spartanburg final oct 2013

October 2013 | Spartanburg South Carolina | SpartanburgNA.com

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh moreFREE

CREATING TIMETo Reclaim Your Life Time

On the Trailof ChangeTrekking with a Profound Purpose to Reclaim Your Life

ENERGY HEALING Gains Acceptance in Mainstream Medicine

October 2013 | Spartanburg South Carolina | SpartanburgNA.com

Gains Acceptance in Mainstream Medicine

A Paleo Diet is not all About MeatPass the Potatoes, Quinoa and Sprouts!

2 Spartanburg South Carolina | www.SpartanburgNA.com

L I M I T E D T I M E O F F E RComplimentary,

No Obligation Blood Analysis!($250 Value)

Call to schedule your appoinment today.

888.299.9300 or go online at balancedagain.com

Hormonal balance is key to your well-being and a delicate thing to achieve. Other hormone

replacement therapies rarely accomplish or maintain the hormonal equilibrium your body depends

on for optimum health. Our Hormone Replacement Therapy is highly successful. Here’s why:

The right kind of hormoneWe use only bioidentical hormones that are natural, plant-derived compounds which have the same

molecular structure as those made by the human body.

The right amount and compound of hormonesAt Balanced Solutions, each bioidentical hormone regimen is custom-compounded, based

on individual diagnostic results and history, making them safer and more effective than

synthetic hormones.

The right delivery systemPellet therapy is a sustainable delivery method that balances body chemistry and restores health and

vitality. The effect of pellets is nearly identical to the way hormones are naturally produced in a

healthy, 30-something individual.

Additional Health Benefits include:

• Rejuvenation

• Increased Metabolism

• Enhanced Mental Clarity

• Improved Sleep Quality

• Reduction in Mood Swings

• Decreased Hot Flashes

• Increased Libido

• Improved Blood Flow

• Promotes Bone Density

Balanced Solutions 864.662.7655 toll free 888.299.9300 balancedagain.comThe Village at Thornblade • 420 The Parkway, Suite N • Greer, SC 29650

Don’t accept fatigue, weight gain, depressionor low sex drive as normal.

Feel great again with Hormone Replacement Therapy.The perfect treatment for both men and women!

3natural awakenings October 2013

L I M I T E D T I M E O F F E RComplimentary,

No Obligation Blood Analysis!($250 Value)

Call to schedule your appoinment today.

888.299.9300 or go online at balancedagain.com

Hormonal balance is key to your well-being and a delicate thing to achieve. Other hormone

replacement therapies rarely accomplish or maintain the hormonal equilibrium your body depends

on for optimum health. Our Hormone Replacement Therapy is highly successful. Here’s why:

The right kind of hormoneWe use only bioidentical hormones that are natural, plant-derived compounds which have the same

molecular structure as those made by the human body.

The right amount and compound of hormonesAt Balanced Solutions, each bioidentical hormone regimen is custom-compounded, based

on individual diagnostic results and history, making them safer and more effective than

synthetic hormones.

The right delivery systemPellet therapy is a sustainable delivery method that balances body chemistry and restores health and

vitality. The effect of pellets is nearly identical to the way hormones are naturally produced in a

healthy, 30-something individual.

Additional Health Benefits include:

• Rejuvenation

• Increased Metabolism

• Enhanced Mental Clarity

• Improved Sleep Quality

• Reduction in Mood Swings

• Decreased Hot Flashes

• Increased Libido

• Improved Blood Flow

• Promotes Bone Density

Balanced Solutions 864.662.7655 toll free 888.299.9300 balancedagain.comThe Village at Thornblade • 420 The Parkway, Suite N • Greer, SC 29650

Don’t accept fatigue, weight gain, depressionor low sex drive as normal.

Feel great again with Hormone Replacement Therapy.The perfect treatment for both men and women!


© 2013 by Natural Awakenings. All rights reserved. Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing.

Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is available in selected stores, health and education centers, healing centers, public libraries and wher-ever free publications are generally seen. Please call to find a location near you or if you would like copies placed at your business.

We do not necessarily endorse the views ex-pressed in the articles and advertisements, nor are we responsible for the products and services advertised. We welcome your ideas, articles and feedback.

Calendar listings must be emailed by the 10th of the previous month to: [email protected]

SUBSCRIPTIONSSubscriptions are available by sending

$24 (for 12 issues). Call or email to subscribe.

Natural Awakenings is printed on recycled newsprint with soy based ink.

Publishers Linda & Jim Craig

Managing EditorJeanette Watkins

Contributing Editors Sharon Hadden - Michele Senac

Advertising / NAN Card Kendra LaBrie

Design & Production / Ad Design

Susan McCann - Wendy Wilson

Distribution Jim Craig - Kendra LaBrie

To contact Natural Awakenings

Spartanburg Edition:

Phone: 864-248-4910

Email: [email protected]

SpartanburgNA.com

contact us

letterfrompublisherNow that we are one month in—let the fun begin!

With a theme of energy healing, the October is-sue is inspiring and interactive.

Take Starry-Eyed Kids: Clear Skies, Cool Nights, Open Vast Vistas, page 18, for example. It discusses how the night sky can be the perfect canvas for your child to paint their dreams. With the cool weather of fall finally upon us, a night of star-gazing could prove to be an imaginative family bonding experience. Ancestral Diets: A Lighter Shade of Paleo, page 20, touches on Vegetarian Awareness Month and features several yummy recipes with energy-boosting ingredi-ents like carrots, kale and pineapple. Try the grilled pineapple with cream recipe, page 22, for a delicious dessert. Energy healing is all about achieving balance. It’s no surprise that taking our time to go about our daily schedule can be an effective tool for relieving stress and anxiety. All the Time in the World: Transforming Anxiety into Artistry, page 19 shares insight on the benefits of taking things one moment at a time.

Good vibes are flowing in the way of the natural health world. The U.S. Sen-ate passed the Naturopathic Medicine Week resolution. From October 7 to 13, healthy living lovers can officially rejoice in the value of naturopathic medi-cine for providing safe, effective and affordable healthcare. The local natural health community can also rejoice in the exciting events that are happening in our area. The Festival of Healing and Spiritual Awareness, October 12 to 13 in Greenville, will feature workshops on health and spirituality, exhibitors, art, mu-sic and more. The Women’s Weekend Retreat near Caesar’s Head, October 11 to 13, will provide a weekend of relaxation, rejuvenation and adventure.

What better time to curl up with Natural Awakenings, place a quick call to your favorite businesses featured throughout our magazine, and make a stayca-tion out of your journey into energy healing.

In health and harmony,

Linda and Jim

NEW ADVERTISING OPPORTUNITIES

FOR THE SPARTANBURG AREA!


check out our local farm resources on page 24 for all your fresh fruit

and veggie needs.

15 HEAlING SPRINGS A Journey Towards Wellness by Michele Senac

16 ENERGy HEAlING cOMES OF AGE A Historic Milestone in Complementary Medicine by Linda Sechrist

18 STARRy-EyED KIDS Clear Skies, Cool Nights Open Vast Vistas by Randy Kambic

19 All THE TIME IN THE WORlD Transforming Anxiety into Artistry by Marney K. Makridakis

20 ANcESTRAl DIETS A Lighter Shade of Paleo by Sayer Ji and Tania Melkonian

26 TREKKING AS PIlGRIMAGE A Literal Path to Personal Growth by Sarah Todd

HOW TO ADVERTISETo advertise with Natural Awakenings or request a media kit, please contact us at 864-248-4910 or email [email protected] for ads: the 10th of the month.

EDITORIAL SUBMISSIONSEmail articles, news items and ideas to: [email protected] for editorial: the 5th of the month.

CALENDAR SUBMISSIONSEmail Calendar Events to: [email protected] for calendar: the 10th of the month.

REGIONAL MARKETSAdvertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets call 239-449-8309. For franchising opportunities call 239-530-1377 or visit NaturalAwakeningsMag.com.

advertising & submissions

SpartanburgNA.com

Natural Awakenings is your guide to a healthier, more balanced life. In each issue readers fi nd cutting-edge information on natural health, nutrition, fi tness, personal growth, green living, creative expression and the prod-ucts and services that support a healthy lifestyle.

6 newsbriefs

9 healthbriefs

14 ecotip

15 community spotlight

16 healingways

18 healthykids

19 inspiration

20 consciouseating

23 foodiedining guide

24 localfarm page

26 fi tbody

28 calendar

29 resourceguide

9

contents

18

19

20

16

26


communitynewsDemonstration Garden Now Accessible to All

Hatcher Garden & Woodland Preserve recently dedicated the eight-bed Water

Wise Demonstration Garden, handicapped-accessible pathway. A paved pathway, funded by a grant from the Spartanburg Regional Foundation, winds from the Handi-capped Parking/Safe Bus Turnaround past the entrance to the environmentally friendly garden space created as a result of a grant from Spartanburg Water.

“A combination of grants and private and corporate donations made these en-hancements possible,” said Al Jolly, newly-elected chair of the Hatcher Garden board. Jolly, an architect and chair of Hatcher’s Project Implementation Committee, who was intimately involved with the process from the beginning. “Once again, the commu-nity has come together to create a new garden space and accessible facilities for the garden,” Jolly added.

The garden staff worked closely with Spartanburg Water’s general manager, Sue Schneider, to design and implement the educational garden. Arborvitae and a Japa-nese maple, donations from Roebuck Wholesale Landscaping, anchor the garden filled with perennials chosen specifically for their ability to thrive without irrigation in Spartanburg’s climate.

“The fact that we were able to add a water fountain, something the garden has needed to accommodate visitors and school groups, was an added bonus,” said Robin Vollmer, executive director of Hatcher Garden. In addition to the water foun-tain, making the garden wheelchair accessible so everyone could enjoy the low-maintenance, drought-resistant garden was one of the major goals of the project.

For more information, call 864-574-7724 or visit HatcherGarden.org.

Mary Underwood Completes Advanced Energy Courses

This summer, Mary W. Underwood, LISW-CP, DCEP, owner of Awakening Energies, LLC attended two powerful trainings

to learn how to assist the body in healing itself. BodyTalk Fundamentals, a course in Chapel Hill, North Caro-lina, is an intensive 4 day workshop, where participants learn the BodyTalk process. BodyTalk is a non-invasive process that uses the body’s inherent wisdom to heal and balance itself. It is

a simple, peaceful process, yet incredibly powerful and effective. After previously attending the Advanced Heart Assisted Therapy Course (HAT) in

January 2012, and using the method successfully, Underwood attended a more ad-vanced workshop. The HAT course in Trenton, New Jersey is an energy therapy course that uses the energy of the heart and positive affirmations to shift stuck emotions, thoughts and behaviors. Underwood says, “It taught me how to use this tool to treat chronic pain, addictions and compulsive behaviors. I learned how to use it to help people enhance their performance at any desired task, whether athletics, academics or a hobby.”

Awakening Energies, LLC is located at 736 E. Main St, Ste. 201, Spartanburg. For more information, call 864-266-0634 or visit AwakeningEnergies.com. See ad, page 17.

Mary W. Underwood

Show your card and enjoy...• Discounts from 5%

to 50% on network products & services

• Online Provider Directory

• Your Personalized NAN® Card

• Coverage for the entire family

• Free digital sub- scription to Natural Awakenings magazine

• Monthly Newsletter

QUALITY OF LIFEWITHOUT LIMITSDon’t Wait, Enroll Today

[email protected]

864-810-0663NaturalAwakeningsNetwork.com


Geothermal Heating up the Upstate

Geothermal systems – HVAC systems that use

steady underground tempera-ture to heat and cool air – are the hot new trend in heating and cooling. As incredibly cost-effective and durable systems that also significantly reduce a home’s energy consumption, they’re gaining tons of fans in South Carolina.

