8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 1/475

Visual Properties LabelVertex 1 Vertex 2 Color Width Style Opacity Visibility Labelyohan_b alexizzzyohan_b alexizzzttaonline sichelputzerlivia_promo compexweb

livia_promo compexwebivan_alvarencompexwebivan_alvarencompexwebfadinhanurs compexwebfadinhanurs compexwebromeuvsjr compexwebromeuvsjr compexwebhuany_ compexwebhuany_ compexwebnatajustin compexwebnatajustin compexwebdanfalconer eon_techtcarothers 9to5macistelaemila compexwebistelaemila compexwebnabidka informationweekesgratis mskadubillyriantono technetindotriomis silicon_delokalmagasi dagens_nyhetertech_answe go4answers

tech_answe sharepointwikiandre_wilco webdesignmagzdynamomik lefty22naomi631 zebrawebdesignrhettu traviata_ms_crmrhettu javiergmgbardakis ageorthomas_well__furythomas_wellnet2thomas_welldarenbbcthomas_wellphaneeshnthomas_welltonsofgoldthomas_wellfrankguillenthomas_wellcristiedrakethomas_wellbeckiealderthomas_welldarrenharfordthomas_welldaleswintonthomas_wellbloggodowntheplotlesspl9to5mactheplotlesspl9to5mac

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 2/475

aditi_tech dougneineraditi_tech billschrierxbox_updat techshoutcomputers_ sukhikhcomputers_ dhilipsiva_aplecomputers_ comp_softwares

computers_ undergroundidjtarek journaldugeekfedi2 kuswantokuswanto fedi2cvasqu1 informationweekmycleverfrie opensourcefeedscomputers_ arsenalpcinputarsenalpcinparsenalpccameraarsenalpcca arsenalpcinputschoe22 rohyrohy schoe22iknrr applefeedsinsideaxis nalle09insideaxis downloadboxsteakhachai journaldugeeksteakhachai journaldugeekariannagiovaipadforums_netariannagiovadspade123stechnology thomas_wellertecnotruco 9to5machrlockerusa thetechgang

hrlockerusa cloudcareershrlockerusa softwarexpertmaramos22 yorientomaramos22 profesor4debsuvra thewindowsclub jimposhible debsuvrathetechgang ciscloudciscloud thetechgango_oliv journaldugeeko_oliv journaldugeeko_oliv facegeeksusangorha grossmendelsohngrossmendelmsdynamicsgpmsdynamics grossmendelsohnsusangorha grossmendelsohnsusangorha msdynamicsgpaspexperts thomas_welleraspexperts jansantaspexperts jimposhiblethomas_wellaspexperts

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 3/475

jimposhible aspexperts jansant aspexpertshotnewstory globaltechnews jrsaba informationweekhotnewsstor smartmarketing1hotnewsstor giantgizmonews

hotnewsstor techbazarhotnewsstor kittukrerolin lbnplbnp rerolinrerolin lbnp jimposhible mucho_hambremucho_ham jimposhiblewspresso heiseonlinecovettes wspressolacafila followerbackfollowerbac lacafilathomas_wellfollowerbackfollowerbac paulespcforumdefollowerbac thomas_wellerrodrigobreckcompexwebbraulioareis appleweblogfaresf 9to5macmobilecnew maxengagemaxengage mobilecnewsbuzzistic facegeekgeraldebner superbhancho

_misternox yohan_b _misternox journaldugeekthomas_wellfreie_meinungfreie_meinu heiseonlineshortestnew freie_meinungshortestnew paulespcforumdeana7lo0o waltersoftwarewaltersoftw ana7lo0otwittlernen xtopiatwittlernen paulespcforumdetwittlernen pcserviceberlintwittlernen newtechbooksra_caesar heiseonlinewebgadgets bestblogpoststechriotnet nettechnewstechriotnet techwatchwebgadgets techriotnetwebgadgets congadgetsspeedhot webgadgets4lifewebgadgets thomas_weller

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 4/475

webgadgets ariannagiovanniwebgadgets grafdomtechwebgadgets speedhotthomas_wellmycleverfriendmycleverfrie thomas_wellerfosswiki mycleverfriend

mainboarde heiseonlinen3rve windowsnewsinfon3rve htcdevmidox69 journaldugeekitshooter powerumcpowerumc itshooteritshooter powerumcit_world_ne buzzurlsit_world_ne teviantit_world_ne vitalvasiamchuckharclickflickcathomas_welljakespizer jakespizer careerandbizopsterenceduns tarmogootteviant izhastroteviant avmindschoe22 dushideeschoe22 tarmogootschoe22 dannyburlageschoe22 mtimmerdushidee schoe22

buzz_apple shoppingappleninob wpugwpug ninobmysticgeek thewindowsclubthewindows mysticgeekagusnadhi xpertron2itterist 9to5macariannagiova2itterist2itterist 9to5macwissenssuch sichelputzerschmeet sichelputzersichelputzer wissenssucherwissenssuch sichelputzerpptconverte hiresharepointhiresharepoi pptconverteranswers9 hiresharepointanswers9 kunal2383hiresharepoi answers9mkroberts1 cube_icemsitpro mslearningindia

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 5/475

mslearninginmicrosoftkbmslearninginmsitprosoftposts filegamegameblogfr journaldugeekmatiere 9to5macschmeet wissenssucher

schmeet wissenssucherallvideogam watchgleeczcciw_it_jobs informationweekinfoweeksm informationweeknithinr6 microsoftkbnithinr6 thewindowsclubxenen82 anounanoun bossblogsterbossblogster anounmosquitobo anounmosquitobo snobstweetdublidublida tweetnatalxbox_updat tweetnatalmosquitobo tweetnatalisecadviser threatfeeditflash paulespcforumdeagusnadhi ebayomaniactechrss ebayomaniacpreistest ebayomaniacbossblogster preistestpreistest paulespcforumde

preistest bossblogsterchezpax faqshopnewsquelle 9d0wnnewsquelle proactivedefendthomas_wellnettechnewstechnoworldnettechnewsthetechgang technoworldnewstechnoworld techwatchtechnoworld thetechgangd1ndonlyzr1 techwatchonlinehardw openhousebostonopenhouseb onlinehardware1ikroh alltop_seoikroh kittukikroh teliacoikroh thebeanyronaldperkinrevesbysellerrevesbyselle ronaldperkins02askoli webdesignmagzitespressofr tsrr

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 6/475

itespressofr windowsfranceenricorausa socialflumediaenricorausa socialflumediamichiganhill pelushitalianimichiganhill jalansaketmichiganhill kittuk

michiganhill jeromekrussellquanrel michiganhillmichiganhill quanrelhotdealshea view_zaakenniegonza creportengeldvh mariusoiagaengeldvh mariusoiagasiliconnews msblogspaingsiibert siliconnewsmsblogspain siliconnewssiliconnews itespressosiliconnews msblogspainsiliconnews itespressofritespresso siliconnewsgsiibert siliconnewsdatanews_nllewispr_belewispr_be datanews_nlhalosreach ownamaticaceshighmm halosreachhalosreach aceshighmmoniklasrde microsofthilft

microsofthilfniklasrdetechnet_de microsofthilftmicrosofthilfmicrosoftkbmicrosofthilf technet_dexbox_rocks en2twxbox_rocks twitergamermosquitobo xbox_rocksxboxgirlie xbox_rocksxboxgirlie cheapxbox360xboxgirlie xbox_updatezmywebby newstalk24mywebby newstalk24mywebby heiseonlinemywebby wissenssucherteviant vitalvasteviant max88pedroteviant angel0610vitalvas teviantartdriverne teviantartdriverne vitalvas

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 7/475

mtimmer mvdgenderdushidee mvdgendermvdgender mtimmermvdgender thewindowsclubmvdgender renatabignardimvdgender dushidee

mentaltraini emailhostingariannagiovaemailhostingemailhostin bloghostingemailhostin newtechbooksbloghosting emailhostingariannagiovatuinimaryclevergayle tuinimarykelley2009 tuinimarysilicon_de timelesscodestimelesscod silicon_dephilseitig pcserviceberlinpcserviceberphilseitigpcserviceberpaulespcforumdephilseitig pcserviceberlingagdetman globaltechnewslindalim22 world_policydigital_dale advadforumadvadforum digital_daledigital_dale advadforumsalivates tech_monstersalivates paulespcforumde

tech_monst salivatestech_monst ymerejtech_monst htcdevtechnet_de techfieberalexf10 technet_dextopia technet_delando411 newtechbookslando411 olegnovikovgrafdomtechtotaltechnewsdesktopx shoppingappledublidublida lindalim22lindalim22 dublidublidalindalim22 trippbradentrippbraden lindalim22ebespiloy pleccotechpleccotech ebespiloyctandroid ijonbrownijonbrown ctandroidronsimon da52543da52543 ronsimon

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 8/475

ebespiloy zeidelebespiloy olegnovikovebespiloy thomas_welleragusnadhi ebespiloyda52543 ebespiloywpsitehostinrevesbyseller

jansant techkaori5wpsitehostintechkaori5wpsitehostincustomwebdevthomas_wellbppathakbppathak wpsitehostingbppathak thomas_wellerwpsitehostinbppathakkuswanto webfaddswebfadds kuswantotech_monst chemindiawebfadds chemindiamanderson_ a1softwaremanderson_ webfaddsmanderson_ cherylsalescherylsales manderson_jobsagusnadhi manderson_jobsmosquitobo manderson_jobswebfadds manderson_jobs jobsadda webfaddswebfadds jobsaddadublidublida simple2go

webfadds simple2gothomas_wellde_124de_124 itsviralde_124 jansantde_124 ms_access_filesde_124 paulespcforumdede_124 webfaddsde_124 thomas_weller jansant de_124webfadds de_124insideaxis trippbradentrippbraden solutionspathtrippbraden crndailytrippbraden webfaddstrippbraden insideaxiswebfadds trippbradentech_monst webwhywebfadds webwhythomas_welltreyalvarezwebfadds treyalvarez

