wanaka sun

inside:

PAGE 3

PAGE 16

PAGE 5

Watch our water say guardians

Jet race

Honouring Mandela

Club makes history

Markets galore for region

User pays option for libraryA comprehensive survey of user satisfaction with local libraries has just been published by the Wanaka Public Libraries Association, coinciding with the beginning of another survey on local libraries by the council. PAGE 4

The Wanaka Sun Christmas Food Drive will take to the streets in just under a week, with the emergency services vehicles ready to lead the way from 6pm on Wednesday December 18. PAGE 3

THUR 12.12.13 - WED 18.12.13 WANAKA’S INDEPENDENT NEWSPAPER

Count down to food drive

Caroline Harker

Wanaka Sun

Water quality monitoring could soon be a reality for Lake Wanaka and other lakes in the Upper Clutha catchment. The Guardians of Lake Wanaka (GLW) have a new strategy. They plan to get together with guardians of the other lakes (Hawea, Wakatipu and Hayes) to discuss a joint application for funding to collect data and research water quality in the lakes.

GLW chair Helen Tait said the Central Lakes Trust (CLT) has indicated interest in funding a comprehensive proposal which includes all four lakes. The trust had turned down an application for

funding a water monitoring buoy for Lake Wanaka earlier this year. Helen said while the Wanaka group was primarily interested in getting a water quality monitoring buoy, groups representing other lakes may want funding for other research methods.

She hopes to have a workshop with other lakes’ guardians in January to discuss the application proposal. Guardians of Lake Hawea chair Mike Cotter said the group application is a fantastic idea.

Helen said in the GLW proposal the Lake Wanaka buoy would be owned by the Otago Regional Council and data would be analysed by Otago University research fellow Dr Marc Schallenberg,

who has been supervising PhD students studying land use impacts on Lake Wanaka since 2008.

GLW hosted a seminar on Lake Wanaka water quality in March this year. Speakers included scientists from Waikato and Otago universities and NIWA, specialists from district and regional councils, farmers and some members of the public including Hawea resident former NIWA chief scientist Dr Don Robertson. Don said he would like to see funding for a high level report addressing requirements for management of all southern lakes. This report would include detailed scientific advice on appropriate methods of monitoring (including number and placement

of deep water monitoring buoys, lake bed and water column biodiversity and species mix, measurement of lake and catchment nutrient levels and flows) and recommendations on information necessary for lake management policies, governance and implementation. He told the Wanaka Sun he is concerned none of these steps are in place and an effective management framework is lacking for all southern lakes. Don said that while a single buoy may provide useful data, he is concerned that its purchase would “represent a continuation of an ad hoc piecemeal approach to Lake Wanaka management”.

Story continues page 2...

Follow, tweet and retweet with #gigatownwanaka on Twitter to earn us points.

Go to www.gigatown.co.nz, click join up, register, then go to your email and confirm, then select Wanaka.

supported by:

Six high-powered jet aircraft will be racing around a course marked by giant inflatable pylons at Wanaka Airport next Easter as part of the Warbirds Over Wanaka International 2014 Airshow. The #Gigatown Wanaka Jets - three Aero L-29s, two De Havilland Vampires and an Aero L-39 - will feature three Reno pilots challenging three from New Zealand in the world’s fastest motorsport racing side-by-side over an aerial race track and reaching speeds of around 640kmph. Local pilot Grant Bisset is pictured at the 2012 Warbirds Over Wanaka in the L-39 Albatros.

PHOTO: WANAKA.TV

THURSDAY 12.12.13 - WEDNESDAY 18.12.13PAGE 2

sunnews

Laura WiLLiamson

Wanaka sun

According to the Otago Regional Council (ORC), all Otago irrigators should prepare for potential water rationing, as warm and dry weather reduces the flows in all Otago rivers.ORC manager environmental services Martin King said without substantial rainfall soon there may be a need for rationing to begin by late December or early January.“All rivers except the Clutha/Mata-Au are falling towards minimum flow levels. The Manuherikia is very low, and even the Clutha is below the level we expect for this time of the year,” Martin said.The Kakanui, Shag, Taieri, Manuherikia, and Pomahaka rivers are at low levels not usually seen until late summer.“Farmers should be managing their irrigation very efficiently, and planning ahead in case the need for rationing arises,” he said.

Prepare for low river flow conditions

Junior students recognised

staff reporter

Wanaka sun

PHOTO: WANAKA.TV

PHOTO: SUPPLIED

Watch our water

Pass to close early

Following on from the success of the Senior Prizegiving a week before, junior students at Mount Aspiring College had their chance to shine last Fr iday evening at the school’s Junior Prizegiving.

Awards were given out to the highest achievers in Years 7 through 9, and for

the highest achievement in each subject area. S t u d e n t s w e r e a l s o recognised for sports and national achievements, and received cultural awards.

MAC Principal Wayne B o s l e y s a i d h e w a s impressed with the high level of achievement in the junior school, and with the diversity of areas in which pupils were succeeding. He

said the highlight of the prizegiving for him was the variety of student performances in areas from dance to jazz to rock.

“The young students were brilliant and we know that we will look forward to many more terrific performances in the years to come. They are a credit to their families and our music department,” he said.

The ceremony opened

with the college haka, led from the stage with all students and staff taking part. Musical items included the MAC Ukulele Orchestra giving their take on Bruno Mars’ ‘Count On Me’, the Mount Aspiring Big Band playing the Peter Gunn theme, and the Year 9 band raising the roof with a rendition of The Black Key’s ‘Little Black Submarines’.

State Highway 6 through the Haast Pass will close early today (Thursday December 12) to remove the temporary steel plates and bridge the boxed culvert at the Diana Falls slip site.

N Z T A ’ s S e n i o r Network Manager Mark Pinner said the work will enable the road through the slip site to be resealed early next week and minimise

the need to continually clean the culvert. The road will be closed at the Haast township at 4pm, and at 4.30pm at Makarora, today, re-opening at 9am at Haast township, and 9.30am at Makarora, tomorrow.

“Resealing the road, which was damaged in September when 40,000 tonnes of boulders, rock and material fell onto the road, will also improve access for all road users travelling through the

area,” he said. “We have worked hard to minimise the delays for all road users. Much of the work to date in removing rocks and repairing the road has been managed with short 20-minute delays throughout the day.”

Mark said the NZTA apologises for any i n c o n v e n i e n c e t o road users as a result of the early closure and late opening and said the work will take about six hours to complete.

... Continued from page 1

Helen said the guardians’ current priority is to get a buoy in place as soon as possible. “We know the quality of the lake water is currently very good, but it is changing.” She said the lake would need to be monitored for several years before they could reach any conclusions about trends.

Scientists and lake guardians generally agree it is critical to address concerns regarding lake deterioration before major problems occur, rather than trying to m o u n t a r e c o v e r y operation.

“Case studies of Lake Taupo and the Rotorua lakes were very valuable in providing examples of the cost and difficulty of recovery operations,

as well as examples of co-operative planning and management, with strong community input,” Helen said.

After the seminar in March, GLW published a report which said protecting the quality o f L a k e W a n a k a w o u l d d e p e n d o n the establishment of community endorsed goals, extensive and continuous monitoring, a n d c o - o p e r a t i v e oversight, involving all relevant agencies.

The Guardians of Lake

Wanaka are appointed b y t h e M i n i s t e r o f Conservation under the Lake Wanaka Preservation Act. Their role is to advise

on “preserving, as far as possible, the water levels of the lake and its shoreline in their natural state, and maintaining and, as far as possible, improving the quality of water in the lake”.

