVENESSrdquordquoCHAININGrdquo]
max_groupsMaximum number of groupsfor each type
[ldquoALLrdquo 4294967040]
actions Bitmaps of (1 ltlt OFPAT_)values supported
[ldquoALLrdquo [rdquoOUTPUTrdquo]]
Example of use
$ curl -X GET httplocalhost8080statsgroupfeatures1
1 [
types []capabilities [SELECT_WEIGHTSELECT_LIVENESSCHAINING
]max_groups [ALL 4294967040
SELECT 4294967040
68 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
INDIRECT 4294967040FF 4294967040
]actions [ALL [OUTPUTCOPY_TTL_OUTCOPY_TTL_INSET_MPLS_TTLDEC_MPLS_TTLPUSH_VLANPOP_VLANPUSH_MPLSPOP_MPLSSET_QUEUEGROUPSET_NW_TTLDEC_NW_TTLSET_FIELD
]SELECT []
INDIRECT []
FF []
]
]
Get meters stats
Get meters stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
62 ryuappofctl_rest 69
ryu Documentation Release 412
Attribute Description Exam-ple
dpid Datapath ID ldquo1rdquometer_id Meter ID 1len Length in bytes of this stats 56flow_count Number of flows bound to meter 0packet_in_count Number of packets in input 0byte_in_count Number of bytes in input 0duration_sec Time meter has been alive in seconds 37duration_nsec Time meter has been alive in nanoseconds beyond
duration_sec988000
band_stats struct ofp_meter_band_statsndashpacket_band_count
Number of packets in band 0
ndash byte_band_count Number of bytes in band 0
Example of use
$ curl -X GET httplocalhost8080statsmeter1
1 [
meter_id 1len 56flow_count 0packet_in_count 0byte_in_count 0duration_sec 37duration_nsec 988000band_stats [packet_band_count 0byte_band_count 0
]
]
Get meter config stats
Get meter description stats
Get meter config stats of the switch which specified with Datapath ID in URI
Caution This message has been renamed in openflow 15 If Openflow 14 or earlier isin use please used as Get meter description stats If Openflow 15 or later is in use pleaseused as Get meter description stats
Usage(Openflow14 or earlier)
Method GETURI statsmeterconfigltdpidgt[ltmeter_idgt]
70 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Usage(Openflow15 or later)
Method GETURI statsmeterdescltdpidgt[ltmeter_idgt]
Note Specification of meter id is optional
Response message body
Attribute Description Exampledpid Datapath ID ldquo1rdquoflags All OFPMC_ that apply ldquoKBPSrdquometer_id Meter ID 1bands struct ofp_meter_band_headerndash type One of OFPMBT_ ldquoDROPrdquondash rate Rate for this band 1000ndash burst_size Size of bursts 0
Example of use
$ curl -X GET httplocalhost8080statsmeterconfig1
1 [
flags [KBPS
]meter_id 1bands [type DROPrate 1000burst_size 0
]
]
Get meter features stats
Get meter features stats of the switch which specified with Datapath ID in URI
Usage
Method GETURI statsmeterfeaturesltdpidgt
Response message body
62 ryuappofctl_rest 71
ryu Documentation Release 412
Attribute Description Exampledpid Datapath ID ldquo1rdquomax_meter Maximum number of meters 256band_types Bitmaps of (1 ltlt OFPMBT_) values
supported[rdquoDROPrdquo]
capabili-ties
Bitmaps of ldquoofp_meter_flagsrdquo [rdquoKBPSrdquo ldquoBURSTrdquoldquoSTATSrdquo]
max_bands Maximum bands per meters 16max_color Maximum color value 8
Example of use
$ curl -X GET httplocalhost8080statsmeterfeatures1
1 [
max_meter 256band_types [DROP
]capabilities [KBPSBURSTSTATS
]max_bands 16max_color 8
]
Get role
Get the current role of the controller from the switch