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 9/475

farzand_ali_ gacconsultantswebfadds farzand_ali_548fosswiki openthink2openthink2 kristinedykristinedy openthink2kjltechnolog tech_news_daily

msjessej3 kjltechnologyfree3gmobil whebsonmsjessej3 free3gmobilesmsjessej3 twitlounge jacksdunn twitloungemsjessej3 jacksdunn jacksdunn msjessej3 jacksdunn relevantnewsnowmobiledeals bpa_investmentsbpa_investmmobiledealstopthomas_wellsilicon_dealexf10 silicon_defosswiki silicon_desilicon_de paulespcforumdesilicon_de alexf10silicon_de thomas_wellersilicon_de seo_rocketsilicon_de opexxxsilicon_de fosswikiseo_rocket silicon_detech_monst msjessej3

da52543 msjessej3msjessej3 jobdenvermsjessej3 thetechgangmsjessej3 computergroupsmsjessej3 tech_monstermsjessej3 relevantnewsnowmsjessej3 samarth_infablemsjessej3 globaltechnewsmsjessej3 da52543 jobdenver msjessej3kasumani kensukeybcgmarkg bcg_systemsbcg_systems bcgmarkgewst43 compexwebewst43 compexwebst44tavares ewst43st44tavares compexwebst44tavares compexwebst44tavares compexwebmarcellwsa compexweb

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 10/475

marcellwsa compexwebmarcellwsa compexwebbebelaalves compexwebbebelaalves compexwebbebelaalves compexwebtoxic_leo compexweb

toxic_leo compexwebtoxic_leo cspontestoxic_leo compexwebemanuelviolicompexwebemanuelviolicompexwebemanuelviolicompexwebdodas_50 compexwebdodas_50 compexwebdodas_50 compexweb jlarrauri goodcrm jlarrauri goodcrm jlarrauri msblogspain jlarrauri microsoftkballthingsipho9to5maccrimsonium 9to5maccrimsonium 9to5macmicrosoftkb microsoftkbrsj2000mrs clevergaylersj2000mrs madly59rsj2000mrs texasl8dyrsj2000mrs lefty22

rsj2000mrs simplydabclevergayle rsj2000mrstexasl8dy rsj2000mrsclevergayle lefty22kelley2009 lefty22texasl8dy lefty22clevergayle texasl8dyxredemptor compexwebxredemptor compexwebxredemptor compexwebmariliagf compexwebmariliagf compexwebmariliagf compexwebloslemes compexwebloslemes compexwebloslemes compexwebloslemes cspontesprofmarise eduinovakaahesonnix compexwebkaahesonnix compexweb

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 11/475

kaahesonnix compexwebwizmole henrycowellwizmole ariannagiovannihenrisacram compexwebhenrisacram compexwebhenrisacram compexweb

cibele_lsm compexwebcibele_lsm compexwebcibele_lsm compexwebteliaco trust_itagusnadhi da52543da52543 webfaddsda52543 freedomman11da52543 agusnadhida52543 teliacowebfadds da52543teliaco da52543geraldebner info4sheff teliaco info4sheff agusnadhi teliacowebfadds teliacoseo_rocket teliacoteliaco webfaddsteliaco agusnadhiteliaco dublidublidateliaco seo_rockettikkita77 compexweb

tikkita77 compexwebtikkita77 compexwebmonster_follheiseonlinemonster_follpaulespcforumdethomas_wellweb20latestwebfadds web20latestweb20latest webfaddstodosmart web20latestijonbrown todosmarttodosmart ijonbrownthomas_wellcarbide25 jansant carbide25agusnadhi carbide25carbide25 netsparshcarbide25 jansantcarbide25 todosmartcarbide25 thomas_wellertodosmart carbide25 jimposhible feedsettech_monst feedset

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 12/475

todosmart feedsettodosmart nexgadgetthomas_wellkristinedykristinedy todosmartkristinedy thomas_wellertodosmart kristinedy

todosmart philhadjfreedomma marcelobernardmarcelobernnewtechbooksmarcelobernpaulespcforumdemarceloberntodosmartmarcelobernfreedomman11marcelobernmaxoverclockertodosmart marcelobernardtodosmart the_world_newsxbox_updat careerandbizopstodosmart careerandbizopstodosmart newsinreviewssharepointw hiresharepointhiresharepoi sharepointwikigo4answers sharepointwiki jimposhible go4answersana_minas compexwebana_minas compexwebana_minas compexwebitespresso msblogspainmsblogspain appleweblog

msblogspain itespresso javiergm msblogspainwpsitehostingoodcrm javiergm goodcrmoslysilva compexweboslysilva compexweboslysilva compexwebleandroantu compexwebleandroantu compexwebleandroantu compexwebmorgantetti v3_co_ukdushidee mtimmerdushidee mtimmerdennismuld mtimmerdennismuld dannyburlagedind279 compexwebdind279 compexwebdind279 compexwebbluelogicltd greatpcdealsbluelogicltd thetechgang

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 13/475

stclairjohn marknijhof stclairjohn oyvindfanebustoyvindfaneb stclairjohnoyvindfaneb torevestuestorevestues oyvindfanebustoyvindfaneb royosherove

oyvindfaneb marknijhof oyvindfaneb torevestuesipadforumsnallthingsiphonemadly59 simplydabmadly59 clevergaylemadly59 kelley2009simplydab madly59kelley2009 madly59ipadforumsn madly59ipadforumsnshoppingappleipadforumsn ipadfansipadforumsnbloggisitdatanews_nlvvannestevvanneste datanews_nlwpsitehostincrmsoftwaremancrmsoftwarea1softwarecrmsoftware wpsitehostingmikhail_rotc heiflermikhail_rotc heiflermikhail_rotc mohit700geraldebner sheamus

geraldebner train_boygeraldebner latestmp3geraldebner seofundageraldebner thefuturedollarthefuturedolgeraldebnerundergroun eon_techundergroun logixevcomputers_ techsheriff paulespcfor techsheriff techsheriff techbazartechsheriff underground_gtechsheriff paulespcforumdetechsheriff computers_ebookundergroun techsheriff undergroun mkroberts18undergroun darrenstechwiremacethinho ypsilon2macethinho lemehenriquemichaelmccl wpug jimposhible wpug

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 14/475

wpug michaelmcclarywpug xtopiawpug jimposhiblemichaelmccl wpug jaacksonlt compexweb jaacksonlt compexweb

jaacksonlt compexwebthomas_wellhiresharepoint jimposhible hiresharepointhiresharepoi thomas_wellerhiresharepoi a1softwarehiresharepoi jimposhiblehiresharepoi schakespeareschakespear hiresharepointschakespear compatdbthomas_wellvapigiltschakespear vapigiltschakespear gsm_4bd jimposhible technetindoschakespear technetindoschakespear ru_technetcomputers_ mrcomptech jimposhible mrcomptechmrcomptechjimposhibleschakespear mrcomptechschakespear freshwap_netschakespear optimiseit

schakespear optimiseit jimposhible schakespearemsitpro schakespeareschakespear msitproschakespear javiergmschakespear faqshopschakespear jimposhibleschakespear appcraft2schakespear esgratisschakespear 9d0wnschakespear ms_virtfreitasthiago thewindowsclubmaxoverclocyourshoppesimplydab clevergaylesimplydab tkharmonicclevergayle simplydabkelley2009 simplydabtkharmonic simplydabmaxoverclocsimplydabmaxoverclocesgratis

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 15/475

ariannagiovagiantgizmonewsmaxoverclocgiantgizmonewsariannagiovacoolifemaxovercloccoolifemaxovercloc msbillgates12maxoverclocverytecht

agusnadhi s_sherifa_smaxoverclocs_sherifa_smaxoverclocradi8maxovercloc ivenfoxxmlourenco_ compexwebmlourenco_ compexwebwinvistaclub thewindowsclubthewindows winvistaclub javiergm winvistaclubkunal2383 winvistaclubkunal2383 thewindowsclubkunal2383 thewindowsclubkunal2383 microsoftkbthefuturedolunderground_gundergroun thefuturedollarundergroun netsparshundergroun gameplayersgo2tundergroun obsessedgamingobsessedga underground_gcomputers_ maxoverclockera1software maxoverclocker

maxoverclockelley2009maxovercloc9d0wnmaxovercloc ibearabearmaxoverclocsevenforumsmaxovercloc obsessedgamingmaxoverclochenrycowellmaxovercloc feedjunkieobsessedga maxoverclockercomputers_ ariannagiovannicomputers_ obsessedgamingcomputers_ gamingpro101computers_ totaltechnewscomputers_ videogamereportcomputers_ gameaddictorobsessedga computers_ebookxenen82 jennarusexenen82 mikeereddxenen82 bossblogsterbossblogster xenen82 jennaruse xenen82

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 16/475

twitergamer mosquitoboytytwitergamer xbox_updateztwitergamer bossblogstertwitergamer jansanthighlightsga twitergamer jansant twitergamer

bossblogster twitergamermosquitobo twitergamer jennaruse twitergamer jennaruse sabberopiclevergayle tkharmonictkharmonic clevergayle jennaruse tkharmonicinsideaxis videogamereportbossblogster videogamereporttech_monst videogamereport jennaruse videogamereporthighlightsga jennarusetechrss jennarusemosquitobo jennaruse jennaruse highlightsgame jennaruse techrss jennaruse techwatchingatkuwait buhashimbuhashim atkuwaitq80s atkuwaitatkuwait q80s

atkuwait aywaaatkuwait buhashimatkuwait isafat_atkuwait kuwaitmarketingagusnadhi earlyautismearlyautism newtechbooksearlyautism agusnadhiearlyautism eduinovatodosmart en2twps3_4free4u en2twxbox_updat alainaugsburgerps3_4free4u alainaugsburgerwebfadds alltop_seops3_4free4u alltop_seo jimposhible powerguiorgscottmarlow powerguiorgscottmarlow informationweekq80s buhashimbuhashim q80saywaa q80s

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 17/475

q80s isafat_q80s buhashimq80s kuwaitmarketingisafat_ q80saywaa buhashimbuhashim aywaa

aywaa isafat_aywaa buhashimaywaa kuwaitmarketingisafat_ aywaakuwaitmark buhashimisafat_ buhashimkuwaitads buhashimbuhashim isafat_buhashim kuwaitmarketingkuwaitmark buhashimisafat_ buhashimkuwaitmark isafat_isafat_ kuwaitmarketingcreport maartinmoralestaty9950 compexwebtaty9950 compexwebtaty9950 cspontestaty9950 compexwebclaudio_vian taty9950cspontes taty9950claudio_vian compexweb

claudio_vian compexwebclaudio_vian cspontesclaudio_vian compexwebcspontes claudio_viana _everton_to compexweb _everton_to compexweb _everton_to compexweb _everton_to cspontescspontes _everton_toncspontes compexwebcspontes compexwebcspontes compexwebandersonof compexwebandersonof compexwebandersonof compexwebxbox_updat xboxlinksmaxengage xboxlinksxboxlinks maxengagethefuturedolaaronrockeyaaronrockey thefuturedollar