The Guardians of Lake Hawea are elected members of the public, under the auspices of the Hawea Community Association.

Case studies of Lake Taupo and the Rotorua lakes

were very valuable in providing examples of the cost and difficulty of recovery operations.

THURSDAY 12.12.13 - WEDNESDAY 18.12.13 PAGE 3

sunnews

Laura WiLLiamson

Wanaka sun

PHOTO: WANAKA.TV

PHOTO: NIKKI HEATH

Count down to food drive

Honouring Mandela

Three crashes in two hours

Wanaka remained firmly in the lead of the Gigatown competition yesterday, cracking the 500,000 mark, which put us more than 200,000 points ahead of second-placed Oamaru. The town remained well out in front despite failing to place in the ‘Supporters’ W o r l d P r o m o t i o n ’ competition last weekend, which awarded 25,000 points to the town that

was able to sign up the most new email addresses from December 5 through 7. Dunedin won the bonus points, with Blenheim and Masterton taking out second and third.

Meanwhile, organisers behind the Gigatown Wanaka campaign were this week clarifying the rules around spam in the competit ion, specifically regarding Twitter. According to ChorusNZ, only four re-tweets would be counted

for each original tweet posted on the social media site, meaning multiple re-tweeting of the #gigatownwanaka hashtag is no longer an effective way to gain points for Wanaka. As well, only Facebook posts and comments on the official Gigatown Wanaka Facebook page would be counted, so Wanaka supporters should head there to leave their #gigatownwanaka hashtags.

Gigatown update

Nelson Mandela, who was elected South Africa’s first black president after spending nearly three decades in prison, died in Johannesburg on Thursday December 5, aged 95. Deputy Mayor Lyal Cocks is pictured lowering the New Zealand flag at the Wanaka Cenotaph to half-mast in honour of Nelson Mandela.

The Wanaka Sun Christmas Food Drive will take to the streets in just under week, with the emergency services vehicles ready to lead the way from 6pm on Wednesday December 18.

Now in its sixth year, the annual event, made possible with the help of volunteers, local groups and local emergency s e r v i c e s p e r s o n n e l ,

replenishes the local food bank as well as providing hampers of Christmas goodies and basic food stuffs to make the holidays a little easier for local families in need. There will also be presents to open on Christmas day thanks to a draw being run by Active Massage. Anybody who brings a new toy to Active Massage before December 18 will go into the draw to win three one-hour massages,

with all the toys gifted to Community Networks to be distributed.

T h e W a n a k a S u n Christmas Food Drive will be collecting from Wanaka, Mount Barker Road, Lake Hawea, Cardona, Hawea Flat, Albert Town and Luggate. Volunteers should meet at 5.45pm at the Mount Aspiring College gym. Contact organiser Nikki Heath (027 2467835) with any enquiries.

Cromwell Police attended three vehicle collisions on Sunday December 8.

A 3 4 - y e a r - o l d Queenstown man lost control of his vehicle, ending up down a bank off State Highway 6 in the Kawarau Gorge, at about 4pm. He was transported to the Cromwell Medical Centre by ambulance with whiplash and will appear in the Alexandra District Court charged with dangerous driving.

A 43-year-old Wanaka man was taken to Dunstan Hospital for observation after he crossed the centre line on State Highway 8B and collided with an oncoming vehicle at 5.20pm. The driver of the

other vehicle was unhurt. Also at 5 .20pm, a

29-year-old American male drove on the wrong side of the road on State Highway 6 near the Goldfields

Mining Centre and collided head-on with an oncoming vehicle. A 24-year-old Queenstown woman in the other vehicle was transported to Invercargill Hospital with a broken sternum and a broken rib. The man has been charged with dangerous driving causing injury.

Sergeant Simon Paget of the Cromwell Police said

this was the second crash in two weeks involving tourists driving on the wrong side of the road. On November 30 another American man drove on

the wrong side of the road and collided head-on with another vehicle. No one was injured.

“Of real concern is the fact that all of these crashes involved drivers crossing the centre line into the path of oncoming traffic,” he said. “We are very fortunate in that no one was killed in these collisions.”

staff reporter

Wanaka sun

staff reporter

Wanaka sun

We are very fortunate in that no one was

killed in these collisions.


sunnews

A senior mathematics lecturer from the University of Canterbury is speaking tonight as the last presenter of the Royal Society of New Zealand’s 10x10 series, which brought ten speakers to ten locations over ten months. Dr Mike Plank will deliver a lecture on ‘The mathematics of 7 billion’, in which he discusses how a new mathematical approach may help resolve the ecological and socioeconomic problems facing the global fishing industry and the individuals who rely on it. Almost half of the world’s seven billion inhabitants rely on fish as an important source of dietary protein, yet 90 percent of commercial fish stocks are classed as fully-exploited or over-exploited.

Fishy maths

User pays option for library

Students share profits and Xmas cheer

Singers’ showcase

One junior class from Mount Aspiring College has raised $1010 for the Wanaka Christmas tree fund. Students from Lesley Baynes’ Year 8 class gave all the proceeds from their Trade Day to the fund, which, under the management of local “Christmas fairy’’ Jen Anderson, will finance a new Christmas tree for Wanaka next year.

Lesley said the students held the Trade Day as part of a Social Studies unit on the economic world, in which the class studied topics such as consumers

and legislation. She said she gave each student a choice as to whether they wanted to give their profits to the fund. The class unanimously agreed to participate. “Their community-minded spirit blew me away,” Lesley said.

Close to $400 dollars was raised on the day itself, with a further $600 coming from donations from the community, including friends and family of the pupils. The final $10 came from another Year 8 class, who offered to give their schoolmates the tax money from their Trade Day—perhaps the squabbling members of the United Nations could learn from their generosity.

Laura WiLLiamson

Wanaka sun

PHOTO: SUPPLIED

A comprehensive survey of user satisfaction with local libraries has just been published by the Wanaka Public Libraries Association (WPLA), coinciding with the beginning of another survey on local libraries by the council.

WPLA surveyor Jan Janata said, while the WPLA survey was a ‘slice in time’, the QLDC survey is looking to the future. One of the issues the QLDC survey raises is the possibility of a user-pays policy.

“I am very concerned at the idea of paying a substantial amount to use the library over and above rates, because it cuts out low

income people,” Jan said. “Libraries have been part of communities for more than 3000 years. In all my research I have never come across a library where members have to pay.”

Jan said the WPLA conducted its own survey because members felt it was important to establish a baseline of information prior to changes being made at the libraries as part of the QLDC organisation review. (The main change has been substantial cuts in staff numbers.) WPLA conducted its survey in August, and will do another in August next year.

“We received an amazing number of responses to the survey in a short period of time,” Jan said.

They survey found ‘98 percent of respondents agree or strongly agree the library is important and an integral part of the town and larger community ... [and] experienced trained librarians with their extensive local knowledge are a precious and valued community asset.’

“People said they enjoyed the help they got from the librarians, especially with ebooks and the internet, with historical and local information and in the children’s books area,” Jan said. Issues identified which need to be reviewed by council include opening hours, internet usage and parking.

Jan said she welcomed the QLDC

survey. “The more information the review team has the better,” she said. QLDC has employed consultant Sue Sutherland as part of the survey team. Her previous roles included Acting Chief Executive and National Librarian for the National Library of New Zealand, and Libraries Manager for the Christchurch City Council.