Usage
Method GETURI statsroleltdpidgt
Response message body(Openflow14 or earlier)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquogeneration_id Master Election Generation Id 0
Response message body(Openflow15 or later)
Attribute Description Exampledpid Datapath ID 1role One of OFPCR_ROLE_ ldquoEQUALrdquoshort_id ID number for the controller 0generation_id Master Election Generation Id 0
Example of use
72 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X GET httplocalhost8080statsrole1
Response (Openflow14 or earlier)
1 [
generation_id 0role EQUAL
]
Response (Openflow15 or later)
1 [
generation_id 0role EQUALshort_id 0
]
Update the switch stats
Add a flow entry
Add a flow entry to the switch
Usage
Method POSTURI statsflowentryadd
Request message body(Openflow13 or earlier)
62 ryuappofctl_rest 73
ryu Documentation Release 412
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Request message body(Openflow14 or later)
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding
(seconds) (int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedinstruc-tions
Instruction set (list of dict) [ldquotyperdquordquoMETERrdquoldquometer_idrdquo2]
[] DROP
Note For description of match and actions please see Reference Description of Match and Actions
Example of use(Openflow13 or earlier)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
74 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1actions[
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1actions[
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 44444match
in_port1actions[
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
62 ryuappofctl_rest 75
ryu Documentation Release 412
Example of use(Openflow14 or later)
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1instructions [
type APPLY_ACTIONSactions [
max_len 65535port 2type OUTPUT
]
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 22222match
in_port1instructions [
typeGOTO_TABLEtable_id 1
]
httplocalhost8080statsflowentryadd
$ curl -X POST -d dpid 1priority 33333match
in_port1instructions [
typeWRITE_METADATAmetadata 1metadata_mask 1
]
httplocalhost8080statsflowentryadd
76 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
$ curl -X POST -d dpid 1priority 44444match
in_port1instructions [
typeMETERmeter_id 1
]
httplocalhost8080statsflowentryadd
Note To confirm flow entry registration please see Get all flows stats or Get flows stats filtered by fields
Modify all matching flow entries
Modify all matching flow entries of the switch
Usage
Method POSTURI statsflowentrymodify
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1
62 ryuappofctl_rest 77
ryu Documentation Release 412
table_id 0idle_timeout 30hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify
Modify flow entry strictly
Modify flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrymodify_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
flags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
78 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrymodify_strict
Delete all matching flow entries
Delete all matching flow entries of the switch
Usage
Method POSTURI statsflowentrydelete
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
62 ryuappofctl_rest 79
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete
Delete flow entry strictly
Delete flow entry strictly matching wildcards and priority
Usage
Method POSTURI statsflowentrydelete_strict
Request message body
At-tribute
Description Example Default
dpid Datapath ID (int) 1 (Mandatory)cookie Opaque controller-issued identifier
(int)1 0
cookie_maskMask used to restrict the cookie bits(int)
1 0
table_id Table ID to put the flow in (int) 0 0idle_timeoutIdle time before discarding (seconds)
(int)30 0
hard_timeoutMax time before discarding(seconds) (int)
30 0
priority Priority level of flow entry (int) 11111 0buffer_id Buffered packet to apply to or
OFP_NO_BUFFER (int)1 OFP_NO_BUFFER
out_port Output port (int) 1 OFPP_ANYout_group Output group (int) 1 OFPG_ANYflags Bitmap of OFPFF_ flags (int) 1 0match Fields to match (dict) ldquoin_portrdquo1
wildcardedactions Instruction set (list of dict) [ldquotyperdquordquoOUTPUTrdquo
ldquoportrdquo2][] DROP
Example of use
$ curl -X POST -d dpid 1cookie 1cookie_mask 1table_id 0idle_timeout 30
80 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
hard_timeout 30priority 11111flags 1match
in_port1actions[
typeOUTPUTport 2
]
httplocalhost8080statsflowentrydelete_strict
Delete all flow entries
Delete all flow entries of the switch which specified with Datapath ID in URI
Usage
Method DELETEURI statsflowentryclearltdpidgt
Example of use
$ curl -X DELETE httplocalhost8080statsflowentryclear1
Add a group entry
Add a group entry to the switch
Usage
Method POSTURI statsgroupentryadd
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
62 ryuappofctl_rest 81
ryu Documentation Release 412
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentryadd
Note To confirm group entry registration please see Get group description stats
Modify a group entry
Modify a group entry to the switch
Usage
Method POSTURI statsgroupentrymodify
Request message body
At-tribute
Description Example De-fault
dpid Datapath ID (int) 1 (Manda-tory)
type One of OFPGT_ (string) ldquoALLrdquo ldquoALLrdquogroup_id Group ID (int) 1 0buckets struct ofp_bucketndashweight
Relative weight of bucket (Only defined forselect groups)
0 0
ndashwatch_port
Port whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPP_ANY
ndashwatch_group
Group whose state affects whether this bucket islive (Only required for fast failover groups)
4294967295 OFPG_ANY
ndashactions
0 or more actions associated with the bucket(list of dict)
[ldquotyperdquoldquoOUTPUTrdquoldquoportrdquo 1]
[]DROP
Example of use
$ curl -X POST -d dpid 1type ALLgroup_id 1buckets [
actions [
82 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
type OUTPUTport 1
]
]
httplocalhost8080statsgroupentrymodify
Delete a group entry
Delete a group entry to the switch
Usage
Method POSTURI statsgroupentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)group_id Group ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1group_id 1
httplocalhost8080statsgroupentrydelete
Modify the behavior of the port
Modify the behavior of the physical port
Usage
Method POSTURI statsportdescmodify
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)port_no Port number (int) 1 0config Bitmap of OFPPC_ flags (int) 1 0mask Bitmap of OFPPC_ flags to be changed (int) 1 0
Example of use
$ curl -X POST -d dpid 1port_no 1config 1mask 1 httplocalhost8080statsportdescmodify