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 18/475

sparklezstar shannonnjamesshannonnja sparklezstarshelenarecife compexwebhelenarecife compexwebhelenarecife compexwebdaringdarlin kensukey

daringdarlin techfieberkuwaitads isafat_laiskopein compexweblaiskopein compexweblaiskopein compexwebdanielegom compexwebdanielegom compexwebangel0610 max88pedromax88pedro angel0610thomas_wellgorocubeariannagiovagorocubef16flightsim gorocubef_pandakun thetechgangdublidublida xbox_updatezdublidublida bossblogsterdublidublida henrycowelldublidublida aceshighmmodublidublida webfaddsdublidublida paulespcforumdexbox_updat dublidublidaagusnadhi dublidublida

bossblogster dublidublidaaceshighmm dublidublidawebfadds dublidublidahenrycowell dublidublidaxbox_updat pulseonmsfthenrycowell pulseonmsfthenrycowell dreamfilmmakershenrycowell latestmp3henrycowell engineercareerhenrycowell alltop_macariannagiova9d0wnhenrycowell 9d0wnomrimaids mbekezmmbekezm omrimaidshenrycowell omrimaidshenrycowell macosxrsscovettes heiseonlinecovettes olegnovikovhenrycowell covetteshenrycowell mbekezm

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 19/475

mosquitobo sherryonline4ups3_4free4u sherryonline4uhenrycowell sherryonline4uquanrel globaltechnewsglobaltechn fosswikiglobaltechn quanrel

fosswiki globaltechnewsagusnadhi globaltechnewstodosmart globaltechnewshenrycowell globaltechnewsxbox_updat sevenforumshenrycowell sevenforumshenrycowell relevantnewsnow jimposhible javiergm javiergm thewindowsclub javiergm ms_virt javiergm a1software javiergm jimposhiblehenrycowell javiergmhenrycowell computergroupshenrycowell cloudcareershenrycowell 1softwaren2tech ms_access_filesfosswiki ms_access_filesagusnadhi ms_access_filesbossblogster ms_access_fileshenrycowell ms_access_files

henrycowell itsviralhenrycowell asraffabhenrycowell mariusoiagaquanrel tech_news_dailytech_news_ proactivedefendtech_news_ techwatchtech_news_ thetechganghenrycowell tech_news_dailyhotdealshea sparklezstarsclevergayle sparklezstarssparklezstar clevergaylehenrycowell sparklezstarsthomas_wellfeedjunkieps3_4free4u feedjunkiehenrycowell feedjunkiehenrycowell games_reviewsariannagiovanetsparshtodosmart netsparshhenrycowell netsparshhenrycowell liketaurus

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 20/475

gameplayerssheamus360it v3_co_uk360it kakroo360it infosec360it roercomitmst71 azu_re

henrycowell sitfuincome007 sitfuthefuturedolps3_4free4uthefuturedolwebdesignmagzthefuturedol income007income007 thefuturedollarsmartmarke income007smartmarke wpsitehostingwpsitehostinsmartmarketing1income007 smartmarketing1profesor4 oswaldo_riososwaldo_rio profesor4itespressofr philippe_laganeitespressofr journaldugeekitespressofr itespressoasslate itespressofrasslate journaldugeekasslate philippe_laganeprem_nilouf eduinovawaltersoftw eduinovaprem_nilouf eduinova

opexxx proactivedefendproactivedef opexxxkakroo proactivedefendkakroo roercomkakroo infoseckakroo opexxxroercom kakrooroercom opexxxmatijakapic masevemaseve matijakapicmatijakapic maseverosepimentt compexwebrosepimentt compexwebrosepimentt compexweb jansant pcdirect2upcdirect2u jansant jimposhible ms_virtfaqshop ms_virt jimposhible appcraft2faqshop appcraft2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 21/475

facegeek journaldugeekfacegeek journaldugeekemilevoogt dushideedannyburlag dushideedushidee dannyburlagedushidee emilevoogt

dushidee renatabignardiemilevoogt dushideenaomi631 wpsitehostingnaomi631 audio_collegewpsitehostinnaomi631audio_colle naomi631bloghosting technationdailyaudio_colle technationdaily jobdenver shoppingappleshoppingappjobdenveragusnadhi seo_rocketwebfadds seo_rocketseo_rocket deeowdeeohseo_rocket webfaddsseo_rocket agusnadhiseo_rocket shoppingappleshoppingappseo_rocketwebfadds deeowdeeohshoppingappdeeowdeeohgreatpcdealsa1softwaregreatpcdealsshoppingapple

greatpcdealshenrycowellxbox_updat greatpcdealshenrycowell greatpcdealsshoppingappgreatpcdealsbossblogster mosquitoboytymosquitobo totaltechnewsmosquitobo talonedgemosquitobo xbox_updatezmosquitobo a1softwaremosquitobo bossblogstermosquitobo shoppingappleshoppingappmosquitoboytyeu_mesmot compexwebeu_mesmot compexwebeu_mesmot compexwebreinvestinfo paulespcforumdeexercise_dai reinvestinfotechrss exercise_dailyexercise_dai techrssolegnovikov internetmarkets

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 22/475

4alldigitalpr a1software4alldigitalpr olegnovikov4alldigitalpr wpsitehosting4alldigitalpr webfaddswpsitehostin4alldigitalprwebfadds 4alldigitalpr

olegnovikov 4alldigitalprmentaltraini cashking1983mentaltraini jansantmentaltraini paulespcforumdementaltraini aceshighmmomentaltraini income007mentaltraini olegnovikovmentaltraini thomas_wellerthomas_wellmentaltraining2 jansant mentaltraining2aceshighmm mentaltraining2cashking198 mentaltraining2income007 mentaltraining2olegnovikov mentaltraining2income007 thomas_wellerolegnovikov income007n2tech webfaddswebfadds n2techolegnovikov n2techyummymasha1softwareolegnovikov yummymashup

allvideogam _kinectgamaken5 _kinecthenrycowell gamaken5gamaken5 a1softwaregamaken5 henrycowellbossblogster aceshighmmoaceshighmm koza4okaceshighmm bossblogsteraceshighmm henrycowellaceshighmm xbox_updatezaceshighmm allvideogamesallvideogam aceshighmmohenrycowell aceshighmmokoza4ok aceshighmmohighlightsga koza4ok jansant koza4okbossblogster koza4okkoza4ok highlightsgamekoza4ok bossblogsterkoza4ok autovolk

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 23/475

koza4ok lusianalokoza4ok ykomparukoza4ok jansantalcheme newtechbooksalcheme robdimaggioolegnovikov alcheme

robdimaggio alchemewpsitehostinrobdimaggiowebfadds robdimaggiodjgraphics_urobdimaggiorobdimaggio paulespcforumderobdimaggio wpsitehostingrobdimaggio newtechbooksrobdimaggio webfaddspaidajulinha compexwebpaidajulinha compexwebpaidajulinha compexwebtech_monst consultjobdatadrill consultjobdatadrill agilemanagementdatadrill informationweek joaopedro_x compexweb joaopedro_x compexweb joaopedro_x decolms joaopedro_x compexwebdecolms joaopedro_xddecolms compexweb

decolms compexwebdecolms compexwebmuycomput yorientomuycomput leadersummaries javier_pc muycomputerudomsak llun jansant udomsakudomsak jansantyoriento jimmyponsleadersumm yorientoyoriento leadersummariesmarycertad creportprofesor4 creportcreport profesor4marycertad creportyoriento creportmarycertad yorientoyoriento marycertadyoriento lcluengoxtopia heiseonline

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 24/475

klischnet xtopiaalexf10 wissenssucherwissenssuch klischnetwissenssuch webfaddswissenssuch alexf10wissenssuch opexxx

webfadds wissenssucherklischnet wissenssucherklischnet heiseonlineapplenewsd paulespcforumdeapplenewsd igetyounewsigetyounews applenewsdailypandakun_f ariannagiovannitechwatch crndailygreg_vdw crndailysolutionspat crndailygreg_vdw vmblogcomgreg_vdw virtualpathsolutionspat greg_vdwopexxx infosecopexxx infosecsolutionspat infosecinsideaxis a1softwareinsideaxis paddlestonefosswiki insideaxistech_monst insideaxishenrycowell insideaxis

solutionspat insideaxissolutionspat softwarexpertvmblogcom solutionspathsolutionspat vmblogcomsolutionspat informationweeksolutionspat virtualpathpunteros yorientoyoriento punterospunteros txaumespunteros yoriento jimposhible msitpromsitpro jimposhiblemsitpro kashyapakashyapa msitprothewindows microsoftkbkashyapa microsoftkbkashyapa royosherovekashyapa royosherovekashyapa thewindowsclubschestowitz v3_co_uk

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 25/475

schestowitz informationweekschestowitz techwebmarcelonov gneumann jquerybot marcelonovaesgneumann marcelonovaes jquerybot gneumann

benzingame nasdaq_100whebson deskmaiscanttim whebsoncantim_org whebsoncanttim deskmaiscanttim cantim_orgcanttim deskmaiscantim_org canttimcantim_org deskmaiscantim_org deskmaistechweb informationweektechweb informationweekinformation techwebalexf10 techfieberalexf10 heiseonlinefosswiki alexf10information alexf10information iknrr jimposhible opexxxopexxx informationweekhenrycowell opexxx

information opexxxfaqshop informationweekgestaltemita dominic_stoiberdominic_stoiheiseonlinegestaltemita dominic_stoibermohit700 bloggisitfreedomma airfare2010 jansant airfare2010agusnadhi airfare2010henrycowell airfare2010olegnovikov airfare2010mohit700 airfare2010cherylsales mohit700mohit700 cherylsalesthomas_wellnewtechbooksthomas_wellfosswikithomas_welltotaltechnewsthomas_wellaudio_collegethomas_wella1softwarethomas_wellmohit700