“We had a very positive meeting with Sue Sutherland,” Jan said. “She is an amazing woman, very knowledgeable and experienced with a passion for libraries.”

People can take the QLDC survey online or collect hard copies from local libraries. They can contact WPLA via Facebook to request the full report.

Twenty singing students had two nights in the spotlight this week when they performed to sell-out crowds at the Albert Town Tavern. A Night in the Spotlight featured students of vocal tutor Jenn Shelton (Pictured, centre) singing covers of artists from Freddy Mercury to Whitney Houston. A highlight was Bohemian Rhapsody in eight parts. “I like

students who are passionate about wanting to sing,” Jenn said. “They were wonderful.”

Jenn recently performed in front of 20,000 people at Highlands Motorsport Park and 100,000 at Christmas in the Park in Christchurch. “It’s important for my students to see me out there doing it,” she said. “Performing is my real craft. Teaching and passing on what I am learning and what I have been taught is just a bonus.”

CaroLine Harker

Wanaka sun

CaroLine Harker

Wanaka sun


sunnews

inbriefCaroline Harker

Wanaka Sun

Singers’ showcase

House tour raises funds for climbersA cheque was presented to the Cliffhangers Club last week from the Alpha Club Inc who raised $5200 with its October house tour.The Alpha Club is also donating a trophy cup to the club for the “Most Improved Junior” climber. President Heather Malcolm said the club was thankful for the “Wanaka and Hawea residents who willingly open up their homes to allow our house tour to take place on a yearly basis and to the local residents who support us with these fundraisers.”

PHOTO: WANAKA.TV

Markets galore for region

The Upper Clutha may soon have two regular Sunday markets selling local produce and arts and crafts.

The regular Wanaka F a r m e r s M a r k e t i s trialling a change from Thursdays to Sundays, and a group of Cardrona residents is trialling new Cardrona Village Markets f o r s e v e n S u n d a y s starting on January 5.

Neither group was aware of the other’s intentions, however s p o k e s p e o p l e f r o m both said they feel the district would benefit f r o m h a v i n g t w o Sunday markets.

W a n a k a F a r m e r s M a r k e t c o m m i t t e e member Lorne Knight s a i d t h e c h a n g e t o Sundays means the produce market will be alongside the regular craft market run by Susan Manson on Pembroke Park. He said if more locals patronise the Sunday market they wil l change the day permanently. “We would like to do what the market was established to do – namely provide local food and produce to local

people,” he said. While the Wanaka Farmers Market has been well patronised by tourists, stallholders would like to see a lot more regular local customers, he said. There is also room for more local stallholders. Stallholder Frankie Dean said people can run a stall for $5, or join a community stall if they have just a small surplus of produce they would like to sell.

The Wanaka Farmers’ Market will continue to run on Pembroke Park on Thursdays, as well as Sundays, for the rest of December starting at the

earlier time of 3pm to attract parents picking up their children after school. There will also be a special Farmers Market on Boxing Day from 10am until 2pm.

The new Cardrona Village Markets is the brainchild of Abby Lynne and her husband Dave who have just moved b a c k t o t h e U p p e r Clutha after six years in Melbourne.

Abby said they have a lot of interest from Cardrona locals. The market will have fresh food and produce as well as arts and crafts. There are also plans for

live music, and juice and coffee stalls, and community groups are offering face painting and pony rides. The Cardrona Village Markets will be held by the river on part of Abby’s mother K a t h y B r o o k l a n d ’ s d e v e l o p m e n t s i t e opposite the hotel. It will run from 10am until 3pm for a seven week trial period. Abby said she is busy taking applications f r o m s t a l l h o l d e r s . “Markets are the way o f t h e f u t u r e , ” s h e said. “They are getting more and more popular a l l a r o u n d the world.”


sunnews

Laura WiLLiamson

Wanaka sun

Funding for community facilities

Street improvements

Late night shopping

The Central Lakes Trust latest grants approval, totalling $1,551,931, benefitted several community facilities. Significant grants were received by Coastguard Queenstown ($250,000) to construct a Marine Rescue Operations Centre and boat ramp in Frankton; Arrowtown Community & Sports Centre ($600,000) to assist with the construction of a multi-use community facility in Jack Reid Park; Cromwell Squash Club ($80,000) to upgrade its facility to meet current community needs; and Wanaka Community House Charitable Trust ($195,970) to assist with the pre-construction phase that includes architectural and professional services, planning and consents.

The work being carried out on upper Ardmore Street will create a safer environment for pedestrians by narrowing the roadway, making it easier and safer for pedestrians to cross the road, according to QLDC. The first four “build-outs” between Little Street to the Ardmore – Brownston streets roundabout will be finished by December 20, with two more on either side of Little Street built after January 26.QLDC General Manager – Infrastructure and Assets Erik Barnes said the new layout would not reduce the number of parks available outside the Post Office. “We have fielded some queries from people concerned about the number of car parks,” he said. “There will be nine parks including the mobility park, which will now be on the uphill side of the build-out in front of the Post Office.”

For those who have yet to do their Christmas shopping, Wanaka retailers are opening late next Tuesday, December 17. In the centre of town, retailers will be embracing the Christmas spirit with a street party, promotions, Santa, singing, face-painting and food stalls. Retail outlets will be open until 8pm.

A local Wanaka school leaver who has received a $5000 scholarship from the Masonic Lodge will use the money to help fund a volunteer trip to Thailand next year.

Mount Aspiring College student Ellie Greenwood won the second annual Wanaka Masonic Lodge Scholarship, and is planning to spend six weeks next year at the Thai Freedom House in Chiang Mai, Thailand, teaching English. She is also hoping to set up a weekly drama workshop for children at the Freedom House Learning Centre.

Wanaka Masonic Lodge representative Gordon Girvan, who was on the selection panel, said it had been “extremely difficult” to choose this year’s winner, due to the high standard of the 19 applications received. Selectors were not just looking for high academic achievement, but for young people who were strong all-rounders, Gordon said. Ellie had demonstrated both. While there were no strings attached to the money, Gordon said service to the community was the sort of thing they hoped the funds would be used for, and Ellie would be “an excellent ambassador.”

Bound for Thailand

PHOTO: SUPPLIED

Wanaka-based MayJer M i c r o G r e e n s h a s come up with a great Christmas gift idea – a deluxe microgreens home-growing k i t c o m p l e t e w i t h biodegradable trays, organic soil mix, 4 or 8 seed packs of your choice and a spray bottle, all packed in a gift box. You can c h o o s e y o u r o w n seeds from 7 options including red cabbage, kale, peas and pak choi, pepper cress, radish and rocket. Microgreens are tiny plants , only a few w e e k s o l d , w h i c h have a more intense f l a v o u r t h a n t h e i r grown counterparts, and up to 40 times

the nutrients. This m a k e s t h e m b o t h tasty and heal thy, a n d c h e f s a r o u n d the world love them for garnishing their culinary creations.MayJer MicroGreens is owned by Maya and Jerry Novak Sever. T h e y g r o w f r e s h m i c r o g r e e n s , y e a r round, selling them at farmers’ markets and direct to local chefs. You can take advantage of their Christmas Specials when buying these kits at the Wanaka Farmers’ Market and t h e R e m a r k a b l e s Market in Queenstown, or visit the company w e b s i t e w w w .mayjermicrogreens.co.nz and order online.

