cloning and sequencing of the cdna encoding the murine mammary gland long-form prolactin receptor
TRANSCRIPT
263 Gene, 134 (1993) 263-265
Elsevier Science Publishers B.V.
GENE 07447
Cloning and sequencing of the cDNA encoding the murine mammary gland long-form prolactin receptor*
(Mus musculus; h phage library; RT-PCR; recombinant DNA)
Robert C. Moore and Takami Oka
Laboratory ofMolecular and Cellular Biology, National Institute of Diabetes, and Digestive and Kidney Diseases, National Institutes of Health, Bldg. 8, Room 319. 9000 Rockoille Pike, Bethesda, MD 20892, USA
Received by J. Piatigorsky: 8 April 1993; Revised/Accepted: 28 June 1993; Received at publishers: 23 July 1993
SUMMARY
The nucleotide sequence of a 1992-bp cDNA encoding the long form of the murine mammary prolactin receptor
(PRL-R) has been determined. The deduced 68-kDa protein has high sequence identity with long forms of prolactin
receptors from rat ovary and rabbit mammary gland.
INTRODUCTION
Prolactin is a peptide hormone which has multiple bio-
logical functions including the regulation of milk pro-
duction in the mammary gland. The effect of PRL is
mediated by the interaction of the hormone and its
plasma membrane receptor. Both short and long forms
of PRL-R cDNA have been identified that appear to be
the result of alternative splicing of transcripts. cDNAs
encoding three PRL-R short forms from mouse liver
(Davis and Linzer, 1989) and rat liver (Boutin et al., 1989)
have been cloned. Long form PRL-R cDNAs have been
isolated from rat (Shirota et al., 1990), rabbit (Edery et al.,
1989), bovine (Scott et al., 1992) and the human hepa-
toma cell line HepG2 (Boutin et al., 1989). Mammary
Correspondence to: Dr. T. Oka, Laboratory of Molecular and Cellular
Biology, National Institute of Diabetes, and Digestive and Kidney
Diseases, National Institutes of Health, Building 8, Room 319, 9000
Rockville Pike, Bethesda, MD 20892, USA. Tel. (l-301) 496-1404; Fax
(l-301) 402-0053; e-mail: [email protected]
*On request, the authors will supply detailed experimental evidence for
the conclusions reached in this Short Communication.
Abbreviations: aa, amino acid(s); bp, base pairs(s); kb, kilobase or
1000 bp; nt, nucleotide(s); PCR, polymerase chain reaction;
PRL, prolactin; PRL-R, PRL receptor(s); RT-PCR, reverse tran-
scriptase-PCR; TM. transmembrane.
glands of lactating mice produce the highest level of long
form PRL-R mRNA, compared to those of virgin and
pregnant mice (Nishikawa et al., 1993). Transfection ex-
periments have shown that the long form of PRL-R from
rabbit mammary gland is capable of transducing a signal
to milk protein genes (Lesueur et al., 1991) while the
role of the short form has yet to be determined.
EXPERIMENTAL AND DISCUSSION
(a) Isolation of mouse mammary gland long form PRL-R
cDNA
A mouse mammary gland library was prepared from
mRNA purified from a lactating C3H mouse. A cDNA
encoding the long form of PRL-R was isolated and its nt
sequence determined. A comparison of the deduced aa
sequences of the mouse mammary and rat ovary PRL-R
suggested that the cDNA clone lacked seven nt of the S-
end of the open reading frame. A DNA fragment contain-
ing part of the 5’-untranslated region and the first 802 bp
of the PRL-R coding region was amplified by RT-PCR
and used to construct a full length PRL-R cDNA. The
deduced mouse mammary PRL-R precursor consists of
a polypeptide of 608 aa. Analysis of this sequence by the
method of von Heijne (1986) predicts that the PRL-R
264
I”SII”“E~LISSPGDTLGSF‘GKAG~NV~K~SE~AGSGE GTGG~TGTGCMGMCGGGCUGCTTCCCTTCT~~~~~TCT~GGC~~CTCC~~G~~~TTGTCTATGCT~CCCC~~~TACGTG~~TT~C VAVGEGAKSFPSDKPWTSYPPLGEKGPIVYAKPPD~VEIH ~GTCMC~OLCGWIGTGCTATCATTACTCCC~G~~~~CUCCA~~~CCCTGGGGTTCCT~CCAGTMG~GTATGC~GGTATCTGGGGT~~~T 1:: K~NKDGVLSLLPKGRENHGTENPGVPETSKEVAKVSGVTLI 540 AA~AICAT~~TGGTGTTAGTGC~GACTCACGAGCCCA~CA~GCTTTGCTT~G~TCAGCCMGMGGTTCCACCATCGCTT~~~CCMTCTGAG~~TCTGGCCAGC 1798 RNILVLVPDSRAGNTALLEESAKKVPPSLE~R~~EKGLAS 580 TTTA~TG~~~T~~GWUCTGCAWCTCCMCTCCMCTGGG~GGCTG~TTACCTG~TCCTACGTGCTTCATG~CTCCTTT~CTGA~GCTA~CTTAT~CA~TT~CT~T~ 1918 F TATS S N C R L G L G R L D V CD P T C F NH S F H 1** 608
W\TTTCTCTTUCGTMCACTA~~GT~T~GTMTGTGGTCTGCTM~TGTTA~G~TGTG~TAT 1992
Fig. I. The nt sequence of the mouse mammary PRL-R cDNA and the deduced aa sequence. Sequence encoding predicted TM region is underlined.