The team at Waldrop, Inc., a local HVAC company, isn’t surprised by geothermal’s rising popularity. “You can save a lot of money with a geothermal system,” says Jamie Porterfield, Waldrop’s executive vice president. “Between consuming less energy – from 25 to 50 percent – and tax incentives at the state and federal level, you can see it help your budget, and sooner than you might expect.”

Geothermal systems, like the ones offered by Waldrop, take advantage of the fact that the temperature underground stays steady between 50 and 60 degrees year-round. During cold months, warmer air is pumped from underground into your house, while in the sweltering summer months, hot inside air is pumped from your house and into the ground, cooling it.

With their energy efficiency, cost savings, and environ-mental friendliness, they’re a great option, whether you’ve got an eye on your budget or on the Earth – or both.

Waldrop, Inc. is located at 8345 Taylor Colquitt Rd, Spartanburg. For more information, call 864-578-7130 or visit WaldropInc.com.

Healthy Lunches Provided at Montessori School

Montessori Academy of

Spartanburg has seen a positive change in students since a local restaurant began providing healthy, boxed lunches. The Farmer’s Table in Spartanburg is delivering healthy, boxed lunches for students. It was offered one day a week for about 25 to 30 children, and this semester the school is offering more extensive options, with The Farmer’s Table delivering lunches twice a week.

“The children at the school have enjoyed this change and the parents have shown support for the cause as well,” said Lenora Sansbury, co-owner and chef of The Farmer’s Table. “The lunch program is proof that schools can pro-vide healthy lunches for their students.”

Parents can choose to purchase the lunches or have their children bring their own from home.

The Farmer’s Table is located at 401 E. Kennedy St, Spartanburg. For more information, call 864-582-6554 or visit TheFarmersTableSC.com.


communitynewsJunk Matters Creates Zero-Waste Program

As natural resources

diminish and landfill space shrinks, certain alternatives eliminate our need for excess trash. Two recent Wofford graduates, Joseph McMillin and Eric Breitenstein, have returned to their alma mater to incorporate a zero-waste philosophy. The zero-waste philosophy connects the missing link between the manufacturer and the landfill by targeting the

production of products and the reuse of these products. Through zero-waste, over 90 percent of the solid waste

that consumers send to landfills can be eliminated through composting and recycling. What used to be a tedious and complicated process is now made simple through modern day material recovery facility systems (MRFs). People can place all of their recyclable materials, which include mixed paper, cardboard, glass, aluminum, steel and all seven grades of plastic, into a single bin instead of sorting it by hand. These products are then turned into new ones. The second component, composting, allows for the reuse of non-recyclable items including food waste, yard waste, wax board, compostable products and many other paper products.

McMillin and Breitenstein’s waste diversion company, Junk Matters, LLC, has installed an organic waste dehydration unit behind Burwell Dining Hall at Wofford College. The process quickens the decomposition of food, bones and compostable plastic and paper products in about eight hours. Food waste enters the unit where it is churned and heated to a temperature of up to 300 degrees Fahrenheit. The result is a sterile material with the texture of coffee grounds and the distinct smell of gingerbread. Another by-product is landscape grade water, grey water that can be used for landscaping.

“This is very exciting for us,” says McMillin, “We will be looking to implement these at strategic locations across the county in the future in order to help reduce food waste going to the landfill.”

For more information, call 864-473-7376 or visit JunkMattersLLC.com.

Bike Sharing System is First in Southeast

According to the National Household Travel Survey, 48 percent of all trips driven in the U.S. were three miles

or less, and 24 percent were one mile or less. A slight shift in how we travel could have a substantial impact on the current state of Spartanburg’s environment, air and water qualities. Spartanburg B-cycle, a Partners for Active Living Initiative, provides a non-motorized transportation option throughout the urban core of downtown Spartanburg. As the system grows and expands, additional stations will al-low commuters to reach more destinations.

Spartanburg B-cycle is open year round. System hours are 5am to 10pm. There are four stations: downtown near Morgan Square, on the Mary Black Foundation Rail Trail (MBF) and on Wofford College and Converse College campuses. A fifth station is planned for the Healthy Food Hub on the north side of the City of Spartanburg. Spar-tanburg B-cycle has a system wide carbon offset of over 35,000 pounds and has two solar powered stations, one on Converse College’s campus and one on the MBF Rail.

Spartanburg B-cycle rates are among the lowest in the nation. For $15, you can rent a bicycle, lock and helmet for three months, with the opportunity to renew for an additional three months. When you return all of the equipment, your $15 will be refunded. 30-day and annual members are able to track their individual carbon offset as well as the money they saved by not purchasing gasoline. Memberships are available online for your con-venience. In addition to B-cycle, Partners for Active Living also operates a longer-term bike lending initiative called Hub Cycle, which utilizes donated bicycles and parts and refurbishes them to be able to rent them to individuals. Donations are tax deductible and allow renters to borrow the bicycle practically for free.

For more information, call 864-598-9638 or visit Spartanburg.Bcycle.com.

Joseph McMillin and Eric Breitenstein


Senate Passes Naturopathic Medicine Week Resolution

The U.S. Senate unanimously passed a resolution designating

October 7 - October 13 as Natur-opathic Medicine Week.

The resolution recognizes the value of naturopathic medicine in providing “safe, effective, and afford-able health care...” and encourages Americans to learn about the role of naturopathic physicians in preventing chronic and debilitating conditions.

Passage of this resolution is an historic achievement for naturopathic medicine. The Congress has now of-ficially recognized the important role naturopathic medicine plays in effec-tively addressing the nation’s health care needs as well as in addressing the increasingly severe shortage of primary care physicians.

The resolution (Sen. Res. 221) can be found on Congress’ official web site, Congress.gov.

For the latest information about Naturopathic Medicine Week (NMW), visit the NMW page on AANP’s website at Naturopathic.org.

healthbriefs

Dulse Seaweed a Heart Health PowerhouseDulse (palmaria palmata), a protein-rich red sea-

weed, could become a new protein source to compete with current protein crops like soybeans, ac-cording to scientists at Ireland’s Teagasc Food Research Centre. Dulse har-vested from October to January usually has the highest protein content. This functional food also contributes levels of essential amino acids such as leucine, valine and methionine, similar to those contained in legumes like peas or beans. It may even help protect against cardiovascular disease. The Agriculture and Food Development Authority reports that for the first time, researchers have identified a renin-inhibitory peptide in dulse that helps to reduce high blood pres-sure, like ACE-1 inhibitors commonly used in drug therapy.

MORE PlASTIcS, MORE OBESE KIDSA causal link between the worldwide

epidemic of childhood obesity and phthalates commonly used in soft plastics, packaging and many personal care prod-ucts is becoming more evident. A Korean study from Sanggye Paik Hospital at the Inje

University College of Medicine, in Seoul, shows that the risk of childhood obesity increases with the level of DEHP (di-2-ethylhexyl phthalate) in the bloodstream. The study indicates that phthalates may change gene expression associated with fat metabolism. DEHP in particular is a suspected endocrine disruptor, or hormone-altering agent. Children with the highest DEHP levels were nearly five times more likely of being obese than children with the lowest levels. The scien-tists studied 204 children ages 6 to 13, of whom 105 were obese. A chemical commonly used to soften plastics, DEHP is found in some chil-dren’s toys, as well as myriad household items. Phthalates can be found in paci-fiers, plastic food packaging, medical equipment and building materials like vinyl flooring. Personal care products such as soap, shampoo and nail polish may also contain phthalates.

Acupuncture’s Growing AcceptanceOne in 10 American adults has received

acupuncture at least once and nearly half of them say they are “extremely” or “very” satisfied with their treatment, according to a survey sponsored by the National Certification Commission for Acupuncture and Oriental Medicine. Sixty percent of survey respondents readily accepted the idea of acupuncture as a treatment option, and 20 percent have used other forms of Oriental medicine, including herbs and Chinese bodywork.

Acupuncture and Oriental Medicine Day is observed on Oct. 24. For more information, visit aomday.org.


Grapes Grapple with Metabolic SyndromeIt’s high season for grapes, and

consuming any variety of this sweet fruit—red, green or black— may help protect against organ damage associ-ated with the progression of metabolic syndrome, according to new research presented at the 2013 ExperimentalBiology Conference, in Boston. Natural components in grapes, known as polyphenols, are thought to be responsible for this benefi t. Metabolic syndrome comprises a cluster of conditions—increased blood pressure, high blood sugar level, excess body fat around the waist and abnormal cholesterol levels—that occur together, increasing the risk of heart disease, stroke and diabetes. Working with lab animals, researchers found that three months of a grape-enriched diet signifi -cantly reduced infl ammatory markers throughout the body, most signifi -cantly in the liver and abdominal fat tissue. The diet also reduced the fat weight of the animals’ liver, kidneys and abdomen compared with those that were on a control diet. The grape intake also increased markers of an-tioxidant defense, particularly in the liver and kidneys. “Our study suggests that a grape-enriched diet may play a critical role in protecting against metabolic syndrome and the toll it takes on the body and its organs,” says lead inves-tigator E. Mitchell Seymour, Ph.D., of the University of Michigan Health System. “Both infl ammation and oxi-dative stress play a role in cardiovas-cular disease progression and organ dysfunction in Type 2 diabetes.”

Yoga Resource Guide

ANDERSON

Yoga Place2508 N. Main St.

864-404-1616 or 864-376-7750www.YogaPlace.org

CLEMSON/PENDLETON

The Purple Mat [Yoga • Wellness]

The Purple Mat, Ltd.102 E. Main St.864-916-YOGA

www.ThePurpleMat.com

EASLEY

Integrative Yoga Therapy633 Saco Lowell Rd.

864-444-5523www.LindaPattersonYoga.com

GREENVILLEwww.GreenvilleIndoorRowing.com

Halton Business Park120 Halton Rd, Ste. 1

864-354-2882www.ItsYogaStudio.com

404 N. Pleasantburg Dr.864-420-9839

www.QiWorksStudio.com

“Row-ga!” and YOGA at Greenville Indoor Rowing, LLC

576-A Woodruff Rd.864-281-1505 or 864-901-3776

www.GreenvilleIndoorRowing.com

GREENVILLE

1140 Woodruff Rd. 864-329-1114

www.SouthernOm.com

GREER

R

Yoga East 2105 Old Spartanburg Rd.

864-244-6478 www.YogaEast.us

SPARTANBURG

1040 Fernwood-Glendale Rd., Ste.58

864-583-3335www.Zen-GardenYoga.com


MERcURy RAISES RISK OF DIABETES AND HEART ATTAcKSExposure to mer-

cury in young adulthood can trig-ger serious health issues later in life, according to two recent studies. New Indiana University research confirmed a link between mercury exposure and diabe-tes in young adults ages 20 to 32 at the beginning of the study in 1987, and was periodically reassessed six times through 2005. Those with high mercury levels at the beginning of the study were 65 percent more likely to develop Type 2 diabetes as they aged. Also, Swedish researchers report that high mercury levels from eating contaminated fish leads to a higher risk for heart attacks in men. However, eating clean coldwater fish high in healthy omega-3 fatty acids, like salmon, countered the in-creased risk from the mercury exposure, according to conclu-sions published in the American Journal of Clinical Nutrition.