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 26/475

thomas_wellspeedhotfosswiki thomas_welleraudio_colle thomas_wellermohit700 thomas_wellermohit700 techbazar jimposhible mohit700

tech_monst mohit700mohit700 olegnovikovmohit700 tech_monstermohit700 jimposhibletestgotd75 thewindowsclubclevergayle kelley2009kelley2009 tweet2sweepkelley2009 clevergayletweet2swee kelley2009clevergayle tweet2sweeptweet2swee clevergayleagusnadhi chem_plasttech_monst chem_plastwebfadds chem_plasthenrycowell chem_plastchem_plast tech_monsterchem_plast agusnadhichem_plast webfaddsvworlddotnl vmblogcomvmblogcom virtualpathvworlddotnl vmblogcom

vworlddotnl _ipadforumsnet_ruthvilar yorientoyoriento ruthvilarruthvilar yorientof16flightsim wiizeelswiizeels f16flightsimgeekytechne todosmartbloghosting todosmarttodosmart bloghostingtodosmart techrsstodosmart dailytechnews_todosmart geekytechnewstodosmart wiizeelswiizeels todosmarttechfieber heiseonlinehighlightsga paulespcforumdehighlightsga chloefisher1highlightsga bossblogsterbossblogster highlightsgamechloefisher1 highlightsgame

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 27/475

jansant obsessedgamingallvideogam obsessedgamingobsessedga aboringblogobsessedga jansantchloefisher1 obsessedgamingmarknijhof torevestues

torevestues marknijhof runegri marknijhof runegri torevestuestorevestues runegrirunegri torevestuesrunegri royosherovehotcandidat mcobhotdealshea useridk justgames1 useridkxbox_updat allvideogamesbossblogster allvideogamesallvideogam tech_monsterallvideogam a1softwareallvideogam xbox_updatezallvideogam bossblogsterallvideogam shoppingappleallvideogam webfaddsallvideogam justgames1allvideogam olegnovikovtech_monst allvideogameswebfadds allvideogames

shoppingappallvideogamesolegnovikov allvideogames justgames1 allvideogamestech_monst gamingpro101 justgames1 gamingpro101 justgames1 gameaddictor justgames1 dailytechnews_maxengage webfaddsmaxengage tech_monstermaxengage bossblogstermaxengage henrycowellmaxengage wpsitehostingmaxengage thebeanymaxengage justgames1maxengage a1softwaremaxengage olegnovikovbossblogster maxengagetech_monst maxengagewebfadds maxengagehenrycowell maxengage

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 28/475

olegnovikov maxengage justgames1 maxengagebossblogster wiizeelstech_monst wiizeelswiizeels xbox_updatezwiizeels chloefisher1

wiizeels tech_monsterwiizeels bossblogsterwiizeels justgames1 justgames1 wiizeelshenrycowell sharpie9hukd justgames1 sharpie9hukd jansant totaltechnewsfosswiki totaltechnewsbossblogster totaltechnewswpsitehostintotaltechnewswebfadds totaltechnewsps3_4free4u totaltechnews justgames1 totaltechnews jakky_rodrig compexweb jakky_rodrig compexweb jakky_rodrig compexwebmcob agilemanagementdonca rennon09clickflickca j0scelynmariaalicefa compexwebmariaalicefa compexweb

mariaalicefa compexwebxbox_updat ps3_4free4utechrss ps3_4free4ups3_4free4u techrsshenrycowell ps3_4free4uhansoidolor ps3_4free4u janinharesencompexweb janinharesencompexweb janinharesencompexwebthechannelfi hotnewssthechannelfi kinectgamerbitesizedgee clevergayleconceptiagr yorientoyoriento conceptiagroupconceptiagr yorientotech_monst samarth_infablesamarth_inf tech_monsternilupak techwatchingdj_alle compexwebdj_alle compexweb

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 29/475

dj_alle compexwebandresreitze appleweblogandresreitze appleweblogvivihmoura webdesignmagzhamazy royosherovehenrycowell techwatching

techwatchin ageorageor techwatchingtechwatch ageorageor techwatch jansant chijmestanbossblogster chijmestanwebfadds chijmestanchloefisher1 chijmestanchijmestan webfaddschijmestan paulespcforumdechijmestan jansantolivialow facesearchthetechgang techwatchtechwatch newtechbookspaddlestone techwatchfacesearch techwatchfacesearch thetechgangfosswiki agusnadhiagusnadhi webfaddsagusnadhi tech_monsteragusnadhi yoriento

agusnadhi wpsitehostingagusnadhi lusianaloagusnadhi paulespcforumdetech_monst agusnadhiwpsitehostinagusnadhiwebfadds agusnadhiolegnovikov agusnadhiyoriento agusnadhilusianalo agusnadhifreak_beat lusianalolusianalo freak_beatpaddlestone contactsearchcontactsearcwisdeocontactsearcpaddlestoneakemoi philippe_laganeakemoi journaldugeekmarweb tvnpanamamarweb jansantgacconsulta arnoldwendertechrss aboringblog

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 30/475

techrss speedhotaboringblog techrsshenrycowell aboringblogaboringblog henrycowellroyzilla merloyyroyzilla merloyy

merloyy royzillaroyzilla merloyymerloyy royzillaxbox_updat ibearabearibearabear xbox_updatezbloghosting hindustanhostinhindustanho bloghostingfosswiki wpsitehostingwpsitehostinwebfaddswpsitehostinfosswikiwpsitehostinaudio_collegewebfadds wpsitehostingaudio_colle wpsitehostinghindustanho wpsitehostinghindustanho secureonlineblogging202 secureonlinebestdamnsc secureonlinesecureonlineseofundaseofunda secureonlineblogging202 bestdamnscriptsbestdamnsc seofunda

bestdamnsc blogging2020bestdamnsc hindustanhostinseofunda bestdamnscriptsblogging202 hindustanhostinblogging202 seofundaseofunda blogging2020hindustanho seofundaseofunda hindustanhostincompprogbi polarplatinumpolarplatinu compprogbizmintch 2moto52moto5 mintchmintch 2moto5bossblogster chloefisher1tech_monst chloefisher1audio_colle chloefisher1chloefisher1 audio_collegechloefisher1 carmenhill8chloefisher1 xbox_updatezchloefisher1 tech_monster

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 31/475

chloefisher1 bossblogstercarmenhill8 chloefisher1carmenhill8 thebeanyxbox_updat henrycowellbossblogster henrycowellhenrycowell xbox_updatez

henrycowell talonedgehenrycowell bossblogsterhenrycowell paddlestonehenrycowell wisdeohenrycowell facesearchhenrycowell winappzhenrycowell heiflerhenrycowell agilemanagementhenrycowell audio_collegehenrycowell a1softwareaudio_colle henrycowellolegnovikov henrycowellwisdeo henrycowelltalonedge henrycowellcashking198 talonedgetalonedge cashking1983hotdealshea talonedgetalonedge hotdealsheaven jansant talonedgewebfadds talonedgeaudio_colle talonedge

plaveb webdesignmagzykomparu autovolkykomparu jansant jimposhible raddevelopmentraddevelop jquerybotraddevelop jimposhible jquerybot raddevelopment jimposhible jquerybot jimposhible faqshop jquerybot jimposhiblerostacik jquerybot jquerybot rostacikxbox_updat jquerybot jquerybot xbox_updatezdjgraphics_ujquerybot jquerybot djgraphics_ukviniciussep1 compexwebviniciussep1 compexwebviniciussep1 compexwebkristryx yoriento

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 32/475

yoriento kristryxkristryx profesor4kristryx yorientofosswiki newtechbooksfosswiki agilemanagementagilemanagefosswiki

faqshop virtualpathagilemanagevirtualpathagilemanageisuntanglevicu11 lokalmagasinetlokalmagasi vicu11renatabigna dannyburlagenhaaima dannyburlagedannyburlag nhaaimarenatabigna dannyburlagenhaaima dannyburlagenhaaima renatabignardilordmanley lukosanlukosan lordmanleylordmanley lukosanpaddlestone wisdeopaddlestone newtechbooksnewtechboo paddlestonefacesearch wisdeonewtechboo wisdeofacesearch newtechbooksnewtechboo facesearch

newtechboo mikeeredd jansant audio_collegebossblogster audio_collegetech_monst audio_collegeaudio_colle newtechbooksaudio_colle tech_monsteraudio_colle paulespcforumdeaudio_colle a1softwareaudio_colle bossblogsteraudio_colle jansantaudio_colle shoppingappleshoppingappaudio_collegenewtechboo audio_collegequanrel webdesignmagznewtechboo webdesignmagzwebfadds heiflershoppingappheiflernewtechboo heiflernewtechboo train_boybossblogster tech_monster

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 33/475

tech_monst freedomman11tech_monst newtechbookstech_monst a1softwaretech_monst paulespcforumdetech_monst bossblogsternewtechboo tech_monster

newtechboo zeidelshoppingapppaulespcforumdeshoppingappnewtechbooksshoppingappa1softwarenewtechboo shoppingapplebossblogster jquerybotwebfadds jquerybot jquerybot webfadds jquerybot newtechbooks jquerybot bossblogsternewtechboo jquerybotfaqshop newtechbooksnewtechboo faqshopnewtechboo winappzgeekytechnenewtechbooksgeekytechnepaulespcforumdenewtechboo geekytechnewsfreedomma newtechbooksfreedomma olegnovikovbossblogster freedomman11newtechboo freedomman11

newtechboo quanrelnewtechboo sheamusolegnovikov speedhotolegnovikov newtechbooksnewtechboo olegnovikovbossblogster newtechbookswebfadds newtechbooksnewtechboo webfaddsnewtechboo speedhotnewtechboo paulespcforumdenewtechboo bossblogstertxaumes itespressoyoriento profesor4txaumes profesor4yoriento txaumestxaumes yorientowaltersoftw paulespcforumdebossblogster paulespcforumdewallstpostga paulespcforumdespeedhot webfadds

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 34/475

webfadds speedhotwallstpostga speedhotbossblogster a1softwarebossblogster wallstpostgamewallstpostga bossblogster jansant wallstpostgame

jansant a1softwarewallstpostga jansantwaltersoftw wallstpostgamewallstpostga waltersoftwarewebfadds wallstpostgamewallstpostga webfaddswallstpostga tarmogootwallstpostga a1softwaretricomts therecruiterguydesigner_smcompexwebdesigner_smcompexwebgeneracionmapplewebloggeneracionmipadfans

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 35/475

Other ColumnsAdd Your Own Columns Here Relationship Replies To or Mentions Date

Mentions 2010-07-26T11:47:54ZReplies to 2010-07-26T11:47:54ZMentions 2010-07-26T12:22:18ZMentions 2010-07-26T12:39:14Z