Microgreens for Christmas

*ADVERTORIAL


A n e w p r o g r a m m e of research into the production of lower calorie and lower alcohol “lifestyle” wines could b e n e f i t t h e C e n t r a l Otago wine industry, according to Central Otago Winegrowers’ Association president James Dicey. “I’m hugely excited about it,” he said, adding that the initiative could provide b o t h a b u s i n e s s e s opportunity for the local industry and a chance to showcase the region’s sustainable practices.

He said, currently, lower alcohol wines are produced using one of two methods. Grapes could be picked earlier while sugars were still lower, but this potentially could affect flavour as some flavour components did not develop until a certain phase in berry development. The other process was a “very

industrial” approach in which some of the alcohol was stripped out through reverse osmosis. This too could alter flavour and balance.

R e d u c i n g a l c o h o l content through natural p r o c e s s e s , s u c h a s vineyard practices which brought out flavours in grapes earlier, would give local wines a point of dif ference in the growing global market for

“lifestyle” wines, James explained. According to James, the goal would be to produce wines with an alcohol content of 12 to 13 percent, instead of Central Otago’s standard 14 to 14.5 percent, while retaining the “great flavour and intensity t h a t o u r r e g i o n i s renowned for.”

Most current lower alcohol wines are whites such as Sauvignon Blanc

and Pinot Gris, but lighter reds such as Pinot Noir would work well too, an advantage for Central Otago, where 76 percent of the vineyards are planted in Pinot Noir.

A n i n v e s t m e n t o f $ 1 6 . 9 7 m i l l i o n h a s been secured for the programme, which is the largest research and development project ever undertaken by the wine industry.

Laura WiLLiamson

Wanaka sun

sunnews

The Wanaka Sun has two GA tickets to give away for the Rhythm & Alps music festival in the Cardrona Valley. Two-Day GA tickets are now sold out, but Two Day GA + Camping passes are still available and Day Tickets are now on sale. As well, the option to upgrade to the Vodafone Vintage Club VIP area exists for both new purchases and existing tickets. For those needing transport, Wanaka taxi company Yello is offering trips to and from the site—book in advance to secure your ride. To go into the draw, email [email protected] and tell us which performer you’re most excited about seeing this year at R&A or enter online on our Facebook page.

P 03 443 5252

E [email protected]

or [email protected]

advertise in the

Ever wonder what separates those that can from those that can’t? Many wonder why it never quite happens for them, whilst there are a few who celebrate how often it does. “I help people realise how good they could be. Together, we look forward and ask ‘What next?’, leaving others to look back and wonder ‘What if?’ Together we embrace change. Together we make change.”

Jodie is a qualified NLP Coach. NLP is like being given the manual for your brain. It has been called the software for the mind, and it’s easy to see why.

It is an extraordinary a n d c u t t i n g - e d g e a p p r o a c h t o h u m a n communication and the development of your thinking. This remarkable set of tools is based on the amazing discovery that in changing HOW you think can change WHAT you think - and in changing how and what you think, you can dramatically transform the results you create in your life.

You can el iminate unwanted habits, transform negative emotions into positive feelings, improve the way you see yourself, enhance your self-esteem and become the person you want to be. It has a lso been proven in business, relationships,

sports, health & fitness, and therapy to name but a few.

Many people wait until they are older before they discover the ability to make these changes “I had been living my entire life with the belief that I wasn’t good enough, it reflected on my every day life from employment to relationships. One session with Jodie and I was able to eliminate that belief and install a much more resourceful one. It is like seeing through new eyes, my whole world has changed, the opportunities

seem endless. Thank you Jodie, I wish I had done this years ago” Wanaka, 2013.

L i f e i s a g a m e o f choices. If you already know everything you need to know, if you believe there’s little room for improvement, Jodie is probably not right for you just now. However if you think you, your team or organisation could perform even better and you’re curious to learn h o w p r e p a r i n g a n d performing like the elite might help, you should get together.

*ADVERTORIAL

Life is a game of choices

Jodie Rainsford, Your life, live it | [email protected] | 021 356 343

and none of the guilt All of the flavour

Rhythm & Alps ticketgiveawayticketgiveaway

PHOTO: WANAKA.TV


sunnews

New learning network live at MAC

M o u n t A s p i r i n g C o l l e g e i s benefitting from a new government initiative to provide equitable and uncapped internet access for schools. The college was chosen as one of 21 schools to be connected to the Network for Learning (N4L) this year, and is one of the first three schools to go live with the system.

A crown-owned company, N4L will provide centrally-managed access to the web delivered over a mix of ultra-fast, rural and remote broadband. Schools will no longer have to manage their own internet

connections and will have uncapped data allowances.

According to MAC IT manager Tim Harper, there was an urgent need for such a programme in today’s educational environment. Young people now lived and learned in a wired world, and it was no longer feasible for schools to operate with capped data allowances. Continual access to online learning tools and the web’s unlimited information were crucial in modern classrooms, especially at a school like MAC, which was New Zealand’s most remote secondary school. “We have to take virtual field trips to just about everywhere,” he said.

He added that schools now did much of their government-required administration online as well.

N4L would also save the college money. The cost of internet access for the school had peaked at $1200 per month before fibre. Under N4L, it would cost nothing.

Tim said, so far, the system was “brilliant”, with the school chewing through 40GB in the first two days after going live with N4L. This was during a time of year when only Year 7 to 10 students were present, with seniors away on exam leave.

A total of 700 schools will be connected to N4L by the end 2014, with all schools to be included by the close of 2016.

Laura WiLLiamson

Wanaka sun

Up in smoke

PHOTO: SUPPLIED

The Wanaka Fire Brigade was called to extinguish this vehicle blaze on Sargood Drive yesterday afternoon. According to Deputy Chief Fire Officer Garth Campbell, the alarm was raised at approximately 4.30pm. The cause of the fire was unknown, though it appeared to have started in the engine bay. It took about ten minutes to put out the fire and the car was not drivable after the incident, Garth said.


sunnews

Dealing with cyber bullying

Welcome to a column that provides a forum to address issues relevant to the well-being of our community, including youth and their families.

youthmatters

Last week Karla Sanders and her team of students presented ‘Onlife’ events t h r o u g h o u t C e n t r a l Otago. These events were a chance to ask questions and gather information about cyber b u l l y i n g a n d b e i n g positive online.

M a n y t i p s w e r e shared with parents and their teenagers on cyber safety, including: Reinforce the public nature of the internet; Your teenager is more likely to follow the rules when you let them know you will be monitoring and supervising their online activity; Limit the amount of time spent online (recent guidelines suggest a limit of two hours); Use filtering

software; Know their screen names, the friends they communicate with online and the sites they visit; Discuss and promote online responsibility, at all times offer good communication skills and respect as would be expected in the real world; Be aware of your teenagers’ behaviour after using the internet or phone. This might involve subtle comments or changes in relationships with friends; Encourage your teenager to talk and ask for support should they become the victim of a cyberbully; Report any online bullying to the social network site, and contact the police when serious threats are made, particularly if they

include violence.

In summary: Parents - Understand h o w t h e i n t e r n e t works; Teach safety and responsibility.

Friends - Don’t stay si lent; Do help your friend - report the bully, tell your parents, tell your teacher.

With the bully - Don’t respond; Do save what they say, unfriend the person, block them, tell a friend, tell your p a r e n t s , r e p o r t t h e person.

Information courtesy of ‘Generation Next Blog’, ‘Cyberbullying – Vanessa Rogers’ and ‘Safebook’.