Cavities are ContagiousCan a kiss lead to a cav-

ity? Yes, says Middleton, Wisconsin, Dentist Chris Kammer, president of The American Academy of Oral Systemic Health. He contends that cavities can be caused by bacteria that are passed from one person to another, just like a cold or the flu. “We aren’t born with tooth decay-causing bacteria,” says Kammer. “At some point, it is introduced to us from an

external source, usually a family member,” through sharing food utensils, licking pacifiers, kissing and more. “Then it takes up residence in our mouths, where it is fed by sugars, which cause the bacteria to produce acid.” Cavity-causing bacteria can be transmitted by sharing food, by drinking out of the same glass and by toothbrushes that make contact with the bathroom counter. If bacteria is not removed from teeth (existing in a protective biofilm called plaque), the acid byproduct is able to directly reach and soften tooth surfaces, creating the holes called cavities. Easy solutions to the problem start with good oral hygiene for both parents and kids and proper brushing from a very young age, starting with finger brushing as soon as the first tooth erupts. Kammer advises making it fun and thus habit-forming when kids become old enough to do it themselves; one new interactive toothbrush times kids to ensure they brush the dentist-recom-mended two minutes.


October is National Spinal Health Month A healthy spine is more than the basis of good posture—it is a harbin-ger of sound emotional and physical health, according to practitioners of holistic chiropractic care. Those seek-ing relief from back pain and other common spine-related conditions might do well to exchange pain-masking drugs for more lasting relief from professional adjustments. All chiropractic can be consid-ered alternative medicine, because practitioners do not prescribe drugs or surgery. Instead, these doctors rely on manual therapies such as spinal manipulation to improve function and provide pain relief for conditions ranging from simple sprains and strains to herniated discs and sciatica. Yet, holistic chiropractors go beyond treatment of structural problems, like a misaligned spine, to address root causes. Dr. Tessa Greene, a Spartanburg, South Carolina chi-ropractor, points out that, “Chiropractic care restores health

healthbriefs

and prevents injury by improving the structural integrity of the body, primarily the spine. The brain communicates with the rest of the body via the spinal cord and nervous system. When

functioning perfectly, this communication is uninterrupted, and the messages go to and from the brain without interference. Spinal adjustments paired with a healthy diet and exercise is where you will find true healing and health.” Holistic chiropractors typically can suggest complementary measures such as massage, yoga, naturopathy or physical therapy for a more integrated and com-prehensive treatment approach. Beyond adjusting the spine, they may also prescribe adjustments to diet, exercise and other life-style elements, depending on their under-standing of an individual’s optimum path to wellness. Before placing one’s care in some-

one else’s hands, ask for credentials and seek out reviews from former patients. Good health—and a happy spine—begin with an educated and empowered patient.

ChiroHealthy.com includes a database of licensed chiroprac-tors, searchable by zip code.


Natural Eye Care for Aging DogsMany owners of middle-aged and

older dogs worry about their pets’ declining eyesight. Cloudy eyes are of particular concern, but that is not necessarily a sign that a dog is going blind, advises Shawn Messon-nier, a doctor of veterinary medicine practicing in Plano, Texas. “While cataracts strike many older dogs, a more common condi-tion is lenticular or nuclear sclerosis, a thickening of the lens of the eye,” says Messonnier. He explains that this nor-mal change causes the eye to appear somewhat cloudy or gray, similar to a cataract. However, unlike a cataract, this type of sclerosis does not interfere with the pet’s vision. “Veterinarians can easily tell the difference between these conditions,” he says. “No treat-ment is necessary for lenticular scle-rosis; cataracts are often treated with carnosine drops or with surgery.” For prevention, Messonnier sug-gests minimizing toxins that can cause infl ammation throughout an animal’s body, not just the eyes. This means using blood titer testing instead of an-nual vaccinations, reducing the use of fl ea and tick chemicals, using natural pet foods and minimizing the use of conventional medications. He also recommends feeding a pet nutrients that contribute to health and reduce infl ammation and cellular damage, including fi sh oil, probiotics and antioxidants like bilberry, which supports eye health.

Green is the prime color of the world, and that from which its loveliness arises.~Pedro calderón de la Barca


ecotipJohnny AppleseedingTree-mendous Acts Grow Quality of LifeVolunteers will emulate Johnny Appleseed to expand and restore local urban green spaces and improve their quality of life and environment as part of October’s ninth annual National NeighborWoods Month program. Last year, local organizations and governments coordinated the planting of more than 45,000 trees by as many as 23,000 volunteers in hundreds of commu-nities nationwide. In Massachusetts, Boston Parks & Recreation Department workers joined TD Bank employees and public volunteers to revitalize the East Boston Greenway with 50 new trees. In Goleta, California, 80 new trees took root via 12 planting and care events, and more than 500 elemen-tary school students took a cellular-level look at tree leaves during three science nights. “Their shouts upon seeing the hair-like edges of some leaves that serve to absorb water and control evaporation were terrifi c,” says Ken Knight, executive

Join for FREE at NaturalAwakeningsSingles.com

Are You Ready To Meet Your Soul Mate?

Join the largest database of health-conscious, eco-minded, spiritual singles now and manifest an extraordinary relationship!

director of Goleta Valley Beautiful. “We impress on them that they will act as stewards—what we plant will also be their children’s trees and onward.”

The Alliance for Community Trees (AC-Trees), the national nonprofi t program coordinator, estimates last year’s efforts will capture 23.1 million gallons of stormwater, dispose of 660 tons of air pollutants and save participating cities and towns nearly $600,000 in water management and air pol-lution costs each year. Other tree-mendous benefi ts include beautifying the landscape, improving home property values, provid-ing a natural habitat and reducing home air conditioning costs by supplying more shade. To date, ACTrees member organizations have planted and cared for more than 15 million trees in neighborhoods nationwide, involving 5 million-plus volunteers. Ex-ecutive Director Carrie Gallagher remarks, “People understand instinctively that trees are vital to creating safe and successful com-munities, and a livable, sustainable future.”

For more information and to participate, visit NeighborWoodsMonth.org or ACTrees.org.


communityspotlight

by Michele Senac

Marlaina Sheppard of Healing Springs in Spartanburg is a

nutritional health professional who has experienced an impressive healing journey. Sheppard is a Certified Health Coach through the Institute for Integrative Nutrition (IIN). She shares that six years ago while pregnant she had diabetes requiring three insulin injections daily, and high blood pressure for which she took medications three times a day. One week after delivery, at age 30, she had what her doctor said may have been a stroke. The diabetes and high blood pressure persisted and were not responding to treatment. It was at that time that she

Healing SpringsA Journey

Towards Wellnessdecided she had to make significant changes.

Over the next year, Sheppard engaged in an intensive self-study program of nutrition and holistic health. She switched to a plant-based diet and started exercising and within one month her blood pressure normalized and she no longer had to take insulin. Over the next two years, she lost 100 pounds. Inspired by her results, she decided to teach others what helped her. Four years later, she began a women’s group teaching exercise, nutrition, weigh-ins and accountability, and later completed training for Certified Health Coach. “My life had

changed so dramatically. It affected the kind of wife and mother I was. I had energy. We don’t realize how sick we are until we are well,” says Sheppard.

Sheppard states, “Because we are holistic people, our health affects other areas of our lives.” She explains that health coaching focuses on nutrition and exercise, but also looks at relationships, home and work life, and stress. “So many people think that waking up feeling tired is normal. When you get well, you sleep better, and you don’t need an afternoon nap. It even changes our attitude. When we’re well, we’re generally happier people,” Sheppard adds.

New clients are seen after their health history has been previewed. The initial visit includes ph testing, a complete review of the health history, and a detailed action plan. If the client commits, a six month program is outlined, and the client meets with Sheppard two to four times each month for health coaching. A six week Boot Camp is also offered which includes nutritional counseling, exercise, detoxification, weigh-ins, and accountability. According to Sheppard, most clients see rapid results and healthy transformations. A six week “Healing Foods” class is available. This month a “Dangerous Beauty Products” class begins.

Sheppard is the best example of what can be accomplished. She notes that she exercises six days per week, follows a dairy-free, mostly vegetarian diet, adding protein with fish, beans, and a vegan powder, and a green smoothie for breakfast. “As people come to me, I want them to see that I do as I teach. Support and accountability are both so important,” says Sheppard.

Healing Springs is located at 220 Westgate Mall Dr, Ste. 6, Spartanburg. For more information, call 864-699-9448 or visit HealingSprings12.com. See ad, page 11.

Michele Senac is a contributing editor for Natural Awakenings and certified in Interior Redesign, Home Staging and Feng Shui. For more information, call 864-631-9335 or visit FineRedesigns.com.


Energy Healing Comes of Age

A Historic Milestone in Complementary Medicine

As recently as 2010, it would have been unimaginable for an annual medical conference including

allopathic physicians to hold a meet-ing themed Illuminating the Energy Spectrum. Yet it happened at the sold-out Institute of Functional Medicine 2013 annual international conference. Workshop topics ranged from bodily energy regulation to presentations by Grand Qigong Master Ou, Wen Wei, the originator of Pangu Shengong, and Medical Anthropologist and Psycholo-gist Alberto Villoldo, Ph.D., whose Four Winds Light Body School offers a two-year program on the luminous light body, also known as a local energy field, aura, life force, qi/chi or prana. The energy medicine practiced by acupuncturists and other health practi-tioners that offer any one of the 60-plus hands-on and hands-off modalities de-scribed in The Encyclopedia of Energy Medicine, by Linnie Thomas, operates on the belief that changes in the body’s life force can affect health and heal-ing. The therapeutic use of any of them begins with an assessment of the body’s electromagnetic field. Then, a treatment

specifically designed to correct energy disturbances helps recreate a healthy balance in its multilayered energy field, comprised of pathways, known as meridians, and energy centers (chakras) that correspond to related nerve cen-ters, endocrine glands, internal organ systems and the circulatory system. The objective for energy medicine practitioners is to uncover the root causes of imbalances—often from emo-tional stress or physical trauma—and harmonize them at a bioenergetic level before aberrations completely solidify and manifest as illness.

Clinical SupportJames Oschman, Ph.D., an academic scientist and international authority in Dover, New Hampshire, has con-ducted decades of research into the science of bioenergetics—the flow and transformation of energy between liv-ing organisms and their environment. He explores the basis of the energetic exchanges that manifest via comple-mentary and alternative therapies in his book, Energy Medicine: The Scien-tific Basis.

healingways

by linda Sechrist

For more information about advertising and how you can participate, call

864-248-4910

Coming Next Month

PERSONAL GROWTHLive the Life of Your Dreams

Natural Awakenings’ November Issue

Provides You the Resources


According to Oschman, there is now enough high-quality research in leading peer-reviewed biomedical journals to provide energy medicine the credence to transform from a little-known, alternative healthcare modality into a conven-tional form of medicine. The progression to more widespread acceptance is similar to that experienced by acupuncture and massage.