Mentions 2010-07-26T12:39:14ZMentions 2010-07-26T12:40:13ZMentions 2010-07-26T12:40:13ZMentions 2010-07-26T12:41:14ZMentions 2010-07-26T12:41:14ZMentions 2010-07-26T12:41:22ZMentions 2010-07-26T12:41:22ZMentions 2010-07-26T12:41:51ZMentions 2010-07-26T12:41:51ZMentions 2010-07-26T12:42:04ZMentions 2010-07-26T12:42:04ZMentions 2010-07-26T12:44:46ZMentions 2010-07-26T12:55:17ZMentions 2010-07-26T12:55:55ZMentions 2010-07-26T12:55:55ZMentions 2010-07-26T12:57:25ZMentions 2010-07-26T13:00:10ZMentions 2010-07-26T13:07:06ZMentions 2010-07-26T13:13:07ZMentions 2010-07-26T13:13:21ZFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T11:50:20ZFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 36/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T11:59:04ZFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:03:35ZFollowedFollowedMentions 2010-07-26T12:04:00ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 37/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedMentions 2010-07-26T12:06:00ZFollowedFollowedFollowedFollowedMentions 2010-07-26T12:01:20ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 38/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedMentions 2010-07-26T12:14:57ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:21:57ZFollowedFollowedMentions 2010-07-26T12:22:19ZMentions 2010-07-26T12:25:59ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 39/475

FollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:25:59Z

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 40/475

FollowedMentions 2010-07-26T12:29:52ZFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:31:00ZFollowedMentions 2010-07-26T12:18:50ZMentions 2010-07-26T12:31:00ZMentions 2010-07-26T12:42:14ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:31:46ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 41/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:33:58ZFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:34:31ZFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 42/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 43/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:41:07ZMentions 2010-07-26T12:41:07ZFollowedMentions 2010-07-26T12:38:12ZMentions 2010-07-26T12:38:12ZFollowedMentions 2010-07-26T12:38:19Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 44/475

Mentions 2010-07-26T12:38:19ZFollowedMentions 2010-07-26T12:38:24ZMentions 2010-07-26T12:38:24ZFollowedMentions 2010-07-26T12:38:45Z

Mentions 2010-07-26T12:38:45ZFollowedFollowedMentions 2010-07-26T12:38:46ZMentions 2010-07-26T12:38:46ZFollowedMentions 2010-07-26T12:39:04ZMentions 2010-07-26T12:39:04ZFollowedMentions 2010-07-26T12:39:36ZFollowedFollowedFollowedMentions 2010-07-26T11:40:19ZMentions 2010-07-26T12:40:02ZFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:41:42ZMentions 2010-07-26T12:41:42ZFollowedMentions 2010-07-26T12:42:09ZMentions 2010-07-26T12:42:09ZFollowedMentions 2010-07-26T12:42:25ZMentions 2010-07-26T12:42:25ZFollowedFollowedFollowedMentions 2010-07-26T12:42:41ZMentions 2010-07-26T12:42:41Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 45/475

FollowedFollowedFollowedMentions 2010-07-26T12:42:56ZMentions 2010-07-26T12:42:56ZFollowed

Mentions 2010-07-26T12:43:11ZMentions 2010-07-26T12:43:11ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:43:41Z

Mentions 2010-07-26T12:43:41ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 46/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:44:40ZMentions 2010-07-26T12:44:40ZFollowedFollowedFollowed

FollowedFollowedFollowedFollowedMentions 2010-07-26T12:45:00ZMentions 2010-07-26T12:45:00ZFollowedMentions 2010-07-26T12:45:02ZMentions 2010-07-26T12:45:02ZFollowedFollowedMentions 2010-07-26T12:19:18ZFollowedFollowedFollowedMentions 2010-07-26T12:46:10ZMentions 2010-07-26T12:46:10ZFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 47/475

FollowedFollowedFollowedMentions 2010-07-26T12:46:26ZFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:47:39ZFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:48:15ZFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 48/475

FollowedFollowedFollowedFollowedMentions 2010-07-26T12:48:24ZMentions 2010-07-26T12:48:24Z

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:49:09Z

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 49/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedMentions 2010-07-26T12:49:35ZFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:49:43ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 50/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:49:53ZFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:49:10ZFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 51/475

FollowedFollowedFollowedFollowedMentions 2010-07-26T12:48:35ZFollowed

FollowedFollowedFollowedFollowedMentions 2010-07-26T12:50:24ZMentions 2010-07-26T12:50:50ZMentions 2010-07-26T12:52:04ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:38:14ZMentions 2010-07-26T12:38:14ZFollowedFollowedFollowedFollowedMentions 2010-07-26T12:43:03Z

Mentions 2010-07-26T12:43:03ZFollowedFollowedFollowedMentions 2010-07-26T12:38:58ZMentions 2010-07-26T12:38:58ZFollowedFollowedFollowedMentions 2010-07-26T12:51:11ZMentions 2010-07-26T12:51:11ZFollowedMentions 2010-07-26T12:51:14ZMentions 2010-07-26T12:51:14ZFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 52/475

FollowedFollowedMentions 2010-07-26T12:51:51ZMentions 2010-07-26T12:51:51ZFollowedFollowed

FollowedFollowedMentions 2010-07-26T12:53:19ZMentions 2010-07-26T12:53:19ZFollowedMentions 2010-07-26T12:53:31ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:06:30ZFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 53/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 54/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:56:35ZFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:57:00ZFollowedFollowedMentions 2010-07-26T12:57:07ZMentions 2010-07-26T12:57:07ZFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 55/475

Mentions 2010-07-26T12:57:50ZFollowedMentions 2010-07-26T12:58:01ZFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:59:05ZMentions 2010-07-26T12:59:05ZFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 56/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 57/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:00:13ZMentions 2010-07-26T13:00:13ZFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:44:57ZMentions 2010-07-26T12:44:57ZFollowedFollowedFollowedMentions 2010-07-26T13:00:23Z

Mentions 2010-07-26T13:00:23ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:13:38ZFollowedMentions 2010-07-26T12:55:18ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 58/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:19:22ZFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:02:09ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:02:25ZFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 59/475

FollowedFollowedMentions 2010-07-26T13:08:49ZMentions 2010-07-26T13:13:04ZFollowedMentions 2010-07-26T13:13:04Z

FollowedMentions 2010-07-26T13:03:07ZFollowedFollowedMentions 2010-07-26T13:02:34ZFollowedFollowedFollowedMentions 2010-07-26T13:02:57ZFollowedMentions 2010-07-26T12:34:14ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedMentions 2010-07-26T13:03:28ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 60/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:05:11ZFollowedFollowed

FollowedMentions 2010-07-26T13:05:21ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 61/475

FollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:40:44Z

FollowedFollowedMentions 2010-07-26T13:05:52ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 62/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:06:18ZMentions 2010-07-26T13:06:18ZFollowedFollowedFollowedFollowedMentions 2010-07-26T13:06:40ZMentions 2010-07-26T13:06:40Z

FollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:07:35ZMentions 2010-07-26T13:07:35ZFollowedFollowedFollowedFollowedMentions 2010-07-26T13:08:32ZFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:09:06ZMentions 2010-07-26T13:09:06Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 63/475

FollowedMentions 2010-07-26T13:09:12ZFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 64/475

FollowedFollowedFollowedFollowedMentions 2010-07-26T13:09:37ZReplies to 2010-07-26T13:09:37Z

Mentions 2010-07-26T13:11:04ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:12:15ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 65/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:13:11ZMentions 2010-07-26T13:13:11ZFollowedMentions 2010-07-26T13:13:11Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 66/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T12:54:48ZMentions 2010-07-26T13:13:32ZFollowedFollowedFollowedFollowedMentions 2010-07-26T13:13:42ZFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 67/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 68/475

FollowedFollowedFollowedFollowedFollowedFollowed

FollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedFollowedMentions 2010-07-26T13:14:29ZFollowedFollowedFollowed

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 69/475

Visual Properties Labels

Vertex Color Shape Size OpacityImageFile Visibility Label

Label FillColor

LabelPosition

yohan_b http://a0.twimg.com/profile_images/1083648616/Capturealexizzz http://a0.twimg.com/profile_images/1077622132/148615ttaonline http://a2.twimg.com/profile_images/995059442/4b6d784

sichelputzer http://a3.twimg.com/profile_images/1067262163/twitter_livia_promo http://a3.twimg.com/profile_images/984537005/SAM_010compexweb http://a2.twimg.com/profile_images/541618662/compex_ivan_alvarenga http://a1.twimg.com/profile_images/1019810665/form_nfadinhanurse29 http://a0.twimg.com/profile_images/1081896832/msn_noromeuvsjr http://a0.twimg.com/profile_images/996172108/DSC0024huany_ http://a3.twimg.com/profile_images/1081797391/2_normnatajustin http://static.twitter.com/images/default_profile_normal.pdanfalconer http://a0.twimg.com/profile_images/221564076/DSCF025eon_tech http://a1.twimg.com/profile_images/507525189/EONRSSictcarothers http://a2.twimg.com/profile_images/724646614/n5917089to5mac http://a2.twimg.com/profile_images/656366314/ninetofivistelaemila http://a0.twimg.com/profile_images/1020169664/Fiquei_nabidka http://s.twimg.com/a/1279831293/images/default_profile

informationweek http://a2.twimg.com/profile_images/626843834/IW_logo_esgratis http://a0.twimg.com/profile_images/848917352/logo_normskadu http://a0.twimg.com/profile_images/118460728/mskadu_billyriantono http://a1.twimg.com/profile_images/899242053/n104282technetindo http://a0.twimg.com/profile_images/866250424/logoTNtwtriomis http://a0.twimg.com/profile_images/827330916/triomis72silicon_de http://a1.twimg.com/profile_images/200099480/silicon-delokalmagasinet http://a1.twimg.com/profile_images/737944896/lmlogo1_dagens_nyheter http://s.twimg.com/a/1279322210/images/default_profiletech_answers http://s.twimg.com/a/1279901730/images/default_profile