62 ryuappofctl_rest 83
ryu Documentation Release 412
Note To confirm port description please see Get ports description
Add a meter entry
Add a meter entry to the switch
Usage
Method POSTURI statsmeterentryadd
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1flags KBPSmeter_id 1bands [
type DROPrate 1000
]
httplocalhost8080statsmeterentryadd
Note To confirm meter entry registration please see Get meter config stats
Modify a meter entry
Modify a meter entry to the switch
Usage
Method POSTURI statsmeterentrymodify
Request message body
84 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)flags Bitmap of OFPMF_ flags (list) [rdquoKBPSrdquo] [] Emptymeter_id Meter ID (int) 1 0bands struct ofp_meter_band_headerndash type One of OFPMBT_ (string) ldquoDROPrdquo Nonendash rate Rate for this band (int) 1000 Nonendash burst_size Size of bursts (int) 100 None
Example of use
$ curl -X POST -d dpid 1meter_id 1flags KBPSbands [
type DROPrate 1000
]
httplocalhost8080statsmeterentrymodify
Delete a meter entry
Delete a meter entry to the switch
Usage
Method POSTURI statsmeterentrydelete
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)meter_id Meter ID (int) 1 0
Example of use
$ curl -X POST -d dpid 1meter_id 1
httplocalhost8080statsmeterentrydelete
Modify role
modify the role of the switch
Usage
Method POSTURI statsrole
Request message body
62 ryuappofctl_rest 85
ryu Documentation Release 412
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)role One of OFPCR_ROLE_(string) ldquoMASTERrdquo OFPCR_ROLE_EQUAL
Example of use
$ curl -X POST -d dpid 1role MASTER
httplocalhost8080statsrole
Support for experimenter multipart
Send a experimenter message
Send a experimenter message to the switch which specified with Datapath ID in URI
Usage
Method POSTURI statsexperimenterltdpidgt
Request message body
Attribute Description Example Defaultdpid Datapath ID (int) 1 (Mandatory)experimenter Experimenter ID (int) 1 0exp_type Experimenter defined (int) 1 0data_type Data format type (ldquoasciirdquo or ldquobase64rdquo) ldquoasciirdquo ldquoasciirdquodata Data to send (string) ldquodatardquo ldquordquo Empty
Example of use
$ curl -X POST -d dpid 1experimenter 1exp_type 1data_type asciidata data httplocalhost8080statsexperimenter1
Reference Description of Match and Actions
Description of Match on request messages
List of Match fields (OpenFlow10)
86 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Matchfield
Description Example
in_port Input switch port (int) ldquoin_portrdquo 7dl_src Ethernet source address (string) ldquodl_srcrdquo ldquoaabbcc112233rdquodl_dst Ethernet destination address (string) ldquodl_dstrdquo ldquoaabbcc112233rdquodl_vlan Input VLAN id (int) ldquodl_vlanrdquo 5dl_vlan_pcp Input VLAN priority (int) ldquodl_vlan_pcprdquo 3 ldquodl_vlanrdquo 3dl_type Ethernet frame type (int) ldquodl_typerdquo 123nw_tos IP ToS (int) ldquonw_tosrdquo 16 ldquodl_typerdquo 2048nw_proto IP protocol or lower 8 bits of ARP
opcode (int)ldquonw_protordquo 5 ldquodl_typerdquo 2048
nw_src IPv4 source address (string) ldquonw_srcrdquo ldquo19216801rdquoldquodl_typerdquo 2048
nw_dst IPv4 destination address (string) ldquonw_dstrdquo ldquo1921680124rdquoldquodl_typerdquo 2048
tp_src TCPUDP source port (int) ldquotp_srcrdquo 1 ldquonw_protordquo 6ldquodl_typerdquo 2048