Taiwan tariff

This Friday (December 13) muscle cars will descend on Cromwell for the penultimate round of the seven-race DHL Saloon Speedweek (7pm, Central Motor Speedway).Twenty-two of the country’s top speedway saloon drivers will be competing including South Island champion Cromwell’s Daryl Ainsley (pictured) and Tiger Woods’ former caddie Steve Williams. There will be a demolition derby and support classes including adult and youth ministocks, stockcars, production saloons and six shooters. After last weekend’s racing, three of five Central Motor Speedway contracted drivers, including two Cromwell locals, are in the top ten of the DHL Saloon Speedweek. The Wanaka Sun has one family pass to give away to tomorrow’s event to the first person who emails their contact details to [email protected] or gets in touch via Facebook. The family pass must be collected from the Wanaka Sun office in Spencer House Mall before 4pm Friday.

Cromwell speedwayticketgiveawayticketgiveaway

New Zealand’s latest free trade agreement with Taiwan is good news for Central Otago fruit and wine growers. The new tariff-free agreement will see the removal of tariffs from milk powder, cheese, butter, apple, cherry and wine exports. Taiwan is New Zealand’s largest market for cherries, which have been subject to a 7.5 percent tariff in the past. New Zealand now has free trade agreements with China, signed in 2008, and an economic partnership agreement with Hong Kong, signed in 2010.

PHOTO: WANAKA.TV

PHOTO: SUPPLIED


sunnews

New look for ArdmoreWith the car park at 123 Ardmore Street currently being converted into a pedestrian area, the last of the new tenants to establish itself between Black Peak Gelato and Alice Hair has settled in. Vodafone opened today in its new location beside Cakes of Wanaka and Sotheby’s Real Estate who have both recently moved to the lakefront address.Store Manager Tasha Jones (pictured) said the new store has been designed “to empower Wanaka residents to use the power of Supernet to work where they are rather than be tied to the office. We will showcase live handsets, more service and more advice to all of our customers in this great new location.”

inbriefInternational film prize for DaisyDaisy Thor-Poet has had a big week. First she flew to Paris for three days as a finalist in the Panasonic Kid Witness News filmmaking competition. Then she won. Then she appeared on both Campbell Live and TV3’s Firstline. Then, yesterday, she was the guest of honour at a special assembly at Mount Aspiring College, where she was greeted by a stirring full-school haka. Then she was whisked away to answer questions for the Wanaka Sun.

If her success in film-making so far is an indication of things to come, Daisy will have to get used to weeks like these. Her short film, ‘Forever Emily’, which tells the story of a teenage girl dealing with loss, was chosen from 650 entries from 28 countries and was shortlisted alongside six other films from China, Germany, Japan, Malaysia and Russia. The judges praised her attention to detail and careful framing, and for creating a work that would “resonate with anyone who has experienced grief.”

The 15-year-old, who cites Jane Campion as an influence, came up with her concept for the film after watching her family deal with the death of her uncle. “I

observed the emotions of grief and tried to put them inside a teenage mind,” she said. In the film, writing helps the main character work through her pain, an idea Daisy read about on the website of her uncle’s favourite author, Louise L Hay.

Daisy’s sister Ming, 13, (pictured left, with Daisy and co-star Katherine Millis) starred in the film and joined her sibling on the

“amazing” trip to Paris, which included a tour of Versailles, a boat cruise on the Seine and a late-night visit to the Eiffel Tower. She said her sister was a good director to work with. “She explains what we need to do, and always makes it fun,” she said.

The Thor-Poet girls were joined at the school assembly by younger sisters Persia, 11, and Aria, 8, as well as mum Vicki

Fraser, who said she was “bursting with pride”.

Daisy has been involved with the Kid Witness News competition since she was 12, when she made her first film, ‘Giving Back’, for the contest. Her most recent work, ‘Searching for Summer’ is a regional finalist in next year’s competition, and she will be travelling to Bangkok, Thailand in January for the judging.

Laura WiLLiamson

Wanaka sun

PHOTO: JESSICA HOGAN


Junior World Cup quarter finals

Disc golf

Mountain goat

sunnews

IPC Nor-Am races underway

Wanaka-based adaptive skiers Adam Hall (pictured) and Corey Peters competed in the first International Paralympic Committee North America Cup (Nor-Am) races of the Northern Hemisphere s e a s o n i n C o p p e r Mountain, Colorado, USA on Saturday. On a steep and fast course in tough, cold conditions, Adam placed third and sit-skier Corey finished tenth.

On Sunday, Adam was the first standing athlete to race in the finals of the super-G on day two of the IPC Nor-Am Cup races. He finished seven seconds faster than the previous day to win silver.

“[It] was an extremely fast course and bitterly cold,” Adam said. “I am extremely happy with my performance over the last two super-G races. With such a world class field it’s

been a good measurement of where we are heading into the rest of the season. It’s very exciting as we will go away and continue to work hard on progressing my super-G even more.”

Corey crashed because

of equipment failure - his outrigger snapped due to the cold. Corey raced the following day in the Giant Slalom. The results were not available at the t i m e o f g o i n g to print.

Staff RepoRteR

Wanaka Sun

The Junior Black Sticks Men have qualified for the quarter finals of the Junior World Cup in New Delhi. Hawea Flat forward Jeremy Morris is the one of four Southern players on the 30-man squad who beat South Africa 1-0 earlier this week to progress in the tournament.“We only had 15 players to rotate onto the field, and even some of those players were recovering from being sick overnight, so it made getting a win that much tougher,” head coach Grant Edwards said.The win placed them second to Malaysia in Pool D.

Robyn Agnew and Jes Guy of Team Awesome won the women’s doubles category in Disc Golf Wanaka’s Sunday competition at Lismore Park with 46 (11 under par). The course record was broken in the men’s doubles, with 37 (20 under par), scored by both local teams Hazen Simson and Dom Hayden, and Martin Galley paired with Aucklander Brad Muir. The winner, Martin and Brad, was decided with the closest to the pin on the play-off hole. Martin also won the men’s singles category.

Local athlete Jess Simson won the Open Goat division of the Goat Alpine Adventure Run in Tongariro National Park. The 21km alpine run traversing the side of Mount Ruapehu begins with a series of eight wave-starts based on competitors’ previous run-times. According to organisers, “the staggered start is necessary to preserve and protect the pristine environment of the Tongariro National Park and ease congestion”.


Appalled about drug bust

I was appalled to see in the paper of a drug bust in our town.They need life imprisonment. How many lives have they ruined and how many people have they killed? They don’t need bail, they need the stocks up and publicly humiliated. We don’t want you or the likes of you in our town.You are killers of youth.

Shir Ironside.

sunviews

TXT MESSAGE

BOARD

021 986 786 021 986 786 TXT THE WANAKA SUNTXT THE WANAKA SUN

WHY DID A NEWLY ELECTED COUNCILLOR KEEP SILENT IN THE PRE-ELECTION ADDRESS ABOUT THE ROWING BOAT COMPLEX BEING LOCATED ON OUR LAKE FRONT AND NOW IS A FERVENT SUPPORTER OF IT BEING BUILT THERE?

HAPPY BIRTHDAY LOVELY JULIE JULES, BIG SQUIDGY HUGS FROM AUNTIE AND UNCLE BEE, AND HAPPY BIRTHDAY TO TUP TOO – HIP HIP HOORAAAY HIP HIP HOORAY!