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 70/475

go4answers http://a0.twimg.com/profile_images/1067226896/questiosharepointwiki http://a1.twimg.com/profile_images/1077891501/questioandre_wilcox http://s.twimg.com/a/1279322210/images/default_profilewebdesignmagz http://a3.twimg.com/profile_images/847318051/WebDesidynamomike http://a2.twimg.com/profile_images/1040981838/untitledlefty22 http://a2.twimg.com/profile_images/798335014/img2010-

naomi631 http://s.twimg.com/a/1278724399/images/default_profilezebrawebdesign http://a0.twimg.com/profile_images/335894952/zebraweb

rhettu http://a3.twimg.com/profile_images/983337839/rhett_notraviata_ms_crm http://a1.twimg.com/profile_images/760427446/Traviata- javiergm http://a0.twimg.com/profile_images/781549008/twitterPr

gbardakis http://a1.twimg.com/profile_images/794273017/n143490ageor http://a1.twimg.com/profile_images/539718637/P515005

thomas_weller http://a3.twimg.com/profile_images/378882375/Thomas-

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 71/475

__fury http://a3.twimg.com/profile_images/405959037/P720015

net2 http://a3.twimg.com/profile_images/67722515/images_nodarenbbc http://a3.twimg.com/profile_images/1084555771/sleepin_phaneeshn http://a3.twimg.com/profile_images/789289885/0383_gui

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 72/475

tonsofgold http://a3.twimg.com/profile_images/637899153/blog_nor

frankguillen http://a2.twimg.com/profile_images/719570770/frankguillcristiedrake http://a3.twimg.com/profile_images/976461079/suzie-chabeckiealder http://a0.twimg.com/profile_images/976537368/becky-alddarrenharford http://a1.twimg.com/profile_images/980109913/darren-hdaleswinton http://a0.twimg.com/profile_images/949636736/dale-swinbloggodown http://a2.twimg.com/profile_images/464924062/blog-godtheplotlessplot http://a2.twimg.com/profile_images/712519386/8825_11aditi_tech http://a2.twimg.com/profile_images/859884894/aditi_ico

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 73/475

dougneiner http://a1.twimg.com/profile_images/377002585/FBI-Dougbillschrier http://a3.twimg.com/profile_images/882728621/William_xbox_updatez http://a0.twimg.com/profile_images/510456888/xbox_nortechshout http://s.twimg.com/a/1278188204/images/default_profilecomputers_ebook http://a2.twimg.com/profile_images/1084468426/index_nsukhikh http://s.twimg.com/a/1279901730/images/default_profile

dhilipsiva_aple http://a3.twimg.com/profile_images/1071461137/DhilipSi

comp_softwares http://s.twimg.com/a/1279901730/images/default_profileundergroundi http://a1.twimg.com/profile_images/489189501/logo_nor

djtarek http://a1.twimg.com/profile_images/805383818/Bot_nor journaldugeek http://a1.twimg.com/profile_images/205948476/logo-typefedi2 http://a2.twimg.com/profile_images/414189470/yellow_tskuswanto http://a0.twimg.com/profile_images/472773592/avatar_h

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 74/475

cvasqu1 http://a3.twimg.com/profile_images/66258519/chris_profi

mycleverfriend http://s.twimg.com/a/1279901730/images/default_profileopensourcefeeds http://a1.twimg.com/profile_images/618742844/osdc_def arsenalpcinput http://a2.twimg.com/profile_images/897814658/input_logarsenalpccamera http://a1.twimg.com/profile_images/897640289/camera_lschoe22 http://a1.twimg.com/profile_images/1071248012/rene2_nrohy http://a0.twimg.com/profile_images/800440396/rohypnoliknrr http://a3.twimg.com/profile_images/669993755/1111twitapplefeeds http://a2.twimg.com/profile_images/63558066/applefeedinsideaxis http://a1.twimg.com/profile_images/1033611813/LinkedInnalle09 http://a3.twimg.com/profile_images/460090499/DSCN130downloadbox http://a3.twimg.com/profile_images/404028343/indonesiasteakhachai http://a3.twimg.com/profile_images/257234103/Avatar_nariannagiovanni http://a0.twimg.com/profile_images/1046028012/iStock_0ipadforums_net http://s.twimg.com/a/1279322210/images/default_profiledspade123 http://s.twimg.com/a/1279901730/images/default_profile

stechnology http://a1.twimg.com/profile_images/434210941/sm_facebtecnotruco http://a3.twimg.com/profile_images/913839675/image_nhrlockerusa http://a1.twimg.com/profile_images/1014203873/Screen_thetechgang http://a3.twimg.com/profile_images/475365811/Tech_norcloudcareers http://a3.twimg.com/profile_images/477964787/CloudCarsoftwarexpert http://s.twimg.com/a/1279901730/images/default_profilemaramos228 http://a0.twimg.com/profile_images/1087566588/perfil_tyoriento http://a3.twimg.com/profile_images/1064552467/AAG-EBprofesor4 http://a1.twimg.com/profile_images/554550461/pita_nordebsuvra http://a2.twimg.com/profile_images/1082628022/Avatar5thewindowsclub http://a0.twimg.com/profile_images/658406452/twitterPr jimposhible http://a3.twimg.com/profile_images/805282793/pwf-twittciscloud http://a2.twimg.com/profile_images/891270866/Cisco_noo_oliv http://a0.twimg.com/profile_images/1087623560/image_facegeek http://a1.twimg.com/profile_images/893429989/icon_norsusangorham http://a1.twimg.com/profile_images/313184624/Gorham_grossmendelsohn http://a3.twimg.com/profile_images/586991693/Gross_Mmsdynamicsgp http://a0.twimg.com/profile_images/326450244/logo_foraspexperts http://s.twimg.com/a/1279901730/images/default_profile jansant http://a3.twimg.com/profile_images/97524751/DSC04588

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 75/475

hotnewstory http://a3.twimg.com/profile_images/1081267091/paper_oglobaltechnews http://a1.twimg.com/profile_images/636818458/twitter_n jrsaba http://a1.twimg.com/profile_images/103796410/n582261hotnewsstory http://a2.twimg.com/profile_images/1080656054/paper_o

smartmarketing1 http://s.twimg.com/a/1278630136/images/default_profilegiantgizmonews http://s.twimg.com/a/1278724399/images/default_profiletechbazar http://a1.twimg.com/profile_images/1081271761/title_1_kittuk http://a3.twimg.com/profile_images/487724383/image_n

rerolin http://a3.twimg.com/profile_images/871783947/default_plbnp http://a2.twimg.com/profile_images/51603234/kuma-hakmucho_hambre http://a2.twimg.com/profile_images/774553990/biglogo_wspresso http://a3.twimg.com/profile_images/92946055/wss_xing0heiseonline http://a1.twimg.com/profile_images/349399572/heiseonlicovettes http://a1.twimg.com/profile_images/628258341/twitter_clacafila http://a2.twimg.com/profile_images/1084923186/ecyu2wfollowerback http://a0.twimg.com/profile_images/1039433476/bg_norpaulespcforumde http://a1.twimg.com/profile_images/185999352/PPF_73-2

rodrigobreck http://a0.twimg.com/profile_images/1025010048/avatar_braulioareis http://a3.twimg.com/profile_images/842716043/34_normappleweblog http://a0.twimg.com/profile_images/370066208/hipertextfaresf http://a1.twimg.com/profile_images/769994409/Me2_normobilecnews http://a3.twimg.com/profile_images/754082899/profil_no

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 76/475

maxengage http://a2.twimg.com/profile_images/827029110/maxengabuzzistic http://a1.twimg.com/profile_images/845562357/avatar_trigeraldebner http://a3.twimg.com/profile_images/1058516751/EB_gr_nsuperbhancho http://a3.twimg.com/profile_images/1011814803/images_ _misternox http://a0.twimg.com/profile_images/1061790888/misternfreie_meinung http://a2.twimg.com/profile_images/397824074/logo-freieshortestnews http://a3.twimg.com/profile_images/494771775/news_noana7lo0o http://a2.twimg.com/profile_images/547702142/8935_12waltersoftware http://a3.twimg.com/profile_images/128860501/624_nor

twittlernen http://a3.twimg.com/profile_images/862507035/twttlernlxtopia http://a0.twimg.com/profile_images/852348040/just_the_pcserviceberlin http://a1.twimg.com/profile_images/228541378/logo_nornewtechbooks http://a1.twimg.com/profile_images/1067058169/girl-boora_caesar http://a3.twimg.com/profile_images/1038704939/tim_prowebgadgets4life http://a1.twimg.com/profile_images/1065173180/icone_bibestblogposts http://s.twimg.com/a/1279901730/images/default_profiletechriotnet http://a1.twimg.com/profile_images/1032466517/iconlogonettechnews http://a3.twimg.com/profile_images/951234891/bluerss-m

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 77/475

techwatch http://a2.twimg.com/profile_images/118338486/FotoFlexcongadgets http://a3.twimg.com/profile_images/352478275/gadget-wspeedhot http://a0.twimg.com/profile_images/606016880/sol_norm

grafdomtech http://a1.twimg.com/profile_images/727427801/icon_big

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 78/475

fosswiki http://a1.twimg.com/profile_images/302423400/boxee_nmainboardernews http://a2.twimg.com/profile_images/499758118/rechteckn3rve http://a0.twimg.com/profile_images/1083898560/Otowo_windowsnewsinfo http://a3.twimg.com/profile_images/654786155/7new_nohtcdev http://a1.twimg.com/profile_images/843735976/htc-evo-4midox69 http://a2.twimg.com/profile_images/1007721954/espana_itshooter http://a3.twimg.com/profile_images/1038699759/TK_nor

powerumc http://a0.twimg.com/profile_images/1087702308/426784it_world_news http://a2.twimg.com/profile_images/1017089114/______buzzurls http://a1.twimg.com/profile_images/298249788/Picture_1teviant http://s.twimg.com/a/1279171689/images/default_profilevitalvas http://a2.twimg.com/profile_images/986519978/5308b04