Evolving PlatformFor more than 35 years, pioneers of energy medicine like Bar-bara Ann Brennan, founder of the Barbara Brennan School of Healing; John F. Thie, founder of Touch for Health; and Donna Eden, founder of Eden Energy Medicine, have delved beyond conventional models of healing to confi rm that our sensory experience of the world is as limited as our vocabulary to describe it. New language for new concepts is required, such as: nature’s drive for wholeness, resonance, a new band of frequencies, restructuring DNA, local fi elds and the non-local fi eld, encoding, entrainment, strings, strands, attunement, evolutionary healing and vibration. Eden, who has had a lifelong ability to make intuitive health assessments later confi rmed by medical tests, can look at an individual’s body, see and feel where the energy fl ow is interrupted, out of balance or not in harmony, and then work to correct the problem. “Very little of the natural world that human beings evolved in still exists. In addition, our bodies haven’t adapted to modern stressors or the electromagnetic ener-gies associated with technologies that occupy our living and working environments,” says Eden. “Energy medicine is invaluable because anyone can learn how to understand

Awakening Energies is a psychotherapy practice integrating energy therapy, body work, and traditional talk therapy. It is based on the belief that human suffering is best healed by combining a strong, positive therapeutic relationship with the use of innovative healing techniques.is best healed by combining a strong, positive therapeutic relationship with the

Mary W. Underwood, MSW, LISW-CPDiplomate of Comprehensive Energy Psychology Advanced Heart Assisted Therapist Certified Advanced Integrative Therapist BodyTalk Practitioner EFT, EMDR, DNMS TherapistLearn more at www.awakeningenergies.com

“Mary picked me up from

a dark, deep hole that I

thought no one could get

me out of. She guided me

slowly and with patience.

Her office is a safe place

filled with lots of love

from her heart.”864-266-0634 • [email protected] E. Main St., Suite 201. Spartanburg, SC 29302

Come see how energy therapy can bring more joy and peace into your life.Awakening Energies is a psychotherapy practice integrating energy therapy, body work, and traditional talk therapy. It is based on the belief that human suffering is best healed by combining a strong, positive therapeutic relationship with the use of innovative healing techniques.

Mary W. Underwood, MSW, LISW-CP

Come see how energy therapy can bring more joy and peace into your life.

Because happiness matters...

Awakening Energies, LLC

their body as an energy system and how to use techniques to restore energies that have become weak, disturbed or unbalanced.” Her teaching tools include her classic book, Energy Medicine, and Energy Medicine University, which she founded in 2006 in Sausalito, California. In a 2009 talk at the American Academy of Anti-Aging Medicine, Oschman predicted that energy medicine will become prominent in anti-aging medicine. “When I review the history of medicine, there are periods in which things stay pretty much the same, and then there are great break-throughs. I think that with the advent of energy medicine, another milestone is upon us.”

Learn more at issseemblog.org, the International Society for Subtle Energies and Energy Medicine website.

Linda Sechrist is a senior staff writer for Natural Awakenings. Visit ItsAllAboutWe.com for the recorded interviews.

One touch of nature makes

the whole world kin.

~William Shakespeare


healthykids

Wishing upon a star is an iconic activity steeped in everyone’s childhood desire

to attain happiness and fulfillment. Ac-tual stargazing can help make parents’ dreams for their children’s well-being come true, as well. Children are exposed to imagin-ing the larger celestial realm through popular films, science fiction literature and pop songs, plus more tangibly via current sky events. Consider news of the meteoroid that exploded over Rus-sia in February and the latest images from the surface of Mars beamed to us by the NASA rover Curiosity. Experienc-ing the excitement of early knowledge can bolster academics while fostering a calming sense of the order of nature’s rhythms. “Astronomy ties into every edu-cational domain—physics, geometry, algebra, history and ecology,” advises former elementary school teacher Hi-ram Bertoch, of West Valley City, Utah, owner of the KidsKnowIt Network, which maintains 10 free children’s learning websites, including Kids Astronomy.com. Standing in awe at the wonders of the universe can also instill a centering sense of humility in the face of such grandeur. Autumn is one of the best times for channeling youngsters’ intrigue in constellations, given the clearer skies and comfortably cool nights. This

STARRY-EYED KIDS

Clear Skies, Cool Nights Open Vast Vistasby Randy Kambic

year, families can anticipate a special viewing of the Comet ISON, which is expected to be visible from much of the United States in late November.

Getting StartedSky & Telescope magazine’s online guide, Getting Started in Astronomy, offers easy steps for parents to put stars in kids’ eyes. Check out its This Week’s Sky at a Glance link. Find an open space like a park or wooded clearing to reduce ambient light and use sky maps in hobby publications or astronomy books from the library as guides. Binoculars are the best tool to start getting familiar with the night sky—they augment the naked eye enough to iden-tify many Moon craters, Jupiter’s moons and the crescent phases of Venus. Plan-etariums, science and children’s mu-seums, nature centers and astronomy clubs often hold public family events that include access to telescopes; some loan or rent them out. (Find local clubs and facilities at SkyAndTelescope.com/community/organizations.) Other opportunities include NASA’s Night Sky Network of astrono-my clubs, Astronomy magazine’s youth

The magical

night sky is

a perfect playground for a

child’s imagination.

Faraway Fun Factsn Stars appear to twinkle from light distortions caused by temperature differ-ences in our atmosphere. The lifespan of most stars is billions of years.n Ancient peo- ples saw patterns among the 2,000 stars visible to the naked eye and gave them names like The Big Dipper, Cassiopeia and Scorpius.

n A “shooting star” is actually a meteor with a trail of gases and particles.

n The Moon’s surface is pitted with thousands of craters from long-ago meteor strikes.

n Saturn’s rings are composed mostly of billions of ice particles and rocks.

n Jupiter is by far the largest studied planet; after the Moon and Venus, it’s usually the brightest object in the night sky.

n Planets Jupiter, Saturn, Neptune, Mercury and Mars, as well as Pluto, are named for Roman gods—Venus was the Roman goddess of love.

n Planets and the Moon don’t emit light—they reflect light from the sun.

Source: Don’t Know Much About the Universe, by Kenneth C. Davis


inspiration

Ask American adults if they’re anx-ious about time and they’ll likely say yes. Our society even deems

it expected, acceptable and normal to experience such stress, but is it neces-sary? It’s helpful to explore what is at the root of our problems with time and why we believe we benefi t from worry-ing and complaining about it. Both are good fi rst steps to releasing ourselves from the drama of getting caught up in and blaming time as a convenient catchall. Which of the following ratio-nales apply to us personally? “If I can complain about being busy, I don’t have to examine other areas in my life.” “My schedule is wrapped up with my self-esteem; being ‘too busy’ means that I’m successful.” “Worrying about time gives me something to talk about.” “I don’t plan things I might enjoy because it can be too demanding or even scary—it just feels easier and safer to be bored.” “Worrying about time is a con-venient excuse for not following my dreams.” Once we identify the perceived payoffs from worrying about time, we can see them for what they are: illu-sions that keep us from living our true potential. Awareness allows us to make a different choice and to partner with

time, instead of working against it. Einstein proved that time is subjec-tive, illustrated every time we compare an hour in a dentist’s chair to an hour in the company of a loved one. Time behaves and feels differently based on many variables, like emotion, engage-ment, fl ow, desire, interest, pain and pleasure. Our perspective counts. With capricious factors dancing around in our every moment, we can see why time isn’t constant. Happily, we can use the relative nature of time to our advantage and choose what our relationship with it will be. Consider that with each instance we choose how we talk about, measure and experience time, we are actually creating a new paradigm of time for ourselves. We can relinquish general views and limitations of time that hinder us and emerge into the possibilities of time as anything but a defi ned line. It can be a vibrant, completely moldable, layered, multifaceted work of art that we may adapt as we wish, to custom design each and every day.

Marney K. Makridakis of Dallas, TX, is the author of Creating Time: Using Creativity to Reinvent the Clock and Reclaim Your Life. She founded Artella magazine, the ARTbundance philosophy and the ArtellaLand.com community.

All the Time in the WorldTransforming Anxiety into Artistry

by Marney K. Makridakis

programs, SpacePlace.nasa.gov and Astronomy.com/kids programs. Boy Scout and Girl Scout troops both offer astronomy merit badges. When a family’s interest continues suffi ciently to buy a telescope, test pre-ferred models at many potential settings before fi nalizing a purchase. According to the online guide, a fi rst telescope should provide high-quality optics that limit diffraction (the spreading of light as it passes through the lens system to the eye) and a sturdy, smooth-working mount. More advanced telescopes have built-in computers and motors that can be programmed to point at specifi c spots in the sky.

Rising Stars on EarthIf trying to emulate Galileo is a chal-lenge, youngsters can relate and aspire to the cadre of young scientists profi led in Astronomy magazine’s “As-tronomy’s Rising Stars” story in July, available via most public libraries. Being a “self-described computer nerd” led Mark Krumholz, Ph.D., an associate professor of astronomy and astrophysics in his 30s at the University of California-Santa Cruz, to conduct massive-star formulation simulations. By “plugging in the laws of physics and turning the crank,” he has shown why some stars heat gas around them to appear much larger than others. Colors vary, as well. Stargazing was the catalyst for Anna Frebel, Ph.D., an assistant physics professor at the Massachusetts Institute of Technology, in Cambridge. “I consider myself fortunate that my initial passion led to becoming a professional astrono-mer,” says this scientist, who is credited with discovering the most chemically primitive star; the oldest known star as of 2007, at about 13.2 billion years; and the red giant star S1020549. Whether early steps lead to a later career or as a heavenly hobby, helping to convert a child’s, “What’s that?” to a happy, “I know what that is,” becomes worth encouraging. As Bertoch ob-serves, “Kids have an innate excitement about what’s out there.”

Randy Kambic, in Estero, FL, is a free-lance writer and editor who regularly contributes to Natural Awakenings.


reci

pe p

hoto

s by

Ste

phen

Bla

ncet

t

by Sayer Ji and Tania Melkonian

Vegetarian Awareness Month provides a timely opportu-nity to realize that a plant-focused diet does not derive exclusively from plants. Just as a carnivore does not

subsist on meat alone, the same applies to a vegetarian. What can we learn from our Paleolithic, or Stone Age

consciouseating

Ancestral DietsA Lighter Shade of Paleo

ancestors? The recent trend toward recreating a Paleo-era diet emphasizes the importance of vegetable nutrition to prehistoric communities, correcting the misperception that they were primarily meat-eaters. The original Paleo diet, before the advent of agriculture, reflected the hunting and gathering of lean meats, fruits, vegetables, nuts and seeds, and was absent of grains, dairy, starchy foods, sugar and salt. Today’s updated version might comprise foods naturally available and/or abundant before the cultivation of food in gardens, crops and livestock. Loren Cordain, Ph.D., author of The Paleo Diet and Nutritionist Nora Gedgaudas, author of Primal Body, Primal Mind, each contest the premise perpetuated by many in the weight-loss industry that fat, especially naturally satu-

rated fat, is unhealthy. Those same proponents that maintain low-fat/non-fat food is a panacea for modern illnesses also purport that cholesterol is the chief cause of heart ailments. Gedgaudas writes that the diets of hunter-gatherers inhabiting varied landscapes, from the Inuit of the north to tropical forest hominids, included large amounts of fat and cholesterol, which is essential to maintaining cell membranes and regulating hormones. She points out that obtaining cho-lesterol from food is necessary to augment the liver’s function of creating cholesterol internally. Cordain agrees that even saturated fats in meats can be beneficial, providing the animals are grass-fed, lean and live in clean surroundings. He emphasizes, however, that when our prehistoric ancestors ate fat, they did not also eat grain carbo-hydrates, sugar and salt, and contends that it is these compo-nents, not meat, that can be detrimental to the body. Doctor of Naturopathy Maureen Horne-Paul adds that organic, lean and game meats are exempt from the acid-ity inherent in corn-based animal feed. Plus, “When an animal is insensitively confined and killed, stress hormones are released that result in acidity. So, we are changing our pH from a healthy alkaline state to a more acidic condition when we consume meat from conventionally raised ani-mals.” Scientific studies published in the Journal of Gluten Sensi-tivity, Medical Hypotheses and by the Mercola group attest to key problems related to human consumption of grains. Anti-nutrients such as phytic acid in grains lead to the poor absorp-tion of minerals and related deficiencies. Improper absorption of dietary protein caused in part by enzyme inhibitors in grains also tends to damage the pancreas. Individual sensitivities to proteins in specific grains can further interfere with function-ing of the neuroendocrine system and subsequent emotional difficulties like addiction and depression may arise. All of these difficulties have been exacerbated by irresponsible prenatal diets that have made younger generations extra-sensitive to the