tp_dst TCPUDP destination port (int) ldquotp_dstrdquo 2 ldquonw_protordquo 6ldquodl_typerdquo 2048
Note IPv4 address field can be described as IP Prefix like as follows
IPv4 address
192168011921680224
List of Match fields (OpenFlow12 or later)
Match field Description Examplein_port Switch input port (int) ldquoin_portrdquo 7in_phy_port Switch physical input port (int) ldquoin_phy_portrdquo 5 ldquoin_portrdquo 3metadata Metadata passed between tables (int or string) ldquometadatardquo 12345 or ldquometadatardquo ldquo0x12120xffffrdquoeth_dst Ethernet destination address (string) ldquoeth_dstrdquo ldquoaabbcc11223300000000ffffrdquoeth_src Ethernet source address (string) ldquoeth_srcrdquo ldquoaabbcc112233rdquoeth_type Ethernet frame type (int) ldquoeth_typerdquo 2048vlan_vid VLAN id (int or string) See Example of VLAN ID match fieldvlan_pcp VLAN priority (int) ldquovlan_pcprdquo 3 ldquovlan_vidrdquo 3ip_dscp IP DSCP (6 bits in ToS field) (int) ldquoip_dscprdquo 3 ldquoeth_typerdquo 2048ip_ecn IP ECN (2 bits in ToS field) (int) ldquoip_ecnrdquo 0 ldquoeth_typerdquo 34525ip_proto IP protocol (int) ldquoip_protordquo 5 ldquoeth_typerdquo 34525ipv4_src IPv4 source address (string) ldquoipv4_srcrdquo ldquo19216801rdquo ldquoeth_typerdquo 2048ipv4_dst IPv4 destination address (string) ldquoipv4_dstrdquo ldquo19216810102552552550rdquo ldquoeth_typerdquo 2048tcp_src TCP source port (int) ldquotcp_srcrdquo 3 ldquoip_protordquo 6 ldquoeth_typerdquo 2048tcp_dst TCP destination port (int) ldquotcp_dstrdquo 5 ldquoip_protordquo 6 ldquoeth_typerdquo 2048udp_src UDP source port (int) ldquoudp_srcrdquo 2 ldquoip_protordquo 17 ldquoeth_typerdquo 2048udp_dst UDP destination port (int) ldquoudp_dstrdquo 6 ldquoip_protordquo 17 ldquoeth_typerdquo 2048sctp_src SCTP source port (int) ldquosctp_srcrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048sctp_dst SCTP destination port (int) ldquosctp_dstrdquo 99 ldquoip_protordquo 132 ldquoeth_typerdquo 2048icmpv4_type ICMP type (int) ldquoicmpv4_typerdquo 5 ldquoip_protordquo 1 ldquoeth_typerdquo 2048icmpv4_code ICMP code (int) ldquoicmpv4_coderdquo 6 ldquoip_protordquo 1 ldquoeth_typerdquo 2048arp_op ARP opcode (int) ldquoarp_oprdquo 3 ldquoeth_typerdquo 2054
Continued on next page
62 ryuappofctl_rest 87
ryu Documentation Release 412
Table 61 ndash continued from previous pageMatch field Description Examplearp_spa ARP source IPv4 address (string) ldquoarp_spardquo ldquo192168011rdquo ldquoeth_typerdquo 2054arp_tpa ARP target IPv4 address (string) ldquoarp_tpardquo ldquo19216804424rdquo ldquoeth_typerdquo 2054arp_sha ARP source hardware address (string) ldquoarp_shardquo ldquoaabbcc112233rdquo ldquoeth_typerdquo 2054arp_tha ARP target hardware address (string) ldquoarp_thardquo ldquoaabbcc11223300000000ffffrdquo ldquoeth_typerdquo 2054ipv6_src IPv6 source address (string) ldquoipv6_srcrdquo ldquo2001aaaabbbbcccc1111rdquo ldquoeth_typerdquo 34525ipv6_dst IPv6 destination address (string) ldquoipv6_dstrdquo ldquo2001ffffccccbbbb111164rdquo ldquoeth_typerdquo 34525ipv6_flabel IPv6 Flow Label (int) ldquoipv6_flabelrdquo 2 ldquoeth_typerdquo 34525icmpv6_type ICMPv6 type (int) ldquoicmpv6_typerdquo 3 ldquoip_protordquo 58 ldquoeth_typerdquo 34525icmpv6_code ICMPv6 code (int) ldquoicmpv6_coderdquo 4 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_target Target address for Neighbor Discovery (string) ldquoipv6_nd_targetrdquo ldquo2001ffffccccbbbb1111rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_sll Source link-layer for Neighbor Discovery (string) ldquoipv6_nd_sllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 135 ldquoip_protordquo 58 ldquoeth_typerdquo 34525ipv6_nd_tll Target link-layer for Neighbor Discovery (string) ldquoipv6_nd_tllrdquo ldquoaabbcc112233rdquo ldquoicmpv6_typerdquo 136 ldquoip_protordquo 58 ldquoeth_typerdquo 34525mpls_label MPLS label (int) ldquompls_labelrdquo 3 ldquoeth_typerdquo 34888mpls_tc MPLS Traffic Class (int) ldquompls_tcrdquo 2 ldquoeth_typerdquo 34888mpls_bos MPLS BoS bit (int) (Openflow13+) ldquompls_bosrdquo 1 ldquoeth_typerdquo 34888pbb_isid PBB I-SID (int or string) (Openflow13+) ldquopbb_isidrdquo 5 ldquoeth_typerdquo 35047 orldquopbb_isidrdquo ldquo0x050xffrdquo ldquoeth_typerdquo 35047tunnel_id Logical Port Metadata (int or string) (Openflow13+) ldquotunnel_idrdquo 7 or ldquotunnel_idrdquo ldquo0x070xffrdquoipv6_exthdr IPv6 Extension Header pseudo-field (int or string) (Openflow13+) ldquoipv6_exthdrrdquo 3 ldquoeth_typerdquo 34525 or ldquoipv6_exthdrrdquo ldquo0x400x1F0rdquo ldquoeth_typerdquo 34525pbb_uca PBB UCA hander field(int) (Openflow14+) ldquopbb_ucardquo 1 ldquoeth_typerdquo 35047tcp_flags TCP flags(int) (Openflow15+) ldquotcp_flagsrdquo 2 ldquoip_protordquo 6 ldquoeth_typerdquo 2048actset_output Output port from action set metadata(int) (Openflow15+) ldquoactset_outputrdquo 3packet_type Packet type value(int) (Openflow15+) ldquopacket_typerdquo [1 2048]
Note Some field can be described with mask like as follows
Ethernet address
aabbcc112233aabbcc11223300000000ffff
IPv4 address
1921680111921680442419216810102552552550
IPv6 address
2001ffffccccbbbb11112001ffffccccbbbb2222642001ffffccccbbbb2222ffffffffffffffff0
Metadata
0x12121212121212120x34343434343434340x01010101010101010
88 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Example of VLAN ID match field
The following is available in OpenFlow10 or later
bull To match only packets with VLAN tag and VLAN ID equal value 5
$ curl -X POST -d dpid 1match
dl_vlan 5actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When ldquodl_vlanrdquo field is described as decimal int value OFPVID_PRESENT(0x1000) bit is auto-matically applied
The following is available in OpenFlow12 or later
bull To match only packets without a VLAN tag
$ curl -X POST -d dpid 1match
dl_vlan 0x0000 Describe OFPVID_NONE(0x0000)actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with a VLAN tag regardless of its value
$ curl -X POST -d dpid 1match
dl_vlan 0x10000x1000 Describe OFPVID_PRESENT(0x1000rarr˓0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
bull To match only packets with VLAN tag and VLAN ID equal value 5
62 ryuappofctl_rest 89
ryu Documentation Release 412
$ curl -X POST -d dpid 1match
dl_vlan 0x1005 Describe sum of VLAN-ID(eg 5) | OFPVID_rarr˓PRESENT(0x1000)
actions[
typeOUTPUTport 1
]
httplocalhost8080statsflowentryadd
Note When using the descriptions for OpenFlow12 or later please describe ldquodl_vlanrdquo field as hexadec-imal string value and OFPVID_PRESENT(0x1000) bit is NOT automatically applied