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 79/475

iamchuckharris http://a3.twimg.com/profile_images/900728635/Chuckie_clickflickca http://a2.twimg.com/profile_images/208013234/jo1_norm jakespizer http://a0.twimg.com/profile_images/980122924/jake-spizcareerandbizops http://a2.twimg.com/profile_images/991099878/group-of-terencedunstan http://a2.twimg.com/profile_images/980151822/terence-dtarmogoot http://a1.twimg.com/profile_images/1075632865/Tarmo2

izhastro http://a3.twimg.com/profile_images/586012231/4004_nor

avmind http://a3.twimg.com/profile_images/908677803/social_m

dushidee http://a0.twimg.com/profile_images/1072613708/Perlita3dannyburlage http://a0.twimg.com/profile_images/1074248252/HAARLEmtimmer http://a0.twimg.com/profile_images/953690000/marcelt_buzz_apple http://a0.twimg.com/profile_images/783042472/zure_appshoppingapple http://a2.twimg.com/profile_images/659987426/Shoppingninob http://a1.twimg.com/profile_images/716409205/twitterPrwpug http://a0.twimg.com/profile_images/843491700/phone_nmysticgeek http://a1.twimg.com/profile_images/135591078/mysticgeagusnadhi http://a0.twimg.com/profile_images/464781812/tn_100_0xpertron http://a3.twimg.com/profile_images/285608311/Xpertron2itterist http://a0.twimg.com/profile_images/508141112/phoenix_wissenssucher http://a1.twimg.com/profile_images/1077958801/Wissensschmeet http://a0.twimg.com/profile_images/855842324/twitterPrpptconverter http://a1.twimg.com/profile_images/473638876/images_nhiresharepoint http://s.twimg.com/a/1279322210/images/default_profileanswers9 http://a2.twimg.com/profile_images/1087370618/aaa_norkunal2383 http://a3.twimg.com/profile_images/1087426887/Kunal_Cmkroberts18 http://a1.twimg.com/profile_images/599220161/gal_whit

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 80/475

cube_ice http://s.twimg.com/a/1279901730/images/default_profilemsitpro http://a3.twimg.com/profile_images/767798199/microsoftmslearningindia http://a0.twimg.com/profile_images/852613816/twiit-logomicrosoftkb http://a3.twimg.com/profile_images/1038250239/MSKB_Lsoftposts http://a0.twimg.com/profile_images/694617204/Best_20Hfilegame http://s.twimg.com/a/1278188204/images/default_profilegameblogfr http://a2.twimg.com/profile_images/256946570/Croix_48matiere http://a3.twimg.com/profile_images/858792955/maru_1_allvideogames http://a2.twimg.com/profile_images/680573418/joystick_watchgleeczcc http://s.twimg.com/a/1278960292/images/default_profile

iw_it_jobs http://a1.twimg.com/profile_images/610103689/IWlogo73infoweeksmb http://a3.twimg.com/profile_images/956493655/Informatinithinr6 http://a3.twimg.com/profile_images/772524487/nram5_nxenen82 http://s.twimg.com/a/1279901730/images/default_profileanoun http://a3.twimg.com/profile_images/385990659/xbox_norbossblogster http://a1.twimg.com/profile_images/740474764/techno_nmosquitoboyty http://a2.twimg.com/profile_images/359152950/bombermsnobstweet http://a1.twimg.com/profile_images/400793760/avatar_ndublidublida http://a0.twimg.com/profile_images/750357436/thumbsutweetnatal http://a1.twimg.com/profile_images/742470853/tn-icon_nisecadviser http://s.twimg.com/a/1278960292/images/default_profilethreatfeed http://s.twimg.com/a/1279901730/images/default_profileitflash http://a1.twimg.com/profile_images/674237177/itf01_norebayomaniac http://a2.twimg.com/profile_images/79744934/Untitled-1

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 81/475

techrss http://a3.twimg.com/profile_images/54401195/1970_norpreistest http://s.twimg.com/a/1278188204/images/default_profilechezpax http://a3.twimg.com/profile_images/1064108013/DSC_07faqshop http://a0.twimg.com/profile_images/611340236/FAQShop

newsquelle http://a2.twimg.com/profile_images/732271762/news_zei9d0wn http://s.twimg.com/a/1278021155/images/default_profileproactivedefend http://a1.twimg.com/profile_images/374230004/Pic_normtechnoworldnews http://a1.twimg.com/profile_images/1016210517/Technod1ndonlyzr101 http://a1.twimg.com/profile_images/1048018945/27370_onlinehardware1 http://a2.twimg.com/profile_images/1043049642/10_noropenhouseboston http://a1.twimg.com/profile_images/994128425/small_no

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 82/475

ikroh http://a0.twimg.com/profile_images/988979172/Ikroh_sqalltop_seo http://a2.twimg.com/profile_images/391216966/IloveAlltoteliaco http://a0.twimg.com/profile_images/293715500/logo_telithebeany http://a2.twimg.com/profile_images/861045078/thebeanyronaldperkins02 http://a2.twimg.com/profile_images/525833934/ronaldperevesbyseller http://a2.twimg.com/profile_images/246350150/revesbysaskoli http://a3.twimg.com/profile_images/774246947/askoli_loitespressofr http://a2.twimg.com/profile_images/574579890/mini-logotsrr http://a1.twimg.com/profile_images/694064253/twitterPrwindowsfrance http://a1.twimg.com/profile_images/715595121/avatar_v

enricorausa http://s.twimg.com/a/1279901730/images/default_profilesocialflumedia http://a1.twimg.com/profile_images/683233149/Screen_smichiganhill http://a1.twimg.com/profile_images/870364372/Michiganpelushitaliani http://a0.twimg.com/profile_images/683043280/tecnologi

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 83/475

jalansaket http://a1.twimg.com/profile_images/767449853/DSC0367 jeromekrussell http://a1.twimg.com/profile_images/763907821/jerome-rquanrel http://a1.twimg.com/profile_images/384736169/qtechloghotdealsheaven http://a3.twimg.com/profile_images/909236317/Dock_norview_zaa http://a1.twimg.com/profile_images/840672545/twitterPrkenniegonzalez http://a3.twimg.com/profile_images/1082630483/140798creport http://a0.twimg.com/profile_images/982007964/6344456engeldvh http://a0.twimg.com/profile_images/416064844/iu_1776_

mariusoiaga http://a1.twimg.com/profile_images/888972062/marius20siliconnews http://a1.twimg.com/profile_images/671100282/logo_-_silmsblogspain http://a3.twimg.com/profile_images/669006103/ms-para-tgsiibert http://a0.twimg.com/profile_images/1073002404/Gus03_itespresso http://a3.twimg.com/profile_images/263750919/mini-logodatanews_nl http://a1.twimg.com/profile_images/628212624/Data_Nelewispr_be http://a3.twimg.com/profile_images/455667479/twitter_ichalosreach http://a2.twimg.com/profile_images/866442354/tt_normaownamatic http://a2.twimg.com/profile_images/458447482/GBavataraceshighmmo http://a1.twimg.com/profile_images/801353758/ace2_norniklasrde http://a0.twimg.com/profile_images/598865440/DSC0016microsofthilft http://a2.twimg.com/profile_images/958664342/MSHilft_technet_de http://a1.twimg.com/profile_images/918675738/briefmarxbox_rocks http://a1.twimg.com/profile_images/200809296/xboxpic_

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 84/475

en2tw http://a1.twimg.com/profile_images/69026556/newsdog_twitergamer http://a1.twimg.com/profile_images/251488573/me_normxboxgirlie http://s.twimg.com/a/1279901730/images/default_profilecheapxbox360 http://a1.twimg.com/profile_images/385472792/title_normywebby http://a3.twimg.com/profile_images/777282087/mywebbynewstalk24 http://s.twimg.com/a/1278724399/images/default_profilemax88pedro http://a0.twimg.com/profile_images/649871376/m_bd6f1angel0610 http://a2.twimg.com/profile_images/669504398/0_1fb4b_artdrivernews http://a1.twimg.com/profile_images/1083741033/Picture_

mvdgender http://a2.twimg.com/profile_images/1072333550/9293ecrenatabignardi http://a3.twimg.com/profile_images/661098571/foto_renmentaltraining2 http://a2.twimg.com/profile_images/180628262/chinese_l

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 85/475

emailhosting http://a2.twimg.com/profile_images/109621510/2logo2_n

bloghosting http://a2.twimg.com/profile_images/107211394/oli3.0_notuinimary http://a2.twimg.com/profile_images/617610002/flower_n

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 86/475

clevergayle http://a0.twimg.com/profile_images/1065203380/87e4e7kelley2009 http://a1.twimg.com/profile_images/903427845/Kaden_atimelesscodes http://a1.twimg.com/profile_images/788674250/Passfotophilseitig http://a0.twimg.com/profile_images/842934860/logo_nor

gagdetman http://a1.twimg.com/profile_images/542170622/Apple_iPlindalim22 http://a2.twimg.com/profile_images/1031818646/3314_1world_policy http://a0.twimg.com/profile_images/481487584/twitter-bidigital_dale http://a0.twimg.com/profile_images/88600636/Dale2_noradvadforum http://a1.twimg.com/profile_images/1050110557/logo2c_salivates http://a1.twimg.com/profile_images/414961737/images_n

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 87/475

tech_monster http://s.twimg.com/a/1278724399/images/default_profileymerej http://a3.twimg.com/profile_images/661900193/Jays_Avattechfieber http://a3.twimg.com/profile_images/75720871/twitter_tf alexf10 http://a0.twimg.com/profile_images/389279832/lifeevy_n

lando411 http://a0.twimg.com/profile_images/68516188/mouse_loolegnovikov http://a0.twimg.com/profile_images/574131112/OlegNovitotaltechnews http://a0.twimg.com/profile_images/342773916/0410270desktopx http://s.twimg.com/a/1279901730/images/default_profiletrippbraden http://a0.twimg.com/profile_images/845801952/twitter_n

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 88/475

ebespiloy http://a3.twimg.com/profile_images/286800685/EdwinLo

pleccotech http://a1.twimg.com/profile_images/418369713/symbol_nctandroid http://a0.twimg.com/profile_images/853030972/CT_andro

ijonbrown http://a2.twimg.com/profile_images/737016138/Brown_J

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 89/475

ronsimon http://a0.twimg.com/profile_images/191587688/ron_atellda52543 http://a2.twimg.com/profile_images/283927330/IMG_903zeidel http://a1.twimg.com/profile_images/929346277/richmgmtwpsitehosting http://a3.twimg.com/profile_images/434196167/wplogo_techkaori5 http://s.twimg.com/a/1279750718/images/default_profilecustomwebdev http://s.twimg.com/a/1279901730/images/default_profilebppathak http://a0.twimg.com/profile_images/949539276/26304_1webfadds http://a3.twimg.com/profile_images/397172785/webfadd

chemindia http://s.twimg.com/a/1279901730/images/default_profilemanderson_jobs http://a0.twimg.com/profile_images/333634020/bently_gta1software http://a2.twimg.com/profile_images/314194510/futuramacherylsales http://a2.twimg.com/profile_images/519369526/12b_nor