Three asterisks indicate a stop codon. GenBank accession number is L13593. The mouse PRL-R sequence was obtained by: (a) isolation of a clone
(RM236) from a mouse mammary cDNA library constructed in kZAPl1 using a 32P-labeled PCR fragment encoding the receptor intracellular
domain; (b) sequencing RM236 after phagemid rescue using helper phage R408; (c) RT-PCR amplification of the missing 5’-end of the coding region
using mammary RNA and primers to the 5’-untranslated region of mouse liver PRL-R (Davis and Linzer, 1989) and RM236 coding sequence;
(d) exchange of restriction fragments to create RM252 and sequencing the complete nt sequence of clone RM252. Additional RT-PCR experiments
using long form specific primers confirmed the sequence and identity of the 5’-end of the cDNA. Methods: PRL-R cDNA was amplified in a final
volume of 100 pi in a I x PCR buffer (50 mM KCljlO mM TrisHCI (pH 8.3)/1.5 mM MgCl,) containing 0.2 mM each dNTPjlO0 ng each primer/phage
h cDNA/2.5 units of Taq polymerase. A 1217-bp PRL-R probe was synthesized by amplifying AZAPII library cDNA with PRL-R specific upstream
primer 8 (T-TATCTTGTCCAGACTCGCTGCAAGC) and downstream primer 12 (S-CACGTAGGATCCAGGTAATCCAGCC). The PCR program
was as follows: denaturation at 94-C for 1 min, annealing of primers at 60°C for 1 min and elongation at 72°C for 2 min. cDNA was synthesized
from mammary gland total RNA in a final volume of 20 ~1 in a I x PCR buffer containing 1 mM each dNTP/l unit of RNase inhibiter/5.2 pg
total RNA/random hexamers (2.5 pM112.5 units of Moloney Murine leukemia virus RT (Perkins Elmer Cetus). PRL-R cDNA was amplified
using upstream primer 24 (5’-GATCTAGAGAAGGGAGCCTCTGATCTATTGCCT) and downstream primer 25 (S-GATCTAGACAGG-
AACTGGTGGAAAGATGCAGGT) or downstream primer 68 (5’-ACTTCCAAGAATTCCACCAGCAAGT). Primers 24 and 25 contain a 5’-XbaI
site and primer 68 contains a single nt mutation (C-*T) to introduce an EcoRI site to facilitate cloning. PRL-R cDNA was amplified by PCR as
described above.
contains a 19-aa signal sequence. The mature receptor is
composed of 589 aa with a 210”aa extracellular domain,
a single 24-aa transmembrane (TM) region and a 355-aa
cytoplasmic domain (Fig. 1). The 3’-untranslated region
of the mouse mammary PRL-R cDNA sequence does not
have the polyadenylation ~onseusus SHp_li?Il~~
(AATAAA), as was the case with the rat ovary (Shirota
et al., 1990) and bovine (Scott et al., 1992) PRL-R cDNA
sequences.
(b) Sequence analysis
Long and short forms of PRL-R have highly conserved
extracellular and TM domains; i.e., the first 280 aa of the
PRL-R long form are identical to the mouse liver short
form. Among long forms, the mouse mammary receptor
shares 91% (of 610 aa) and 72% (of 616 aa) identity with
rat and rabbit receptors, respectively. The most conserved
region of the cytoplasm& domains of all forms of PRL-
R is adjacent to the TM region. All differences in peptide
sequence of the mature PRL-R that are due to the addi-
tion or deletion of aa are clustered within the central
region of the intracellular domain, from aa 384 to 524
(Fig. 2). This variable region of the receptor appears to
be dispensable because the PRL-R of the Nb2 rat lym-
phoma cell line, which lacks this region, is still capable
of stimulating milk protein gene expression (Ali et al.,
$8” N”“*IPPTPNPQ*l++xNNTPNCHTDTSRSTTWP*”LP”P Rt .***....vD.. *****GTN..F.V.RP..S...**.L*....“P......”........ P.B .**‘VTH.WD..TISLVDREI.YLGVNO...G...L”.Q*....NTN....N...~....T B0 .‘**LTCLQA..STSMGKI.YFLANGP..S...FPQ.*.SLYSP.YS..N.....E..L Hu THTWD.PCISHg**~'"GKI.YF.AGG..CS...*"..Q.S..NP..S..N.T...E..V
SO GHAG.TATS..QT~HA."**.A.KTIET.R.GK.TX*Q*RBSEGC.S'.PD.D.V..RP Hu G.AGAPATL.M(.CMA.g**.S.~IKSR..GX.T.+QREW..H.ETD"*.D.P.LLP
f$ QEKGPIVYAKPPDYVEIHKDGVLSLLPKQREN*HQTENPG 524 . ..S.T..V...................F......'N...K.. 526
Rb K..P.FISP..L............A....L..K..GD..GKA. 532 BO .D.T.LIS...tE.......SQ....A.F...N.R*P*****. 535 nu . ..T.FGS...L............A..........SGKPKK.. 538
Fig. 2. Comparison of variable regions in the intracellular domains of
long form PRL-R. Deduced aa 384-524 of mouse (Mu) mammary PRL-
R is compared to corresponding aa of rat (Rt) ovary (Shirota et al.,
1990), rabbit (Rb) mammary gland (Edery et al., 1989), bovine (Bo)
(Scott et al., 1992) and human (Hu) HepG2 cell (Boutin et al., 1989)
PRL-R. Dot indicates identical aa, asterisk indicates addition or dele-
tion of aa.