Paleo Specials du Jour

Curried carrot soup with buckwheat crackers and

goat cheese

Kale wraps with julienne of grass-fed strip loin,

bell peppers and avocado

Butter-grilled pineapple rounds served with

dollop of vanilla-scented heavy cream

challenges posed by grains to the human system. While Cordain doesn’t recommend dairy, Gedgaudas suggests organic or raw milk products, provided they retain their

full fat content and come from grass-fed cows. She reasons that the presence of the anti-carcinogenic fatty acid conjugat-ed linolenic acid (CLA) and the Wulzen factor anti-stiffness agent in the fat benefit joint lubrication. Experts suggest that the dietary formula established by our prehistoric ancestors can be the foundation for a modern-day, healthy, non-confining, creative eating experience. We can exchange grains for quinoa, amaranth and buckwheat (not technically grains at all), and include tubers and legumes, due to their folate and protein content. Blue and sweet potatoes also contain high levels of anthocyanins and potas-sium. Nearly every category of food, in the proper amounts, can be part of such a balanced diet. When we explore what makes sense and eat clean and natural foods, we have a good chance of finding our body’s own sweet spot.

Sayer Ji is the founder of GreenMed Info.com and an advisory board mem-ber of the National Health Federation. Tania Melkonian is a certified nutrition-ist and healthy culinary arts educator. Learn more at GreenMedInfo.com.

Paleo Parallel Tipsn Make plants the center. For any meat, choose organic, grass-fed lean cuts and use small portions as sides or garnish.

n Limit dairy to items with full fat content. Choose sheep or goat dairy when possible, followed by organic cow dairy.

n Limit grains, but explore pseudo-grains such as buckwheat, quinoa and amaranth to add safe, starch-like body to meals.

n For legumes, eat lentils. Blue and sweet potatoes are good choices for tubers.

Choose a job you love, and you will

never have to work a day in your life.

~Confucius


Kale Wraps

1 head kale (suggest cavolo nero or dino kale)1 bell pepper, sliced into julienned strips1 avocado, julienned3 oz grass-fed sirloin, grilled to medium and juliennedChili flakes and cumin to taste

Wash and dry kale.

Hold the blade of a long chef’s knife along the rib of the kale leaf and pull the leaf away from the rib. Repeat on the other side of the leaf to produce two long flat wraps. Set aside the ribs for stock.

Bring a pot filled with 2 cups of water to a rolling boil. Lower the heat to sim-mer and set a metal colander inside as a steamer basket so it sits on top of the water, not immersed.

lime leaves and lemongrass stalk.

When the stock comes to a boil, reduce to medium heat and add leaves, add half of the carrots and stalk. Cover and simmer for 30 minutes.

Remove from heat, cool and then remove leaves and stalk; blend soup until smooth.

Return soup blend to pot, add peppers and the rest of the carrots and then simmer on low heat for 40 minutes.

Grilled Pineapple with Cream

1 organic pineapple, cut into rounds2 Tbsp grass-fed, organic butter¼ cup organic cream1 vanilla bean or ½ tsp organic vanilla extract

Heat butter in a sauté pan until melted and bubbling (not brown). Place pine-apple rounds in the pan and grill for 2 minutes each side.

Slice vanilla bean pod lengthwise to scrape out vanilla granules. Mix gran-ules with cream until incorporated.

Serve pineapple rounds warm with a drizzle of vanilla-scented cream.

Paleo Menu Recipesby Tania Melkonian

Line the colander/basket with the kale “wrap” leaves. Cover and steam for 3 minutes until the leaves are just wilted.

Remove basket from heat and lay out leaves on a clean work surface, lined up vertically.

Stack 1 slice meat, 1 slice avocado and 2 slices pepper horizontally near the edge of a leaf. Add cumin and chili flakes and roll leaf away from the cook into a wrap. Repeat with all leaves.

curried carrot Soup

2 Tbsp ground turmeric1 tsp ground cumin1 cup diced onions3 Tbsp curry paste2 cups coconut milk2 cups vegetable broth1 Tbsp coconut oil1 stalk lemon grass3 leaves Kaffir lime1 cup diced carrots1 cup finely chopped red pepper

Set a heavy-bottomed pot on medium heat. Add turmeric and cumin, to toast. Add oil and stir to combine with spices. Add onions; sweat to cook until translu-cent, but not browned.

Add curry paste and stir. Add coconut milk and vegetable broth and bring to a boil.

With the back of a knife, bruise the

New DayPhysical Therapy

Alternative & Conventional Therapies


HEAlTHy

lOcAl

FRESH

SEASONAl

ORGANIc

GlUTEN-FREE

DAIRy-FREE

FARM-TO-TABlE

VEGETARIAN

VEGAN

PAlEO

RAW

Check Out These Local

Restaurants!

ANDERSON

SUMMA JOE’SJoe & Summer Fredette127 N. Main St.864-965-9030

We are proud to use local produce from Polecat Vegetable Farm, Bethel Trails Farm, Split Creek Farm, and other local f a r m s w h e n available.

GREENVILLE

JASON’S DElI824 Woods Crossing Rd.864-284-9870www.JasonsDeli.com

Greenville’s fa-vorite deli of-fers gluten-free, vegetarian, veg-an and dairy-free options ev-ery day. No

high-fructose corn syrup or trans fats are ever in any of our food. Salad bar with many organic choices is also available. See ad, page 20.

lIFEITcAFE’730 S. Pleasantburg Dr, Ste. L(near Greenville Tech) 864-271-4334www.LifeItCafe.com

“Change your diet into a Lifeit.” Organic, vegan, raw, living foods, smoothies, fresh juices, soups, sandwiches, des-serts, gluten-free options, weekly meal plans, catering, classes, free wi-fi. Making healthy food taste good!

ROOST RESTAURANT220 N. Main St.864-298-2424www.RoostRestaurant.com

New Main Street soil-to-city res-taurant features local, organic, and seasonal foods. Enjoy out-door seating in NOMA Square, open kitchen with counter seat-ing and open-air bar. Open daily

for breakfast, lunch, dinner and Sunday Brunch.

TORTIllA MARIA115 Pelham Rd.864-271-0742www.TortillaMaria.com

O r g a n i c f o o d , t h e way nature i n t e n d e d .

Fresh from the earth, wholesome and beauti-fully prepared entrees. Plenty of yummy, gluten-free and raw food options.

SPARTANBURG

GARNER’S NATURAl FOODS1855 E Main St.Specialty Row at Hillcrest864-585-1021

Garner’s is a local f a m i l y - o w n e d health food store and deli with or-ganic, gluten-free options, and in-door/outdoor seat-ing. Hours: Mon-Fri: 9am to 4pm,

and Sat: 9am-3pm. See ad, page 13.

JASON’S DElI1450 WO Ezell Blvd.864-574-0202www.JasonsDeli.com

S p a r t a n -burg’s favor-ite deli offers gluten-free, vegetarian, vegan and

dairy-free options every day. No high-fructose corn syrup or trans fats are ever in any of our food. Salad bar with many organic choices is also available. See ad, page 20.

TAYLORS

GOOD TO GO5000 Old Spartanburg Rd.Eastgate Village864-244-2733www.Facebook.com/GoodToGoJuiceBar

F e a t u r i n g whole food s m o o t h i e s , juices, well-

ness shots, acai bowls, salads, juice cleanses, and nutritional supplements. All natural, all the time. Your body will thank you.


*COMMUNITY SUPPORTED AGRICULTURE

clEMSON ORGANIc FARMClemson UniversityCalhoun Field Laboratory 190 Field Station Dr, Clemson University864-656-6644 or 864-933-6742www.clemson.edu/sustainableag/(Wed. 3:30-6:30pm Spring to Fall)

GREENBRIER FARMS772 Hester Store Rd. 864-855-9782•Easleywww.GreenbrierFarms.com(Onsite store, Friday’s 1-6pm, May-October)

MINI MIRAclES FARM708 Old Rutherford Rd864-438-7147•Taylorswww.MiniMiraclesFarmSC.com(Tues.11am-7pm, Thurs. & Sat 10am-2pm and by appointment.)

PARSON PRODUcE404-452-4321•Clintonwww.ParsonProduce.com(Sat. Greenville Downtown Market May thru July)(3rd Wed. Earth Market, NoMa Square, 220 N. Main St, Greenville)(May 15- Sept. 18) (Holiday Markets, Nov 23 and Dec 14)

FARMS AND FARM TOURS

BAREFOOT FARMS OF BElTON293 Murphy Rd864-380-2002 or 864-338-0010•Beltonwww.BarefootOrganic.com(Open 9am-7pm Daily)

BElUE FARMS3773 Parris Bridge Rd. 864-578-0446•Boiling Springswww.BelueFarms.com(Open Mon.-Sat.- 8am-6pm)

HAPPy cOW cREAMERy330 McKelvey Rd. 864-243-9699•Pelzerwww.HappyCowCreamery.com(Mon.-Fri. - 9am-7pm, Sat. 9am-5pm)

HURRIcANE cREEK FARMS220 Moores Mill Rd. 864-933-1343•Pelzerwww.HurricaneCreekFarms.com(Thurs.1-6pm, Fri. & Sat. 9am-6pm)

MIlKy WAy FARM 220 Hidden Hills Rd. 864-352-2014•Starr864-617-5911 (Cell)www.SCMilkyWayFarm.com(See website for retail locations or for placing orders to pick-up at delivery locations.)

SPlIT cREEK FARM3806 Centerville Rd864-287-3921•Andersonwww.SplitCreek.com (Open Mon.-Sat. 9am-6pm, Sunday 2-5pm)

TIMBEROcK (@ Hopkins Farm)3717 Fork Shoals Rd.864-907-0529•Simpsonvillewww.TimberockAtHopkinsFarm.com(Saturday Egg Sales)

WAlKER cENTURy FARMS110 Walker Rd.864-226-2668•Andersonwww.WalkerCenturyFarms.com(Roadside market Fri. and Sat. 2-5pm, Opens May 18)

FARMERS’ MARKETS

FOUNTAIN INN FARMERS’ MARKET105 Depot St. 864-275-8801•Fountain Innwww.FountainInn.org/farmers-market1 (Sat. 8am-Noon – June 1- Sept. 28)

HUBcITy FARMERS’ MARKET298 Magnolia St.864-585-0905•Spartanburgwww.HubCityFM.org(Sat. 8am-12pm-May 11-Nov. 9-Train Depot)(Wed. 11am-1pm-June 5-Sept. 25-Morgan Square)

SlOW FOOD UPSTATE EARTH MARKETNoma Square, 220 N. Main St.864-289-0103•Greenvillewww.SlowFoodUpstate.com(3rd Wednesday 3-7pm. May-September)(Holiday Markets, Nov 23 and Dec 14)

WHOlE FOODS lOcAlFARMERS’ MARKET1140 Woodruff Rd. (Whole Foods Market parking lot)864-335-2300•Greenvillewww.WholeFoodsMarket.com/stores/greenville(Tues.10am-2pm, May 7 thru Oct. 1)

local Produce & Farm Tour ResourcesTreat your locavore palate to garden-fresh produce at any of these local markets,

join a cSA*, or visit area farms to see who grows your food and where it comes from.