LISMORE BIKE PARK AND DISC GOLF ARE AWESOME FACILITIES. JUST WONDER WHERE THE USERS GO TO THE TOILET??? MAYBE QLDC COULD TALK TO SANTA AND HE COULD DROP THEM OFF ALONG WITH A COUPLE OF RUBBISH BINS

HAPPY BIRTHDAY FOR SUNDAY MEL! 38 CAN`T WAIT FOR THE BIG 4-0! GOTCHA X M

WELL DONE TO THE PEOPLE WHO BUILT THE TRAIL NEXT TO HOE DOWN. AMAZING TRACK!!!

THANKS SO MUCH TO THE VOLUNTEER RURAL FIRE BRIGADE WHO ATTENDED THE FIRE OUT TOWARDS TARRAS LAST WEEK. YOU ARE SO APPRECIATED.

KIWIS CANT FLY. CAN’T WALK EITHER IF WE HAVE TO CUT DOWN A BEAUTIFUL TREE TO GET A BETTER VIEW OF THE LAKE

IS IT POSSIBLE TO HEAR AN ACCENT IN SOME NEGATIVE TXTS? NO, IT’S JUST YOUR PREJUDICE SHOWING.

GUESS COURTESY APPLIES TO THE DUCKS CROSSING AT THE SPEED BUMPS ALSO. THEY KNOW WHAT THEY ARE DOING!

LAST WEEK’S PROBLEM: LACK OF PARKING AROUND WANAKA POST OFFICE. WHAT A JOKE. SOLUTION: THERE’S A CAR PARK RIGHT BEHIND WANAKA POST OFFICE.

TIRED OF GETTING THE BLAME! PICK UP YR DOG S@#T ON MT IRON GIVES US WHO DO A BAD NAME U KNOW WHO U R :-(

Q . IS IT POSSIBLE TO HEAR A BITTER MOANING OLD FOSSIL IN LAST WEEK’S TXT!!

JUST LIKE I REFUSE TO PAY FOR A COLD SHOWER AT THE POOL, I ALSO REFUSE TO PAY TO LANE SWIM IN A POOL TOO HOT.

RIDICULOUS AMOUNT OF POWER BEING WASTED AT WANAKA POOL. IT DOESN`T NEED TO BE 30 DEGREES. LET`S SAVE MONEY AND DROP TEMPERATURE.

WELL DONE WANAKA POOL, YOU FINALLY REACHED 30 DEGREES WATER TEMPERATURE WHILE OUTSIDE TEMPERATURE 29 DEGREES. WHY DON`T YOU CHANGE YOUR NAME TO WANAKA HOT POOLS?

REMOVE MOST OF THE CAR PARKS FROM OUTSIDE THE P.O. THE ONE PLACE WHERE PEOPLE REALLY DO NEED TO PARK EASILY AND FOR SHORT PERIODS AND LEAVE ONE PARK AND NO FIRE HYDRANT ACCESS. YEAH, GOOD ONE.

THE BIG YELLOW TRUCK HAS GOT THE SPEED HUMPS SORTED OUT. HE STOPS FOR PRETTY GIRLS BUT SPEEDS UP FOR HIPPIES.

THE VIEWS EXPRESSED IN THE TEXT BOARD AND IN THE

LETTERS TO THE EDITOR ARE THOSE OF THE AUTHOR ALONE

AND NOT NECESSARILY THOSE OF THE WANAKA SUN.

EDITORIAL

Kids these days. What’s gotten in to them? Why this week alone, local teens were caught doing the following: winning an international film competition; raising more than $1000 to buy our town a Christmas tree; receiving academic, sporting and cultural awards; twice (twice!) performing a rousing haka to acknowledge the success of their peers; working part time over the summer holidays to save money for university; performing live music to a professional standard; and using scholarship money to fund overseas volunteer work. What’s next? Helping out on the food bank drive? Back in my day, kids blew their allowance on junk food and video games and spent their spare time watching television, like proper teenagers. Times have changed.

Issue 639 Thursday December 12, 2013

Phone: 03 443 5252 Fax: 03 443 5250 Text view: 021 986 786 Text classified: 022 0786 778

Address: Upstairs Spencer House, Wanaka Postal: PO Box 697, Wanaka

Editorial manager: Ruth Bolger [email protected]: Tim Brewster [email protected]

Caroline Harker [email protected] Production: Adam Hall [email protected]

Advertising: Amanda Hodge [email protected] Jake Kilby [email protected]

Accounts: [email protected]

Printed by: Guardian Print, Ashburton Delivered by: Wanaka Rowing ClubPublished by: Wanaka Sun (2003) Ltd Distribution: 7500

Free delivery to Wanaka, Wanaka surrounds and Cromwell urban and rural mailboxes, PO boxes in Makarora, Cromwell, Haast, Wanaka, Albert Town, Hawea. Distributed to motels, hotels and cafes plus businesses in the

Wanaka central business district and to drop boxes in Wanaka and Cromwell.


20 word limit - deadline Tuesday 4pm - standard network rates apply

02 20 786 77802 20 786 778

ClassifiedsClassifieds

For FREE listing text your advert to

For FREE listing text your advert to

sunclassifieds

82 Anderson Road, Wanaka P 03 443 1114

“Quality mechanical repairs at an a�ordable price.”

body and mindSADHANA LIVING, connect with the living earth, living with the rhythm of nature. Yoga & Ayurveda rejuvenation with carmen www.thesadhanastudio.com

ABHYANGA MASSAGE or an Ayurvedic treat-ment: A unique experience of self-healing and re-laxation. Call Martin 443 5712, www.ayurvedaora.com

ASPIRING MASSAGE WANAKA. Deep Tissue - Relaxation. Trevor Bailey. Full time massage since 1994. Ph 4432993 or 0274222455. Gift vouchers for Xmas!

BEGINNERS BOXING and fitness class, Mondays 6pm at 7 Gordon road. All welcome, casual/weekly options available. Contact Sanna 0212010954

BOWEN THERAPY practitioners in wanaka. Lyn brown 443 7388 www.naturalhealth.co.nz. Cathy rodgers 443 7907 www.lakesbowentherapy.com. Gentle,fast and effective results.

DOREEN VIRTUE Certified Angel Intuitive in Wanaka. Call Linda on 0211468041 to arrange a reading.

EXPERIENCED HOMEOPATH and Healer at Wanaka Wellness Centre. Visit www.intel-ligenthealth.com for details or call Linda on 0211468041 for an appointment.

GIFT VOUCHERS for Xmas. The perfect pre-sent for your loved ones. Massage in Wanaka for all your massage and Beauty needs. Ph 03 443 8448.

MASSAGE THERAPY, Sportsmassage, Deep tissue, Relaxation. Treatment work, stress relief. Ursula Krebs, Dipl. Massage Therapist. Ph: 027 6602271

MUAY THAI boxing, intermediate class, Wednesdays 6pm at 7 Gordon road. All welcome, casual/weekly options available. Contact Sanna 0212010954

NICOLA ROMERIL . Professional Make Up Artist. Weddings and special occasions . Works with Jane Iredale mineral make up. Ph 021 2255142.

QIGONG CHINESE movement art for body & mind rejuvenation. Classes Hawea Flat 7am & 7pm James 443 4122

for saleBED FOR SALE king single bed with mattress only $50 pick up preferred. Call 02102738889

LAST MINUTE Xmas Pressie? DIVINE CLEARING GIFT VOUCHER! 0210781955. Dr Yvonne Murphy www.divineclearing.co.nz

POULTRY WHEAT and barley 4 sale, whole or crushed.30kg 4 $25.. .. 021 251 5510/4434944.