Description of Actions on request messages
List of Actions (OpenFlow10)
Actions Description ExampleOUTPUT Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3SET_VLAN_VIDSet the 8021Q VLAN ID using
ldquovlan_vidrdquoldquotyperdquo ldquoSET_VLAN_VIDrdquoldquovlan_vidrdquo 5
SET_VLAN_PCPSet the 8021Q priority usingldquovlan_pcprdquo
ldquotyperdquo ldquoSET_VLAN_PCPrdquoldquovlan_pcprdquo 3
STRIP_VLANStrip the 8021Q header ldquotyperdquo ldquoSTRIP_VLANrdquoSET_DL_SRCSet ethernet source address using
ldquodl_srcrdquoldquotyperdquo ldquoSET_DL_SRCrdquo ldquodl_srcrdquoldquoaabbcc112233rdquo
SET_DL_DSTSet ethernet destination addressusing ldquodl_dstrdquo
ldquotyperdquo ldquoSET_DL_DSTrdquo ldquodl_dstrdquoldquoaabbcc112233rdquo
SET_NW_SRCIP source address using ldquonw_srcrdquo ldquotyperdquo ldquoSET_NW_SRCrdquoldquonw_srcrdquo ldquo10001rdquo
SET_NW_DSTIP destination address usingldquonw_dstrdquo
ldquotyperdquo ldquoSET_NW_DSTrdquoldquonw_dstrdquo ldquo10001rdquo
SET_NW_TOSSet IP ToS (DSCP field 6 bits)using ldquonw_tosrdquo
ldquotyperdquo ldquoSET_NW_TOSrdquo ldquonw_tosrdquo184
SET_TP_SRC Set TCPUDP source port usingldquotp_srcrdquo
ldquotyperdquo ldquoSET_TP_SRCrdquo ldquotp_srcrdquo8080
SET_TP_DST Set TCPUDP destination portusing ldquotp_dstrdquo
ldquotyperdquo ldquoSET_TP_DSTrdquo ldquotp_dstrdquo8080
ENQUEUE Output to queue with ldquoqueue_idrdquoattached to ldquoportrdquo
ldquotyperdquo ldquoENQUEUErdquo ldquoqueue_idrdquo3 ldquoportrdquo 1
List of Actions (OpenFlow12 or later)
90 Chapter 6 Built-in Ryu applications
ryu Documentation Release 412
Ac-tions
Description Example
OUT-PUT
Output packet from ldquoportrdquo ldquotyperdquo ldquoOUTPUTrdquo ldquoportrdquo 3
COPY_TTL_OUTCopy TTL outwards ldquotyperdquo ldquoCOPY_TTL_OUTrdquoCOPY_TTL_INCopy TTL inwards ldquotyperdquo ldquoCOPY_TTL_INrdquoSET_MPLS_TTLSet MPLS TTL using ldquompls_ttlrdquo ldquotyperdquo ldquoSET_MPLS_TTLrdquo ldquompls_ttlrdquo
64DEC_MPLS_TTLDecrement MPLS TTL ldquotyperdquo ldquoDEC_MPLS_TTLrdquoPUSH_VLANPush a new VLAN tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_VLANrdquo ldquoethertyperdquo33024
POP_VLANPop the outer VLAN tag ldquotyperdquo ldquoPOP_VLANrdquoPUSH_MPLSPush a new MPLS tag with
ldquoethertyperdquoldquotyperdquo ldquoPUSH_MPLSrdquo ldquoethertyperdquo34887
POP_MPLSPop the outer MPLS tag withldquoethertyperdquo
ldquotyperdquo ldquoPOP_MPLSrdquo ldquoethertyperdquo2054
SET_QUEUESet queue id using ldquoqueue_idrdquowhen outputting to a port
ldquotyperdquo ldquoSET_QUEUErdquo ldquoqueue_idrdquo 7
GROUP Apply group identified byldquogroup_idrdquo
ldquotyperdquo ldquoGROUPrdquo ldquogroup_idrdquo 5
SET_NW_TTLSet IP TTL using ldquonw_ttlrdquo ldquotyperdquo ldquoSET_NW_TTLrdquo ldquonw_ttlrdquo 64DEC_NW_TTLDecrement IP TTL ldquotyperdquo ldquoDEC_NW_TTLrdquoSET_FIELDSet a ldquofieldrdquo using ldquovaluerdquo (The
set of keywords available forldquofieldrdquo is the same as matchfield)
See Example of set-field action
PUSH_PBBPush a new PBB service tag withldquoethertyperdquo (Openflow13+)
ldquotyperdquo ldquoPUSH_PBBrdquo ldquoethertyperdquo35047
POP_PBB Pop the outer PBB service tag(Openflow13+)
ldquotyperdquo ldquoPOP_PBBrdquo
COPY_FIELDCopy value between header andregister (Openflow15+)