We all need iodine, yet most of us don’t get enough of it through our diet. A study in

the American Journal of Clinical Nutrition found that iodine deficiency in the developed world has increased fourfold in the past 40 years and now affects nearly three-quarters of all adults. Numerous U.S. practicing physicians quoted widely in the media estimate that the incidence of hypothyroidism in our adult population may be between 30 and 70 percent.

Thus, we can’t efficiently produce the thyroid hormones that serve as chemical messengers triggering nearly every bodily function. The pres-ence or absence of iodine affects our every cell.Be Aware of Hypothyroidism Symptoms

Low thyroid function, or hypothyroidism, is the most recognized and obvious indicator of low iodine intake because the thyroid gland contains more concentrated iodine than other organs.

Symptoms can range from extreme fatigue and weight gain to depression, carpal tunnel syn-drome, high blood pressure, fibrocystic breasts and a variety of skin and hair problems.

Hypothyroidism can further cause infertility, joint pain, heart disease and stroke. Low iodine levels also have been associated with breast and thyroid cancers. In children, insufficient iodine has been strongly linked with mental retardation, deafness, attention deficient and hyperactivity disorder and impaired growth, according to studies by Boston University, China’s Jiao Tong University School of Medicine and France’s National Academy of Medicine. The answer is simple: Taking the right kind of iodine in the right dosage can rebalance thyroid function and restore health to the thyroid and the whole body.

Reasons Behind Iodine DeficiencyRadiation: Almost everyone is routinely exposed to iodine-depleting radiation emitted by cell phones, Wi-Fi, microwave ovens and other electronic devices. Iodized table salt: The human body cannot utilize the iodine added to this product. Low-sodium diets: Failure to use healthy salts to fulfill sodium requirements, plus over-use of zero-nutrient table salt in foods, leads to iodine depletion.Bromine: This toxic chemical overrides iodine’s abilities to nourish the thyroid, adrenal and other hormone-producing glands. A known carcinogen, it is used as an anti-caking ingredient found in almost all baked goods, unless the ingredients specifically cite unbromated flour. Iodine-depleted soils: Due to poor farming techniques, iodine and other minerals in soil have declined, so most foods today are devoid of naturally occurring iodine. Proper iodine supplementation with a high-quality product like Natural Awakenings Detoxified Iodine can prevent harm by protecting the thyroid and other endocrine glands and restoring proper hormone production.

ADVERTORIAL

Natural Iodine SupplementationA Must for Most Americans

Natural Awakenings Detoxifed Iodine is 100 percent natural, raw iodine in an ethyl alcohol solution. We thank all those that are benefiting from this product and enthusiastically telling us their great results. Available only at NAWebstore.com My wife, who suffered from extreme fatigue and other symptoms, saw a dramatic increase in energy after just a few days of taking the natural iodine drops. Now if she misses a day, she’ll end up falling asleep in the middle of the afternoon, like she used to do before taking the iodine. It works! ~ AaronMy doctor told me that I had a hypothyroid condition, prescribed medication and was happy with the follow-up test results, yet I noticed no positive effects on my overall well-being. Within two weeks of using the Natural Awakenings Detoxified Iodine, I had more energy, felt more awake and enjoyed clearer thinking and greater peace of mind. People even comment that I look younger. I am a fan!

~ LarryYour ThyroidNeeds Protection!Natural Awakenings Detoxified Iodine Can Provide the Protection You Need

Almost everyone is routinely exposed to iodine-depleting radiation emitted by cell phones, WI-FI and microwave ovens.

Proper iodine supplementation with a high-quality product like Natural Awakenings DETOXIFIED IODINE can prevent harm by protecting the thyroid and restoring proper hormone production.

Iodine replacement has beenreported to give relief from:• Depression • Weight Gain• Fibromyalgia • Low Energy• Hyperthyroidism • Radiation• Hypothyroidism • Bacteria & Viruses

Don’t delay, order yours today! Available only at: NAWebstore.com

Or call: 888-822-0246$20 for a 4-6 week supply

SPECIAL SHIPPING - $5•up to 8 bottlesWholesale pricing available to stores and practitioners


fi tbody

TREKKING AS PILGRIMAGEA Literal Path to Personal Growth

For more than a millennium, seekers have made spiritual pilgrimages on the Way of St. James, beginning at

their chosen point in Europe, winding westward and ending in the Spanish city of Santiago de Compostela. Today, as portrayed in the 2010 movie, The Way, the core route continues to attract both secular and devout trekkers. It’s fair to say that every pilgrim derives something from the journey, although it’s not always what they expect. Alyssa Machle, a landscape architect in San Francisco, imagined that walking The Way would be a quietly contempla-tive and solitary experience. Instead, she spent weeks bonding with fellow trekkers: an Ohio schoolteacher trying to decide whether to become a Catholic nun, and a German woman in her 30s unsettled by falling in love with her life partner’s best friend, a war veteran in his 70s. “Inevitably, each person had some internal battle that he or she hoped to resolve,” Machle found. “My own ideological shift was about setting aside preconceived ideas about how I would experience the path, and focusing my

energy on the community that I sud-denly was part of.” The diverse goals of the people Machle met on The Way speaks to the power of adventurous treks. From the Bible story of Moses and the Israel-ites crossing the desert for 40 years to young Fellowship of the Ring members hiking across Middle Earth, we like the idea of walking long distances as a way to get in touch with ourselves—and of-ten with something larger. In America, there are as many trails to hike as there are reasons to do it. For Cheryl Strayed, author of the 2012 bestselling memoir, Wild, hiking the Pacifi c Crest Trail at age 26 allowed her innate courage to blossom. A rank novice, she took to the trails solo, griev-ing the early death of her mother, and discovered a new kind of self-reliance. “Every time I heard a sound of un-known origin or felt something horrible cohering in my imagination, I pushed it away,” Strayed relates. “I simply did not let myself become afraid. Fear begets fear. Power begets power. I willed myself to beget power. It wasn’t long

by Sarah Todd

Shop online for this and other natural products at

NAWebstore.comor call: 888-822-0246

Enjoy safe and effective relief from:

• Arthritis Pain • Stiff Joints• Headaches • Cramps• Knee, Neck & Back Pain• Inflammation & Swelling • Tired Sore Muscles

All-naturalingredients include:

• Certified Emu Oil • Aloe Vera• Herbs • Botanical Extracts• Vitamins & Antioxidants• Essential Oils • MSM• Glucosamine & Chondroitin

4-oz Spray Bottle just

$19.95plus $5 shipping for

up to 8 bottles

Powerful, Natural

PainRelief

with Dr. Emu’s Rx for Pain


before I actually wasn’t afraid.” Other people on such journeys are inspired by their love for the envi-ronment, like Zen Buddhist priest and retired psychotherapist Shodo Spring, leader of this year’s Compassionate Earth Walk, a July-through-October protest of our nation’s dependence on fossil fuels. It has engaged a “moving community” of shared prayers, meditation and yoga along the path of the pending Keystone XL pipeline from Hardisty, Alberta, Canada, to Steele City, Nebraska. Spring emphasizes that the walk is intended to connect participants to the land and the people that live on it. “We’re going to small towns,” she says, “where many residents make their live-lihoods from oil. There’s a deep division between such people and our group. But when we listen to each other, that division gets healed.” Activist David Rogner says that long-distance walks don’t just raise awareness of political and social issues—they also give people hope. He spent 25 months walking across the United States in the first coast-to-coast roadside litter pro-gram, Pick Up America. “As we walked and picked up trash, we inspired people to believe there could be change,” he says. His trek gave him hope for his own future, too. He now believes, “If you commit your life to the healing and restoration of community and yourself, you are go-ing to be wholly provided for.” Whatever the purpose, there are

TIPS FOR A LONG TREKby Sarah Todd

Pack light. In long-distance hiking, every ounce counts. Try to make sure every-thing in the backpack has at least two uses: socks that double as mittens or a fleece that transforms into a pillow.

Get in shape. Walk two hours a day in preceding months to help train for lengthy days on foot. Do a few test walks loaded with gear to see what it’s like to carry that amount of weight before hitting the trail.

Prepare for foot care. Expert trekkers smear jelly-like products like Waxelene on their feet before putting on their socks to help prevent blisters. It also

soothes chafing and offers foot relief at the end of a long day’s hike.

Plan meals beforehand. Measure out all the ingredients for a healthy menu plan and put them in lightweight bags

to allow the exact right amount of food needed—no more, no less—for the long haul between provisioning stations (local accessible towns and holding spots for

pre-shipped boxes).

many scenic long-distance walking trails to choose from. The Pacific Crest Trail, from the U.S.-Mexico border in Southern California to the uppermost reaches of Washington State, offers stunning views of the Sierra Nevada and Cascade mountain ranges. The Appa-lachian Trail, which winds 2,200 miles between Georgia and Maine, provides 250 shelters and campsites. In Wiscon-sin, the 1,000-mile Ice Age Trail offers awe-inspiring views of glacial land-

scapes. Starting in North Carolina, the Mountains-to-Sea trail extends from the Great Smoky Mountains to the crystal-blue waters of the Outer Banks. In Mis-souri, the Ozark Trail sweeps through mountains, lush valleys and tumbling waterfalls. Plus, overseas trails await, as well. Sarah Todd is a writer and editor in Brooklyn, NY. Connect at SarahToddInk.com.


Note: Dates are subject to change. Please use contact information to confirm dates and times of events. How to submit: All listings must be received by the 10th of the month prior to publication. Please help by following the format as seen below and email listings to [email protected]. All non-advertiser calendar entries are subject to availability and are $15 per each submission.

calendarofevents

Note: Dates are subject to change. Please use contact information to confirm dates and times of events. How to submit: All listings must be received by the 10th of the month prior to publication. Please help by following the format as seen below and email listings to [email protected]. Non-advertiser calendar entries are subject to availability and are $15 per each submission.

ongoing events

FRIDAY, OCTOBER 4

Hatcher Garden Fall Plant Sale ─ 8am-5pm Oct 4; 9am-1pm Oct 5. Annual sale provides an opportunity for gardeners to purchase a variety of trees, shrubs, perennials, grasses and vines at a great price. Hatcher Garden, 820 John B. White Blvd, Spartanburg. 574-7724.

Kid’s Yoga ─ 3-4pm. Designed for students in grades K-5th. The class will focus on various poses and techniques and will learn through partner work, leading by example, respect, listening, and coopera-tion. $10. Zen Studios, 1040 Fernwood-Glendale Rd. Ste. 58, Spartanburg. 583-3335.