SGT DAN Poultry layer mash $25 for 25kg. 4434944

STUCK FOR CHRISTMAS IDEAS? True or-ganic skincare for Face, Body, Mother & Baby. Read the True Story at trueholisticbeauty.com For Sale plse.

TRUE ORGANIC skincare makes a great gift for Christmas. Now available at Wonder room, Soul food, Wholefood Haven and Decode in Queenstown.

DOG KENNEL- large carpet and raised floor.$50. 4436235

GIFT VOUCHERS available at Nirvana Retreat www.nirvanaretreat.co.nz or call 4432252 for details.

GREAT BOOKS at the Sunday craft market this week, written and illustrated right here in wa-naka, what a great gift!

for saleHAAST, WEST COAST Cheapest section in the area, no hidden costs! We have a 1050 Sqm² section with compaction test, temp power and phone ready to be built on NOW! Will throw in FREE set of plans (worth $6000) for architecturally designed two storied house, self-contained unit downstairs. Bush and Sea Views, located in Hannahs Clearing. $95,000 + GST if any. Ph: 03 7500 153 For sale

JONSARED RIDE on mower new battery – good working order $2750 o.n.o 443 6069 or 021626649

KEEPING IT natural at the craft market this Sunday, organic cotton handprinted t’s, natural skin care products, pembroke park, from 10am

STUCK FOR gift ideas? Try a hand-crafted hu-lahoop from fantailhoops adult or kids hoops to suit different abilities and shapes. Contact jo 02108289987

WE’VE HAD a major PrAna delivery. It’s flying out the door. Gorgeous men’s shorts. Vibrant ladies dresses. Come see at MTOutdoors.

BRAND NEW Crocs range now in store at MTOutdoors. And you should see them. Wild! Especially the new ladies styles.

HAINES HUNTER boat 4 sale. 6 m. Yamaha 140hp. Cooker, sink, seaWC, FMradio. Great family boat! 32,500 dollars. Located Cromwell. 034453325 or 0279257161

1999 SUZUKI Grand Vitara, 184,500km, 5 door. We have purchased a motor home, the Suzuki must go. Can be yours for $6500 ono. Call 7468108 or 0273212451 for inspection.

802SQM SECTION, Lake Hawea. Close to lake/shops/primary school, mountain views. Price negotiable, phone 4439310 or 021656655.

FOR SALE Bagleys New Potatoes - Dug fresh each day available at Selectrix

WAKEBOARD FOR sale. Freemotion, 138cm with liquid force bindings. $300. Ph 443 6684.

BEAUTIFUL CHINA tea cup bird feeders, great for attracting wax eyes and bell birds to your garden. Make the perfect presents $20 ph 443 1017 or txt 021 680 110

freeMOVING ON? Wanaka Wastebusters picks up donated goods for free, call 443-8606 to help us help our community and the environment. Resaleable condition only please.

FREE TO good home black male rabbit ap-proximately 9wks old (very cute) 0274170195

FREE PICK up service for your household donations please phone The Salvation Army Family Store 443 5068 to arrange

garage saleGARAGE SALE - Sunday 15 household items, clothing, toys. All must go 9am 36 Kennedy crescent

GARAGE SALE 9 Balneaves lane 8am Sat 14th wooden bed ends, antique dresser $650 ono, & lots of other stuff

MASSIVE YARD SALE. Saturday 14th. 3 Ewing Place off Old Racecourse Rd. Womens/Boys clothing. Childrens books. Tons of stuff!

noticeHAVE YOU heard of the Baking Fairy? Come to the craft market this Sunday and check out this local recipe book by Susan Manson

noticeKEEPING IT natural at the craft market this Sunday, organic cotton handprinted t’s, natural skin care products, pembroke park, from 10am

LIFE STORIES writing and book design. Memoirs, histories, letters, diaries - tran-scribed and published. www.timeofyourlife.co.nz. Contact [email protected] or 443 4629.

NEW RELEASES @ Video Ezy: The Heat, Elysium, Now You See Me, Way Way Back, Grown Ups 2

THERE ARE lots of artisans at the craft market this Sunday, pottery, silk painting, toys, books and more. Pembroke park from 10am

WANAKA MIDWIVES, Mandy, Deb and Peta are now at Wanaka Midwives in the Wanaka Wellness centre. 03 443 1655 www.wanaka-midwives.co.nz

WANAKA WASTEBUSTERS has presents that don’t cost the earth. Gift table and vouch-ers. 9am-5pm every day except Christmas Day.

rentLUXURY HOUSE Wanaka rental. Pool, spa. 5 bedrooms. Sleeps 10. 21-27Dec. 6-23Jan. Bookabatch #23970 or Fiona 021779820

OFFICE TO Let. 36m2 standalone office plus share of kitchen, toilet, shower, terrace & car-park. $150/m2 plus GST & outgoings, 027 663 6224

QUEENBED ROOM. ALBERT TOWN. Welcomes quiet living, nonsmoking couple short term /single long term. Own bathroom, I/N $190/$140/wk Power extra. Ph Maryann 021 1101160

STUDIO UNIT. Centrally located, beside MAC/Primary school. Suit single. Modern, warm, pri-vate, good storage. $250/week bills inclusive. 6 month min. Call 0274729908. Eddie.

XMAS + Warbirds rental - 1 bedroom cottage lakeside @ Hawea. Million $ views & situated within walking distance of store pub & commu-nity centre. 0210318288

services

DRIVING LESSONS available. Call Nicky at Aspiring Drivers to book your lesson and be-come a confident and safe driver. 0210607310

FOUND A swarm? free removal. ph 0211633811

HEDGE TRIMMING. Weed eating. Lawn edg-ing. Lawn mowing . Rubbish removale . Good rates . Free quotes. Wanaka and areas. John 02108449623 or 4431715

INLAND REVENUE are at Community Networks Thursday 19 December 9am - 1pm,For help with personal or business tax,child support,student loans or family tax credits call 4437799 to make an appointment.

JP SERVICES at Community Networks Tuesdays1pm and Fridays 10.30.For appoint-ments call 4437799

VASECTOMYS AVAILABLE here in Wanaka with Dr Simon Brebner at Aspiring Medical Centre.Ph 443 1226 for an appointment to discuss.

WANAKA WINDOW CLEANING professional, friendly, efficient service. Enjoy those mountain views. High, awkward windows a specialty. Paolo 021 0572505/ 4432420

WANAKA’S NEWEST website design and graphic design company -www.envydesign.co.nz. 30% off when you mention this ad!

servicesWHEELS TO DUNSTAN: Free daily transport to Dunstan Hospital & Alexandra specialist ap-pointments, Bookings call 4437799

WWW.BRIGHTSPARKSWANAKA.CO.NZ ARE your local payroll specialists (from $15 per payroll run), certified Xero advisers and more. Check us out TODAY!

thanksTHE SALVATION Army Store wishes to thank everyone for shopping at our store, with your purchases we can help people in need in our community.

wantedLONG TERM RENTAL NEEDED: local moth-er & daughter need a new home, ideally lake hawea, superb tenants! Ph 02102215409

LOOKING FOR a part time housekeeper. Must be a hard worker, a can do attitude, great customer skills. Send CV to : [email protected]

SPRINGER SPANIEL SEEKS COMPANY sometimes whilst owner works. Maddie is too gorgeous to be alone! Please ph Nikki 027 443 4143

THE SALVATION Army Family Store would like a strong volunteer to help with heavy lifting.