265
1991; 1992). The cDNA clone described here will be
useful in determining the domains through which the
mouse mammary long form PRL-R regulates the tran-
scription of milk protein genes.
(c) Conclusions
We have isolated and sequenced the mouse mammary
long form of the PRL-R cDNA. The mouse mammary
PRL-R is homologous to long forms of PRL-R from rat,
rabbit, bovine and human. The central region (aa
384-524) of the mouse mammary PRL-R intracellular
domain is the least conserved among the long forms of
PRL-R.
ACKNOWLEDGEMENTS
We would like to thank Drs. Lee Burns, Roland Owens
and Frank Tietze for critical reading of the manuscript.
We also thank Drs. Norio Nonomura and Seiji
Nishikawa for their helpful suggestions.
REFERENCES
Ah, S., Pellegrini, I. and Kelly, P.A.: A prolactin-dependent immune
cell line (Nb2) expresses a mutant form of prolactin receptor. _I. Biol.
Chem.266(1991)20110-20117.
Ali, S., Edery, M., Pellegrini, I., Lesueur, L., Paly, J., Djiane, J. and
Kelly, P.A.: The Nb2 form of prolactin receptor is able to activate
a milk protein gene promoter. Mol. Endocrinol. 6 (1992) 1242-1248.
Boutin, J.M., Jolicoeur, C., Okamura, H., Gagnon, J., Edery, M.,
Shirota, M., Banville, D., Dusanter-Fourt, I., Djiane, J. and Kelly,
P.A.: Cloning and expression of the rat prolactin receptor, a member
of the growth hormone/prolactin receptor gene family. Cell 8
(1988) 69977.
Boutin, J.M., Edery, M., Shirota, M., Jolicoeur, C., Lesuer, L., Ah, S.,
Gould, D., Djiane, J. and Kelly, P.A.: Identification of a cDNA
encoding a long form of prolactin receptor in human hepatoma and
breast cancer cells. Mol. Endocrinol. 3 (1989) 1455-1461.
Davis, J.A. and Linzer, D.I.: Expression of multiple forms of the prolac-
tin receptor in mouse liver. Mol. Endocrinol. 3 (1989) 6744680.
Edery, M., Jolicoeur, C., Levi, M.C., Dusanter, F.I., Pttridou, B., Boutin,
J.M., Lesueur, L., Kelly, P.A. and Djiane, J.: Identification and se-
quence analysis of a second form of prolactin receptor by molecular
cloning of complementary DNA from rabbit mammary gland. Proc.
Natl. Acad. Sci. USA 86 (1989) 2112-2116.
Lesueur, L., Edery, M., Ah, S., Paly, J., Kelly, P.A. and Djiane, J.:
Comparison of long and short forms of the prolactin receptor on
prolactin-induced milk protein gene transcription. Proc. Natl. Acad.
Sci. USA 88 (1991) 8244828.
Nishikawa, S., Moore, R.C., A. Kanai and Oka, T.: Hormonal regula-
tion of long form prolactin receptor mRNA and its relationship to
B-casein gene expression in the mouse mammary gland. Endocrine
J. (1993) in press.
Scott, P.I., Kessler, M.A. and Schuler, L.A.: Molecular cloning of the
bovine prolactin receptor and distribution of prolactin and growth
hormone receptor transcripts in fetal and utero-placental tissues.
Mol. Cell. Endocrinol. 89 (1992) 47-58.
Shirota, M., Banville, D., Ali, S., Jolicoeur, C., Boutin, J.M., Edery, M.,
Djiane, J. and Kelly, P.A.: Expression of two forms of prolactin
receptor in rat ovary and liver. Mol. Endocrinol. 4 (1990)
1136-l 143.
von Heijne, G.: A new method for predicting signal sequence cleavage
sites. Nucleic Acids Res. 14 (1986) 4683-4690.