SATURDAY, OCTOBER 5

FALL in the PARK ─ 9am–4pm. Vendors, talent show, dog show, car show, music and entertain-ment for the entire family. “New” Boiling Springs Community Park, 182 Rainbow Lake Rd, Boiling Springs, behind Lowes.

Yin Yoga Workshop ─ 1-3pm. Yin is a type of yoga that activates the major energy channels (meridians), to work on kidney and liver to reduce negative ef-fects of stress, reduce irritation and energize. $20 members/$25 non-members. Zen Studios, 1040 Fernwood-Glendale Rd. Ste. 58, Spartanburg. 583-3335.

MONDAY, OCTOBER 7Dangers of Beauty Products ─ 7-8pm. A class to cover the hidden dangers of our favorite beauty products and an opportunity to sample natural beauty products. $10. Healing Springs, 220 West-gate Mall Dr, Ste. 6, Spartanburg. Must register, 699-9448.

FRIDAY, OCTOBER 11Akashic Records Meetup: “2013 - Gathering Power from Your Past” ─ 7-9pm. An evening of conversation and Q & A. The Namaste Center, 416 S. King St, Hendersonville, NC. Donations, $15. 828-281-0888.

markyourcalendarOCTOBER 11-13

Women’s Weekend Retreat ─ YMCA Camp Greenville, located near Caesar’s Head, SC and Cedar Mountain, NC is hosting a Women’s Retreat. The weekend is an opportunity for re-laxation, rejuvenation and adventure. A variety of physical activities will be offered including waterfall hikes, climbing experiences, zip line, crafts, yoga, massages and more! The weekend ends with a reflective visit to Pretty Place with a breathtaking view of the Appalachian Mountains. For more information, call 836-3291, ext. 108.

mondayYoga Bootcamp ─ 9:15-10:30am. Challenging vinyasa power style class to lengthen and strengthen your entire body. All levels welcome. $10 or $80/10 classes. Chapman Cultural Center, Dance Studio 4 of Ballet, 200 E. St John St, Spartanburg. 612-8333.

Yoga ─ 11am-12pm. Class taught by certified in-structor. Bring your own mat. Inclement weather: class will be held in the Pavilion. $5. Garden of Hope and Healing, Hatcher Garden, 820 John B. White Blvd, Spartanburg. 574-7724.

tuesdayZen Beginnings (Beginners/All Levels) ─ 8:30-9:30am. For the new student or a seasoned yoga student looking to learn alignment and proper tech-nique. $15 for a single drop-in class. Zen Studios, 1040 Fernwood-Glendale Rd, Ste. 58, Spartanburg. 583-3335.

Good Morning Yoga ─ 9–10am. Greet the new day with an all-levels yoga class. $12. Soul Flow Yoga Studio, 2811 Reidville Rd, Ste. 12, Spartanburg. 609-7689.

Home School Elementary Nutrition Class ─ 10-11am. Children (ages K5-5th grade), will explore every system of the body while learning how to best care for it and give it proper nutrition. $125, $25 discount for each additional child, $350 fam-ily max. Healing Springs, 220 Westgate Mall Dr, Spartanburg. 699-9448.

Home School Middle and High School Anatomy Course ─ 11:15am-12:15pm. Students will study every system of the body, becoming familiar with bone structure, all organs, major diseases, prevention how nutrition plays in taking care of our bodies and experiment with recipes and sample super foods. $150, $25 off for each additional child, $400 fam-ily max. Healing Springs, 220 Westgate Mall Dr, Spartanburg. 699-9448.

Pre-Natal Yoga ─ 11:30am-12:30pm. Relax and connect with your baby. $10/class. Spartanburg Regional Center for Women, 101 E. Wood St, Spartanburg. Pre-register. 560-6000.


Festival of Healing and Spiritual Aware-ness ─ Workshops on health and spirituality, exhibitors, retreats, art, music and more. $10/Sat, $8/Sun or $15 weekend pass. Greenville Shrine Club, 119 Beverly Rd, Greenville. 233-3033.


Butterfly Retreat 4 w/Jennifer Lombardi ─ Women’s retreat at North Myrtle Beachoceanfront resort. Wellness seminars and workshops, diet and nutrition, yoga, releasing fears, meditation, painting and wine, fashion and fun, beauty and boudoir photos too! Meals and entertainment. Be empowered, rejuvenated and ready to live your best life. $260 all inclusive, or daily rate. 843-450-0637. TheButterflyRetreat.com.

THURSDAY, OCTOBER 17Hub City Cooperative Open House ─ 5-8pm. Enjoy food, refreshments, and meet local artists while touring the future site of the Hub City Co-op. Free. Hub City Cooperative, 176 N. Liberty St, Spartanburg. 579-2293.

SATURDAY, OCTOBER 12

Dangers of Beauty Products ─ 2-3pm. A class to cover the hidden dangers of our favorite beauty products and an opportunity to sample natural beauty products. $10. Healing Springs, 220 Westgate Mall Dr, Ste. 6, Spartanburg. Must register, 699-9448.


The Seay House Saturday ─ 10am-4pm. Visit Spartanburg’s oldest home, a local farmstead from the 1800s. Free; donations accepted. Spartanburg County Historical Association. 106 Darby Rd, Spar-tanburg. 596-3501.Polarity Share ─ 3-5pm. Learn about Polarity Therapy from Certified Polarity Therapists and dis-cover how it works with the human energy field. $10. Abiada Healing Arts, 187 N. Daniel Morgan Ave, Spartanburg. 542-1123.THURSDAY, OCTOBER 24

2013 “BRA-vo” Event ─ 5-8pm. An “evening of fun” at our 1st Annual “BRA-vo”, Breast Cancer Awareness Event. The “BRA-vo” Event will feature a silent auction, bra decorating contest, delicious food and more. Advanced tickets $5. Boiling Spring Community Park, 182 Rainbow Lake Rd, Boiling Springs. 641-9761.


Free Karma Community Yoga Class ─ 10-11am. Call for details. Free. Zen Studios, 1040 Fernwood-Glendale Rd. Ste. 58, Spartanburg.Spartanburg Cultural Arts Festival ─ 11am-4pm. A day filled with art, culture,dance, drama, music, creativity and more. Free. Chapman Cultural Center. 200 E.St John St, Spartanburg. 542-ARTS. Polarity Share ─ 3-5pm. Learn about Polarity Therapy from Certified Polarity Therapists and dis-cover how it works with the human energy field.$10. Abiada Healing Arts, 187 N. Daniel Morgan Ave, Spartanburg. 542-1123.


communityresourceguideConnecting you to the leaders in natural health-care and green living in our community. To fi nd out how you can be included in the Community Resource Guide, email [email protected] to request our media kit.

ACUPUNCTURE

AcUPUNcTURE SOlUTIONSSimon B. Cairns, L.Ac.220 Freeman Farm Rd.864-848-1548•Duncanwww.AcuSolutionsSC.com

We provide symptom relief while treating the root cause of your health issue. Get results that turn you into an acupuncture advocate. See ad, page 14.

BIO-IDENTICAL HORMONE THERAPY

BAlANcED SOlUTIONS420 The Parkway, Ste. NThe Village at Thornblade888-299-9300•Greerwww.BalancedAgain.com

Don’t accept fatigue, weight gain, depression or low sex drive as NORMAL. Feel great again with Bio-identical Hor-mone Therapy. Complimentary Blood Analysis. ($250 value)

Call today! See ad, inside front cover.

SHERTEcH PHARMAcy1360 Drayton Rd.864-585-3850•Spartanburgwww.ShertechPharmacy.com

We c u s t o m i z e medicines to meet your specifi c needs. Each prescription i s “ m a d e f r o m

scratch.”, including bio-identical hormone replace-ment for women and men, and thyroid medication to suit your body’s needs. We can help you get your body back into balance. Call us today! See ad, page 7.

CHIROPRACTOR HUB cITy HEAlTH STUDIO115 W. Main St.864-583-0300•Spartanburgwww.HubCityHealth.net

With our gentle approach, we offer quality chiroprac-tic care, customized whole-body massage and whole food nutrition programs for the entire family. Same day appointments at affordable

rates. Call and ask us about our monthly wellness plans. See ad, page 21.

AntiGravity Classes ─ 4:30-5:30pm. Discover the power, excitement and pure joy of moving freely in all directions of open space. $15 drop-in. Zen Studios, 1040 Fernwood-Glendale Rd. Ste. 58, Spartanburg. Class size is limited, must pre-register, 583-3335.

Health Boot Camp ─ 6pm. Oct 8-Nov 12. Six weeks of nutrition counseling, workouts, and ac-countability designed to see quick results, and amaz-ing health transformation. $100 for entire session. Call to register. Healing Springs, 220 Westgate Mall Dr, Ste. 6, Spartanburg. 699-9448.

Mixed Level Yoga – Intermediate to Advanced ─ 7:15-8:30pm. Ready to take your practice to the next level? This class is suitable for students with at least two years’ experience who want to explore more advanced poses. $12. YOGAlicious Yoga Studio, 147 E. Main St, Ste. A, Spartanburg. 515-0855.

wednesdayHot Yoga ─ 7:15pm. $12, drop-in. Soul Flow Yoga Studio, 2811 Reidville Rd, Ste. 12, Spartanburg. 609-7689

thursdayGood Morning Yoga ─ 9–10am. See Tuesday 9am listing for details.

Lunchtime Flow Yoga ─ 12:30pm. Soul Flow Yoga Studio. 2811 Reidville Rd, Ste. 12, Spartanburg. 609-7689.

Zen Barre (All Levels) ─ 4:30-5:30pm. Redefi ne and reshape your body with a combination of weights, bands, balls, ballet and a bit of yoga, to challenge your core strength and fl exibility. $15 for a single drop-in class. Zen Studios, 1040 Fernwood-Glendale Rd, Ste. 58, Spartanburg. 583-3335.

Community Yoga ─ 5:45-6:45pm. Donation-based class open to all levels. YOGAlicious Yoga Studio, 147 E. Main St, Ste. A, Spartanburg. 515-0855.

Beekeepers’ Association Meeting ─ 6:30-9pm. Second Thursday. County Administration Bldg, Council Chambers, 366 N. Church St, Spartanburg. 596-2993, ext 117.

friday

Lunchtime Bicycle Ride ─ 12–1pm. Join Partners for Active Living on the weekly lunchtime bicycle ride, open to all levels of riders. Leaving from Mary Black Foundation, 349 E. Main St, Ste. 100, Spar-tanburg. 598-9638.

Jazz on the Square ─ 5:30-8pm. Weekly, live music series. Morgan Square, 108 W. Main St, Spartanburg.

saturday

Saturday Market ─ 8am-12pm. Offering produce, plants and prepared goods. Variety of events includ-ing cooking demos, children’s activities, live music and more. Free admission. Hub City Farmers’ Mar-ket, 298 Magnolia St. at Old Train Depot, Downtown Spartanburg. 585-0905.

Community Yoga ─ 9:30-10:30am. $6 drop in fee. Soul Flow Yoga, 2811 Reidville Rd, Ste. 12, Spartanburg. 609-7689.