ldquotyperdquo ldquoCOPY_FIELDrdquo ldquon_bitsrdquo 32ldquosrc_offsetrdquo 1 ldquodst_offsetrdquo 2ldquosrc_oxm_idrdquo ldquoeth_srcrdquo ldquodst_oxm_idrdquoldquoeth_dstrdquo
ME-TER
Apply meter identified byldquometer_idrdquo (Openflow15+)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
EX-PERI-MENTER
Extensible action for theexperimenter (Set ldquobase64rdquo orldquoasciirdquo to ldquodata_typerdquo field)
ldquotyperdquo ldquoEXPERIMENTERrdquoldquoexperimenterrdquo 101 ldquodatardquoldquoAAECAwQFBgc=rdquo ldquodata_typerdquoldquobase64rdquo
GOTO_TABLE(Instruction) Setup the next tableidentified by ldquotable_idrdquo
ldquotyperdquo ldquoGOTO_TABLErdquo ldquotable_idrdquo 8
WRITE_METADATA(Instruction) Setup the metadatafield using ldquometadatardquo andldquometadata_maskrdquo
ldquotyperdquo ldquoWRITE_METADATArdquoldquometadatardquo 0x3 ldquometadata_maskrdquo 0x3
ME-TER
(Instruction) Apply meteridentified by ldquometer_idrdquo(deprecated in Openflow15)
ldquotyperdquo ldquoMETERrdquo ldquometer_idrdquo 3
WRITE_ACTIONS(Instruction) Write the action(s)onto the datapath action set
ldquotyperdquo ldquoWRITE_ACTIONSrdquoactionsrdquo[ldquotyperdquordquoPOP_VLANrdquoldquotyperdquordquoOUTPUTrdquo ldquoportrdquo 2]
CLEAR_ACTIONS(Instruction) Clears all actionsfrom the datapath action set
ldquotyperdquo ldquoCLEAR_ACTIONSrdquo
62 ryuappofctl_rest 91
ryu Documentation Release 412
Example of set-field action
To set VLAN ID to non-VLAN-tagged frame
$ curl -X POST -d dpid 1match
dl_type 0x8000actions[
type PUSH_VLAN Push a new VLAN tag if a input frame
rarr˓is non-VLAN-taggedethertype 33024 Ethertype 0x8100(=33024) IEEE 8021Q
rarr˓VLAN-tagged frame
type SET_FIELDfield vlan_vid Set VLAN IDvalue 4102 Describe sum of vlan_id(eg 6) |
rarr˓OFPVID_PRESENT(0x1000=4096)
type OUTPUTport 2
]
httplocalhost8080statsflowentryadd
ryuapprest_vtep
REST API
92 Chapter 6 Built-in Ryu applications
CHAPTER 7
Indices and tables
bull genindex
bull modindex
bull search
93
ryu Documentation Release 412
94 Chapter 7 Indices and tables
Python Module Index
rryuappofctlexception 41ryulibnetconf 8ryulibof_config 8ryulibovs 8ryulibxflow 8ryutopology 8
95
ryu Documentation Release 412
96 Python Module Index
Index
EEventBase (class in ryucontrollerevent) 10EventReplyBase (class in ryucontrollerevent) 11EventRequestBase (class in ryucontrollerevent) 11
IInvalidDatapath 41
OOFError 41
RReader (class in ryulibpcaplib) 13ryuappofctlexception (module) 41ryulibnetconf (module) 8ryulibof_config (module) 8ryulibovs (module) 8ryulibxflow (module) 8ryutopology (module) 8
Sset_ev_cls() (in module ryucontrollerhandler) 10
UUnexpectedMultiReply 41
WWriter (class in ryulibpcaplib) 14
97
- Getting Started
-
- Whats Ryu
- Quick Start
- Optional Requirements
- Support
-
- Writing Your Ryu Application
-
- The First Application
- Components of Ryu
- Ryu application API
- Library
- OpenFlow protocol API Reference
- Nicira Extension Structures
- Ryu API Reference
-
- Configuration
-
- Setup TLS Connection
- Topology Viewer
-
- Tests
-
- Testing VRRP Module
- Testing OF-config support with LINC
-
- Snort Intergration
-
- Overview
- Installation Snort
- Configure Snort
- Usage
-
- Built-in Ryu applications
-
- ryuappofctl
- ryuappofctl_rest
- ryuapprest_vtep
-
- Indices and tables
- Python Module Index
-