WANTED CLIP clothes hangers, please drop into The Salvation Army Family Store 48 Helwick Street.

WANTED YOUR old innertubes. All size bike tyres, scooters and motor bikes. Contact jo 02108289987.

WANTED:URGENTLY REQUIRE slat/nor-mal base for bed.And ppl to help move few items into house.0223119113

what’s onLUGGATE PLAYGROUP Christmas Party. The Luggate Hall. Saturday 14th December 10am - 12pm. Santa will be there too! All welcome:)

THE SUNDAY Craft Market is on this week come on down to Pembroke Park, for great handmade N.Z arts and crafts.

CENTRAL OLD TIME DANCE GROUP. Christmas dance. St Gerards Hall Alexandra. Dec 14th 7.30pm. Supper plate, small gift $5 admission

THE SALVATION Army Family store will have late night Christmas shopping Tuesday December 17 from 5 – 8 pm, amazing in store specials available on the night.

WANAKA SUN Christmas Food Drive WEDNESDAY December 18. Donations will fill the community food bank and make Christmas a little brighter for local families in need.

CATCH ‘THE mathematics of 7 billion’ at 6pm at the Presbyterian Church Hall on Tenby Street.

HAWEA PLAYGROUP Christmas party, Thursday 19th December, Santa arrives 11amish, bring small named gift 4 your child n plate 2 share, every1 welcome


CONCRETE CUTTING

sunclassifiedstrades&servicesPANELBEATING

CURTAINS

sport results

notice

employment

employment

employment

BRIDGE RESULTS: Christ-mas Pairs 2. North/South:- Freda Ryder, Terry Wilson 60.42% 1. Errol Kelly, Ian McDonald 56.11% 2. Da-vid Brewer, Lynne Fegan 54.31% 3 East/West:- Sher-ril Harries, Dorothy Mc-Donald 63.47% 1. Marion Furneaux, Maggie Strat-ford 61.39% 2. Allan Kelly, Judy Muir 59.03% 3. Friday Bridge 6 December. North / South:- Joy Baxter, Fran Holmes 62.43% 1. Sher-ril Harrries, Mo Schofield 55.56%2. Ian McDonald, Boyd Ottrey 51.85% 3. East / West:- Pat Gray, Elizabeth Irvine 61.31% 1. Lynda

Hodge, Daphne Stewart 55.65% 2. Jan Cunnigham, Josey McKenzie 55.56% 3. Makarora Pairs 3. North/South:- Ena Leckie, Mo Schofield 51.19% 1. Lynne Fegan, Maggie Stratford 50.00% 2. East/West:- Jac-queline Roberts, Kay Ross 67.86%1. Carolyn Field, Noeline Goldsbrough 47.62% 2.

WANAKA BOWLS RE-SULTS Friday Progres-sive Skip 1 Brian Holmes 2 Betty Russell 3 K Char-tres. Third 1 Neville Dip-pie 2 John Gale 3 Norman Matheson. Second 1 John

Lischner 2 Dick Patterson 3 John Maddison. Lead 1 Dennis Schofield 2 Don Murray 3 Iain Fletcher.

LAKE HAWEA GOLF CLUB RESULTS Mt Maude Stableford Men 1 Rick Johnston 46 2 Stew Burt 45 3 Peter Recordon 41 4 Ian Brown 40 5 Red Ste-venson 39 6 Ashley Hale 37. Ladies 1 Maire McElrea 34. Birdies/Net Eagle No10 Rick Johnston and Peter Recordon. Nearest the Pin No1 Peter Recordon. No5 Colin Hanson. Twos: No5 R Johnston, No10 R John-ston and Peter Recordon.

BOOK YOUR ADVERTISING NOW FOR OUR HOLIDAY EDITIONS

CHRISTMASDEADLINES

All bookings & copy for... Christmas edition (December 26) DEADLINE: December 19, 5pm.

New Year edition (January 2) DEADLINE: December 27, 1pm.

P 03 443 5252 E [email protected] or [email protected]

Sushi Chef WantedYohei is looking for a sushi chef to join the

friendly team at their busy cafe in Wanaka. The successful candidate will have at least 2 years

experience and sushi making ability. Candidates looking for long-term employment preferred. Please email your C.V. and covering letter to

[email protected]

Yohei Cafe WanakaSpencer House, Dunmore Street

Ph: 03 443 4222


Albion Cricket Club senior players won both 20-20 games last weekend. The seniors played against Cromwell in Queenstown. Cromwell scored 51, with Albion’s Ryan Wheeler 2 for 9 and Gareth Tate 3 for 7. The seniors play home at Luggate Cricket Ground this weekend.The senior reserve played Oamakau away. Oamakau got 110 with Jamie Kennerley 2 for 20. Albion got 111 for 4, with Andrew Thomson 73 not out and JD Bowman 17. The senior reserve play at Pembroke Park this weekend when both teams start the first week of 40 over cricket.

Wanaka’s Katharine Eustace finished 18th at the World Cup Skeleton Race at Park City, Utah. The quality of the racing is high as the World Cup season includes the Olympic qualifying races.Katharine was in 20th place after the first run.”I just couldn’t quite believe the time after my first run, I thought it had been okay except for one mistake I made that clearly cost a lot of time,” she said. “As well as not pushing anywhere near as well as I have done in the past it meant that today was not my day. I was definitely pleased to pick up a couple of spots in the second heat though.”The World Cup circuit moves to Lake Placid USA next week.

Two cricket wins

World cup circuit

sunsport

Staff RepoRteR

Wanaka Sun

Wanaka Swim Club hosted the Otago Country Clubs regional swim competition on December 8, winning the competition for the first time in its 77-year history. Ninety-six swimmers from at least six clubs competed. Wanaka Swim Club head coach Fiona Hezinger said the club win was a team effort. “We didn’t have many first placings to gain points from, but we made up for it with lots of swimmers gaining top six placings. In the past we have fallen back on our top individuals to gain us the points but this time we did it as a team,” she said. “We won all the relays bar one which was incredible. As a coach this is what I have strived for over the past three years - to build Wanaka Swim Club up to be a strong team.”Gregor Findlay is pictured during a relay race.

Club makes history

L o c a l f r e e s k i e r s Janina Kuzma and Beau-James Wells have qualified for the halfpipe finals of The North Face Park and Pipe Open Series at Copper Mountain Resort in Colorado.

Janina qualified in ninth place and Beau-James, in heat one, qualified in fourth place. On finals day, Janina was in fourth

place with a score of 78.25 after a solid first run.

“There was no point repeating the same run so I decided to try for the 900 in my second run,” Janina said. She was pleased with her final result of sixth despite not m a k i n g t h e 9 0 0 rotation, and landing a 700 instead.

Beau-James Wells posted his highest score of 80.75 with his second run which

comprised a 540, followed by a double 900, nine to right seven and finishing with a switch seven. He was sixth overall.

B o t h c o n t i n u e t h e i r O l y m p i c qualifying campaign i n c o m p e t i t i o n at the Dew Tour in Breckenridge, Colorado (December 12 to 15) before r e t u r n i n g t o Copper Mountain f o r t h e W o r l d Cup event.

Sixth in finals

PHOTO: TIM BREWSTER

wanaka sun

Documents