Power Zen Flow (Intermediate/Advanced) ─ 10-11:15am. Vinyasa fl ow, power poses and inversions. Class is recommended for students with previous yoga experience, but optional modifi cations will be offered to allow students to fi nd the place that is right for them. $15 for a single drop-in class. Zen Studios, 1040 Fernwood-Glendale Rd, Ste. 58, Spartanburg. 583-3335.

healthbriefsglobalbriefsecotipsgreenlivinghealingwayshealthykids

consciouseatingwisewordsfitbodyinspirationnaturalpet

departmentsthemes

JANUARY health & wellness plus: health coaches

FEBRUARY rethinking heart health plus: stress relief

MARCH food & garden plus: gluten-free foods

APRIL green living plus: healthy home MAY women’s wellness plus: bodywork

JUNE inspired living plus: men’s wellness

JULY food watch plus: natural medicine cabinet

AUGUST transformative education plus: children’s health

SEPTEMBER conscious caretaking plus: yoga

OCTOBER sustainable communities plus: chiropractic and acupuncture

NOVEMBER personal empowerment plus: beauty

DECEMBER awakening humanity plus: holiday themes

healthy


COACHING

SMAll BUSINESS cOAcH ASSOcIATES1000 W. Poinsett St.864-241-0606•Greerwww.SmallBusinessCoach.org

We help small business owners make more $$ and work less. Free 1 hour consultation. Call today!

COMPOUNDING PHARMACY

SHERTEcH PHARMAcy1360 Drayton Rd.864-585-3850•Spartanburgwww.ShertechPharmacy.com

We c u s t o m i z e medicines to meet patients’ specific needs. Each pre-scription is “made

from scratch.” Speak to the pharmacist and tour our facility. Stop by and we’d be happy to answer any questions. See ad, page 7.

DENTISTRY

PAlMER DISTINcTIVE DENTISTRy

Dr. John Palmer134 Milestone Way864-879-6494•Greerwww.PalmerDMD.com

We practice biological dentistry and adhere to the highest stan-dards of biocompati-ble dentistry as de-

fi ned by the (IAOMT) International Academy of Oral Medicine and Toxicology. One-visit-crowns, Laser-Assisted Periodontal Therapy, Ozone Ther-apy, fl uoride-free offi ce; amalgam-safe since 1995. See ad, back cover.

ENERGY THERAPY

AWAKENING ENERGIES, llcMary W. Underwood, MSW, LISW-CP736 E. Main St, Ste. 201864-266-0634•Spartanburgwww.AwakeningEnergies.com

Certifi ed Advanced Integrative Therapist and trained in Emo-tional Freedom Technique, Mary helps people with a host of issues including trauma, addictions, mood disorders, anxiety, and life-altering events. See ad, page 17.

HAIR SALON/SPA

NANcy lEE’S HAIR ARTNancy L. Minix, MC, BS, RA – 20+yrs Exp.

Operating in the Greer area864-320-2359•Greer

More than hair care. Natural/organic/ammonia-free color and products. Formaldehyde-free keratin treatments. Aromathera-py consultations and personal-ized products. ION footbath detox.

HEALTH COACH

HEAlING SPRINGS220 Westgate Mall Dr, Ste. 6864-699-9448•Spartanburgwww.HealingSprings12.com

Begin your journey to wellness. Initial consultation, Ph testing, weigh-in, measurements, health history review and action plan for only $65. Call today! See ad, page 11.

lINDA HOOD, cNHP30+ Years of Wellness Experience864-439-6443•Spartanburgwww.AhaSpirit.com

Specializing in women’s health, stress management and weight loss. New client special: Grocery store tour only $60 for you and a friend. Allow me to coach you towards the life you’ve always dreamed of! See ad, page 12.

HEALTH FOOD STORES

GARNER’S NATURAl FOODS1855 E Main St.Specialty Row at Hillcrest864-585-1021•Spartanburg

Garner’s is a local family-owned health food store and deli with indoor and out-

door seating. We are open 6 days a week 9am to 6pm. See ad, page 13.

HYPNOTHERAPY

GARRISON INTERNATIONAl, llcMichael T. Garrison864-230-3760•[email protected]

Achieve your goals to become healthier, reduce stress, exer-cise, concentrate on your studies and more, all through hypnosis in the comfort of your own home.

MASSAGE/BODYWORK

ABIADA HEAlING ARTS187 N. Daniel Morgan Ave.864-542-1123•Spartanburgwww.AbiadaSpa.com

We put our clients’ needs fi rst and tailor the bodywork to the individual. We use a variety of modalities including massage. Chair massage is also avail-

able at our offi ce or yours. See ad, page 22.

PHYSICAL THERAPY

NEW DAy PHySIcAl THERAPyDavid Taylor, PT, CST, CMT300 N. Main St.864-469-9936•Greerwww.NewDayPhysicalTherapy.com

Patients recover faster by utiliz-ing a combination of conven-tional and alternative therapies. Alternative approaches include CranioSacral, Myofascial, Ves-tibular and Visceral Manipula-tion, drawing on the body’s self-healing properties. See ad, page 22.

PSYCHOTHERAPY

AWAKENING ENERGIES, llcMary W. Underwood, MSW, LISW-CP736 E. Main St, Ste. 201864-266-0634•Spartanburgwww.AwakeningEnergies.com

Mary uses therapeutic methods including Eye Movement Desen-sitization Reprocessing (EMDR) and Emotional Freedom Technique (EFT), which have been shown to help people heal and move to greater peace and contentment. See ad, page 17.

THERMOGRAPHY

THERMAl IMAGING OF THE cAROlINASDr. Lealand FaganMichelle Fagan, CCT900 E. Rutherford St. 864-457-2045•Landrum

Thermography is an FDA ap-proved, non-invasive breast screening with no radiation and no breast compression! It can help to detect very early physiological changes in your body. See ad, page 21.


VETERINARY CARE

ROcKy cREEK VETERINARy HOSPITAl & PET RESORTJudson Powers, DVM111 Ebenezer Rd.864-234-4600•Greerwww.RockyCreekVet.com

Offering compassionate veterinary care, luxury boarding, grooming, dog training, doggie day camp, hypoal-lergenic nutritional supplements and veterinary Rx dog foods (including vegetarian formula), Dr. Judson Pow-ers and his team enjoy helping pet parents in every step of caring for their furry friends. See ad, page 27.

VITAMINS & SUPPLEMENTS

GARNER’S NATURAl FOODS1855 E Main St.Specialty Row at Hillcrest864-585-1021•Spartanburg

Garner’s is a local fami-ly-owned health food store and deli with in-door and outdoor seat-

ing. We are open 6 days a week 9am to 6pm. See ad, page 13.

WHOLE BODY VIBRATION

cIRcUlATION NATION™864-593-8217•Greer864-558-4750•Simpsonvillewww.CirculationNation.com

$49 /mo.

free trainingfree measurements free use of far-infrared saunafree alkaline water

No Contract • No Hidden Fees10% Senior/Student Discount

Become a Member!

Experience Whole Body Vibration!

Discover the vibration sensation that’s sweeping the nation!

10 Minutes = 1 Hour Workout

Decrease cellulite

Massage muscles

Increase muscle strength

Reduce effects of stress

Accelerate weight loss

Improve bone density

Increase metabolism

Prevent muscle loss

Improve circulation

Improve flexibility

Improve mobility

Improve agility

Tone and firm

Low impact

Kind to joints

Our members agree it can help:

get on • get active

PERFECT FOR ALL

AGES!

423 The Parkway @ Publix, Thornblade Center

864-593-8217greenvillesc.gogastudios.com

Goga Studios Greenville2801 Wade Hampton Blvd. #114@ Publix, Hampton Village Center

864-663-1845taylorssc.gogastudios.com

Goga Studios Taylors

Shake your way to better health. Low impact, kind to joints, suit-able for all ages, including se-niors. Hydrate, vibrate, rejuve-nate and try the easiest 10 minute workout you’ll ever do! See ad, page 3.

WHOLISTIC WELLNESS CENTER

ABIADA HEAlING ARTS187 N. Daniel Morgan Ave.864-542-1123•Spartanburgwww.AbiadaSpa.com

We put our clients’ needs fi rst and tailor the bodywork to the indi-vidual. We use a variety of mo-dalities including massage. Chair massage is also available at our offi ce or yours. See ad, page 22.

YOGA/PILATES

ZEN STUDIOS1040 Fernwood-Glendale Rd.Ste. 58864-583-3335•Spartanburgwww.Zen-Studios.com

Eco-friendly studio and Eco-Chic boutique where clients come to have a profound health and well-ness experience with their bodies. In addition to health and wellness classes, Zen Studios also offers workshops and teacher trainings as

well as therapeutic massage, Reiki and acupuncture services. See ad, page 7.

TURN YOUR PASSION INTO A BUSINESS

Own a Natural Awakenings Magazine!

Phenomenal MonthlyCirculation Growth Since 1994.Now with 3.8 Million Monthly Readers in:• Birmingham, AL• Huntsville, AL• Mobile/Baldwin, AL*• Little Rock/Hot Spg., AR*• Phoenix, AZ• Tucson, AZ• East Bay Area, CA• Los Angeles, CA*• San Diego, CA• Denver/Boulder, CO• Fairfield County, CT• Hartford, CT• New Haven/Middlesex, CT• Washington, DC• Daytona/Volusia/Flagler, FL• NWFL Emerald Coast• Ft. Lauderdale, FL• Jacksonville/St. Aug., FL• Melbourne/Vero, FL• Miami & Florida Keys*• Naples/Ft. Myers, FL• North Central FL*• Orlando, FL• Palm Beach, FL• Peace River, FL• Sarasota, FL• Tampa/St. Pete., FL• FL’s Treasure Coast• Atlanta, GA• Western NC/No., GA• Chicago No. Shore, IL• Indianapolis, IN• Lafayette, LA• New Orleans, LA• Baltimore, MD• Boston, MA• Western, MA• Ann Arbor, MI• East Michigan• Grand Rapids, MI• Wayne County, MI• Minneapolis, MN• Asheville, NC*• Charlotte, NC• Triangle, NC• Central, NJ• Hudson County, NJ• Mercer County, NJ• Monmouth/Ocean, NJ• North NJ• North Central NJ• South NJ*• Santa Fe/Abq., NM• Las Vegas, NV• Central NY• Long Island, NY• Manhattan, NY• Rockland/Orange, NY• Westchester/PutnamCo’s.,NY• Central OH• Cincinnati, OH• Oklahoma City, OK• Portland, OR*• Bucks/Montgomery Co’s., PA• Harrisburg, PA• Lancaster, PA• Lehigh Valley, PA• Pocono, PA/Warren Co., NJ• Rhode Island• Charleston, SC• Columbia, SC• Grand Strand, SC*• Greenville, SC*• Chattanooga, TN• Knoxville, TN• Memphis, TN• Nashville, TN*• Austin, TX*• Dallas, TX• Dallas/FWMetro N• Houston, TX*• San Antonio, TX• Richmond, VA• VA’s Blue Ridge• Seattle, WA• Madison, WI*• Milwaukee, WI• Puerto Rico

As a Natural Awakenings publisher, you can enjoy learning about healthy and joyous living while working from your home and earn a good income doing something you love!

No publishing experience is necessary. You’ll work for yourself but not by yourself. We offer a complete training and support

system that allows you to successfully publish your own magazine.

To determine if owning a Natural Awakenings is right for you and your target community, call us for a free consultation at:

239-530-1377NaturalAwakeningsMag.com*Existing magazines for sale

• Low Investment• No Experience Needed• Great Support Team

with Complete Training• Work from Home• Online Marketing Tools• Meaningful New Career

spartanburg final oct 2013

Documents

i t e d t i

e o f f e rcomplimentary

comh e

bioidentical hormones

hormone replacement

n g h e

body chemistry

body dependson