scoring matrices scoring matrices, pssms, and hmms bio520 bioinformaticsjim lund reading: ch 6.1

23
Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 Bioinformatics Jim Lund Reading: Ch 6.1

Upload: lorena-lane

Post on 12-Jan-2016

237 views

Category:

Documents


2 download

TRANSCRIPT

Page 1: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Scoring Matrices

Scoring matrices, PSSMs, and HMMs

BIO520 Bioinformatics Jim Lund

Reading: Ch 6.1

Page 2: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Alignment scoring matrix

• DNA matrix:

A C G T

A 5 -4 -4 -4

C -4 5 -4 -4

G -4 -4 5 -4

T -4 -4 -4 5

Page 3: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Alignment scoring matrix

• Protein matrix:

Page 4: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Use of a scoring matrix

P L S - - C F G

G L T - A C H L

+1+1+1-2-1+1+1+1

Score = 3

Page 5: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Consensus sequences

Different ways to describe a consensus, from crude to refined:

• Consensus site

• Sequence logos

• Position Specific Score Matrix (PSSM)

• Hidden Markov Model (HMM)

Page 6: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Consensus sequences and sequence logos

Sequence logo

Consensus sequence

GTMGFGLPAAIGAKLARPDRRVVAIDGDGSFQMTVQELST

Page 7: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Constructing (and using) a consensus sequence

1. Collect sequences2. Align sequences (consensus sites are

descriptions of the alignment)3. Condense the set of sequences into a

consensus (to a consensus, PSSM, HMM).

4. Apply the scoring matrix in alignments/searches.

Page 8: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Position Specific Score Matrix (PSSM)

• A position specific scoring matrix (PSSM) is a matrix based on the amino acid frequencies (or nucleic acid frequencies) at every position of a multiple alignment.

• From these frequencies, the PSSM that will be calculated will result in a matrix that will assign superior scores to residues that appear more often than by chance at a certain position.

Page 9: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Creating a PSSM: Example

NTEGEWI

NITRGEW

NIAGECCAmino acid frequencies at every

position of the alignment:

Page 10: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Creating a PSSM: Example• Amino acids that do not appear at a specific position of a multiple

alignment must also be considered in order to model every possible sequence and have calculable log-odds scores. A simple procedure called pseudo-counts assigns minimal scores to residues that do not appear at a certain position of the alignment according to the following equation:

• Where– Frequency is the frequency of residue i in column j (the count of

occurances).– pseudocount is a number higher or equal to 1.– N is the number of sequences in the multiple alignment.

Page 11: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

In this example, N = 3 and let’s use pseudocount = 1:

Score(N) at position 1 = 3/3 = 1.

Score(I) at position 1 = 0/3 = 0.

Readjust:

Score(I) at position 1 -> (0+1) / (3+20) = 1/23 = 0.044.

Score(N) at position 1 -> (3+1) / (3+20) = 4/23 = 0.174.

The PSSM is obtained by taking the logarithm of (the values obtained above divided by the background frequency of the residues).

To simplify for this example we’ll assume that every amino acid appears equally in protein sequences, i.e. fi = 0.05 for every i):

PSSM Score(I) at position 1 = log(0.044 / 0.05) = -0.061.

PSSM Score(N) at position 1 = log(0.174 / 0.05) = 0.541.

Creating a PSSM: Example

Page 12: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

The matrix assigns positive scores to residues that appear more often than expected by chance and negative scores to residues that appear less often than expected by chance.

Creating a PSSM: Example

Page 13: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Using a PSSM• To search for matches to a PSSM, scan along a the

sequence using a window the length (L) of the PSSM.

• The matrix is slid on a sequence one residue at a time and the scores of the residues of every region of length L are added.

• Scores that are higher than an empirically predetermined threshold are reported.

Page 14: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Advantages of PSSM

• Weights sequence according to observed diversity specific to the family of interest

• Minimal assumptions

• Easy to compute

• Can be used in comprehensive evaluations.

Page 15: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

More sophisticated PSSMs

1. PSSM with pseudocounts.2. Giving pseudocounts less weight when more

alignment data is available.3. Weight pseudocount amino acids by their

frequency of occurrence in proteins.4. Instead of giving pseudocounts all the same

value, weight them by their similarity to the consensus (like BLOSUM62 does) at each position. (PSI-BLAST method).

5. Combine 2 & 4 (Dirichlet mixture method).

From less to more complicated

Page 16: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Method 1 and standard BLOSUM62 matrix

Method 5

A PSSM column with a perfectly conserved isoleucine with different methods used to calculate the scores.

Page 17: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Using Hidden Markov models to describe sequence alignment profiles

• A profile HMM can represent a sequence alignment profile similar to how a PSSM does.

• A profile HMM includes information on the amino acid consensus at each position in the alignment like a PSSM.

• A profile HMM also has position-specific scores for gap insertion and extensions.

Page 18: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Background: Creating HMMs

To create an HMM to model data we need to determine two things:

• The structure/topology of the HMM—states and transitions

• The values of the parameters—emission and transition probabilities.

• Determining the parameters is called “training”.

Page 19: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

A HMM structure/topology

M = match state (score the aa in the sequence at this position in the profile)I = insertion (w.r.t profile - insert gap characters in profile)D = deletion (w.r.t sequence - insert gap characters in sequence)

M1 is first aa in the profile, M2 is second, etc.

Page 20: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Example HMMER parametersNULE 595 -1558 85 338 -294 453 -1158 (...) -21 -313 45 531 201 384

HMM A C D E F G H (...) m->m m->i m->d i->m i->i d->m d->d b->m m->e

1 -1084 390 -8597 -8255 -5793 -8424 -8268 (...) 1

- -149 -500 233 43 -381 399 106 (...)

C -1 -11642 -12684 -894 -1115 -701 -1378 -16 *

2 -2140 -3785 -6293 -2251 3226 -2495 -727 (...) 2

- -149 -500 233 43 -381 399 106 (...)

C -1 -11642 -12684 -894 -1115 -701 -1378 * * (...)

76 -2255 -5128 -302 363 -784 -2353 1398 (...) 103

- -149 -500 233 43 -381 399 106 (...)

E -1 -11642 -12684 -894 -1115 -701 -1378 * *

77 -633 879 -2198 -5620 -1457 -5498 -4367 (...) 104

- * * * * * * * (...)

C * * * * * * * * 0

//

Page 21: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

A profile HMM with match state probabilities shown

AAs “PATH” is the consensus sequence.

Page 22: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Building a profile HMM

• Pick a HMM structure/topology.• Estimate initial parameters.• Train the HMM by running sequences

through it. • Transitions that get used are given

higher probabilities, those rarely used are given lower probabilities.

Page 23: Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1

Protein profile HMMs• Better (in theory) representations than PSSMs.

– More complicated.– Not hand-tuned by curators.

• Used in some protein profile databases:– Pfam (http://pfam.sanger.ac.uk/)– SMART (http://smart.embl-heidelberg.de/)

• Difficult to describe in human readable formats.

Schuster-Böckler et al., 2004 (http://www.biomedcentral.com/1471-2105/5/7)