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 90/475

jobsadda http://a0.twimg.com/profile_images/92532444/J_normal.j

simple2go http://a1.twimg.com/profile_images/482158681/logo_norde_124 http://a3.twimg.com/profile_images/761740083/Computeitsviral http://a1.twimg.com/profile_images/447722793/A_Comprms_access_files http://a3.twimg.com/profile_images/413094823/BobHeiflsolutionspath http://a1.twimg.com/profile_images/736556878/avt_normcrndaily http://a2.twimg.com/profile_images/1083909146/CRN_nowebwhy http://a1.twimg.com/profile_images/935364837/webwhytreyalvarez http://a2.twimg.com/profile_images/980135506/trey-alvar

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 91/475

farzand_ali_548 http://static.twitter.com/images/default_profile_normal.pgacconsultants http://a1.twimg.com/profile_images/1083550381/123_noropenthink2 http://a2.twimg.com/profile_images/267924270/rednotes

kristinedy http://a0.twimg.com/profile_images/361444020/000j051

kjltechnology http://a1.twimg.com/profile_images/604391405/gadgets_

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 92/475

tech_news_daily http://a2.twimg.com/profile_images/362047178/tech_nemsjessej3 http://a1.twimg.com/profile_images/740841961/u272958

free3gmobiles http://a1.twimg.com/profile_images/746004309/twitterPrwhebson http://a0.twimg.com/profile_images/343175204/whebsontwitlounge http://a2.twimg.com/profile_images/722339110/csc34_no jacksdunn http://a1.twimg.com/profile_images/708558541/images_2relevantnewsnow http://a3.twimg.com/profile_images/744810103/images_nmobiledealstop http://a3.twimg.com/profile_images/649947835/twlogo_nbpa_investments http://a2.twimg.com/profile_images/243679318/bpa_nor

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 93/475

seo_rocket http://a1.twimg.com/profile_images/349636589/seo-iconopexxx http://a2.twimg.com/profile_images/303774966/3124604 jobdenver http://s.twimg.com/a/1279649509/images/default_profilecomputergroups http://s.twimg.com/a/1278188204/images/default_profilesamarth_infable http://a1.twimg.com/profile_images/597266797/sam_pic_

kasumani http://a2.twimg.com/profile_images/958717362/_____norkensukey http://a3.twimg.com/profile_images/620280151/n109641bcgmarkg http://a0.twimg.com/profile_images/720366132/mark_4_bcg_systems http://a1.twimg.com/profile_images/326477565/Untitled-ewst43 http://a1.twimg.com/profile_images/1042750582/720px-Flst44tavares http://static.twitter.com/images/default_profile_normal.pmarcellwsa http://a2.twimg.com/profile_images/825556346/DSC0006bebelaalves http://a2.twimg.com/profile_images/1045685802/gatinhotoxic_leo http://a2.twimg.com/profile_images/937696526/maya_02

cspontes http://a2.twimg.com/profile_images/1001618318/33_ANO

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 94/475

emanuelviolin http://static.twitter.com/images/default_profile_normal.pdodas_50 http://a3.twimg.com/profile_images/968663883/63d2856

jlarrauri http://a1.twimg.com/profile_images/810760257/jimmyBlogoodcrm http://a1.twimg.com/profile_images/116187782/g1_norm

allthingsiphone http://a0.twimg.com/profile_images/82311952/3g-iphonecrimsonium http://a2.twimg.com/profile_images/1021590046/FM10-6microsoftkb1 http://a3.twimg.com/profile_images/1038317529/MSKB_Lrsj2000mrs http://a3.twimg.com/profile_images/1065207919/83e66f8madly59 http://a2.twimg.com/profile_images/860580454/ME_NUR

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 95/475

texasl8dy http://a3.twimg.com/profile_images/693684499/Texas-flasimplydab http://a0.twimg.com/profile_images/1064881176/28606cxredemptor http://a2.twimg.com/profile_images/1059223786/x_normmariliagf http://a1.twimg.com/profile_images/960799686/8427df1eloslemes http://a0.twimg.com/profile_images/930001348/10_normprofmarise http://a1.twimg.com/profile_images/975748202/DSC0511

eduinova http://a1.twimg.com/profile_images/774452977/lampadakaahesonnix3_ http://static.twitter.com/images/default_profile_normal.pwizmole http://a3.twimg.com/profile_images/823124187/Wizmolehenrycowell http://a3.twimg.com/profile_images/840196763/henrycohenrisacramento http://a1.twimg.com/profile_images/560909045/eu_normcibele_lsm http://a0.twimg.com/profile_images/1045492476/eu_nortrust_it http://a0.twimg.com/profile_images/637910176/logo-whitfreedomman11 http://a0.twimg.com/profile_images/457955096/Tom-2_ninfo4sheff http://s.twimg.com/a/1279228556/images/default_profiletikkita77 http://static.twitter.com/images/default_profile_normal.pmonster_follow http://a1.twimg.com/profile_images/897765856/dragon_n

web20latest http://a2.twimg.com/profile_images/760207058/icon_128todosmart http://a3.twimg.com/profile_images/968776819/todosma

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 96/475

carbide25 http://a0.twimg.com/profile_images/585578340/Cabide20netsparsh http://a3.twimg.com/profile_images/714055751/NetSparsfeedset http://a3.twimg.com/profile_images/933277913/feedset-inexgadget http://a2.twimg.com/profile_images/291520802/twitter_nphilhadj http://a1.twimg.com/profile_images/828297490/philhadj_

marcelobernard http://a1.twimg.com/profile_images/501127673/twitterPr

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 97/475

maxoverclocker http://a1.twimg.com/profile_images/1084441657/hoi_northe_world_news http://a3.twimg.com/profile_images/932413851/euraeka_newsinreviews http://s.twimg.com/a/1279228556/images/default_profileana_minas http://a2.twimg.com/profile_images/1083619682/eu_niveoslysilva http://a3.twimg.com/profile_images/1077909847/Rio_de_leandroantuness http://a2.twimg.com/profile_images/378395150/leo_normmorgantetti http://a1.twimg.com/profile_images/67015229/myamd_nv3_co_uk http://a1.twimg.com/profile_images/269452272/V3-crop_dennismulder http://a0.twimg.com/profile_images/1061697516/1b421ddind279 http://a0.twimg.com/profile_images/410151480/nova_norbluelogicltd http://a3.twimg.com/profile_images/689198295/highres_

greatpcdeals http://a2.twimg.com/profile_images/296264910/blwmn_nstclairjohn http://a0.twimg.com/profile_images/20227752/SpainHeadmarknijhof http://a3.twimg.com/profile_images/423279069/MarkNijhoyvindfanebust http://a3.twimg.com/profile_images/349228693/me_normtorevestues http://a1.twimg.com/profile_images/60661973/tore_vesturoyosherove http://a1.twimg.com/profile_images/671984594/DSCF064ipadforumsnet http://a3.twimg.com/profile_images/996180147/hardwareipadfans http://a1.twimg.com/profile_images/659190878/ipad_norbloggisit http://a1.twimg.com/profile_images/985383478/tiger_forvvanneste http://a3.twimg.com/profile_images/1087714283/vvannescrmsoftwareman http://a1.twimg.com/profile_images/876379185/Monoplymikhail_rotckin http://s.twimg.com/a/1278724399/images/default_profileheifler http://a3.twimg.com/profile_images/282748559/Compresmohit700 http://a1.twimg.com/profile_images/748019305/Photo_00sheamus http://a3.twimg.com/profile_images/435152597/sgb_jn_n

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 98/475

train_boy http://s.twimg.com/a/1279901730/images/default_profilelatestmp3 http://s.twimg.com/a/1278724399/images/default_profileseofunda http://a0.twimg.com/profile_images/492306180/seofundathefuturedollar http://a0.twimg.com/profile_images/1050909560/Lei_Cainunderground_g http://a1.twimg.com/profile_images/1050311865/Ugn_prlogixev http://a3.twimg.com/profile_images/850639727/logix-esl-

techsheriff http://a1.twimg.com/profile_images/1083718729/TechShe

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 99/475

darrenstechwire http://a0.twimg.com/profile_images/584124852/95171_Tmacethinho http://a2.twimg.com/profile_images/1062940954/twitterf ypsilon2 http://a3.twimg.com/profile_images/627692011/id-03_nolemehenrique http://a2.twimg.com/profile_images/654194894/leme2_nmichaelmcclary http://a3.twimg.com/profile_images/362464279/mm_nor jaacksonlt http://static.twitter.com/images/default_profile_normal.pschakespeare http://a1.twimg.com/profile_images/1042437493/img_05

compatdb http://a3.twimg.com/profile_images/921198729/compatdvapigilt http://a2.twimg.com/profile_images/1016210442/paulrangsm_4bd http://s.twimg.com/a/1278188204/images/default_profileru_technet http://a3.twimg.com/profile_images/1054735571/TN_normrcomptech http://s.twimg.com/a/1279819768/images/default_profilefreshwap_net http://s.twimg.com/a/1279322210/images/default_profileoptimiseit http://a1.twimg.com/profile_images/773149805/OptimiseIappcraft2 http://a2.twimg.com/profile_images/682959658/Downloams_virt http://a3.twimg.com/profile_images/391521327/MS_Virt_freitasthiago http://a2.twimg.com/profile_images/388171302/informati

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 100/475

yourshoppe http://a0.twimg.com/profile_images/248270536/photo_bitkharmonic http://a3.twimg.com/profile_images/681633305/7_normal

coolife http://a0.twimg.com/profile_images/229449376/white_nomsbillgates12 http://s.twimg.com/a/1279901730/images/default_profileverytecht http://s.twimg.com/a/1279831293/images/default_profiles_sherifa_s http://a1.twimg.com/profile_images/424898797/Sherifa_n

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 101/475

radi8 http://a2.twimg.com/profile_images/20459002/resw_nor

ivenfoxx http://a3.twimg.com/profile_images/481216407/Going-upmlourenco_ http://a3.twimg.com/profile_images/545774571/imgchopwinvistaclub http://a3.twimg.com/profile_images/69234379/3DVista80gameplayersgo2t http://s.twimg.com/a/1279831293/images/default_profileobsessedgaming http://a3.twimg.com/profile_images/1078919567/joystick

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 102/475

ibearabear http://a2.twimg.com/profile_images/927005866/caricter_

sevenforums http://a1.twimg.com/profile_images/97812369/logo_normfeedjunkie http://a3.twimg.com/profile_images/267119295/rss_normgamingpro101 http://a0.twimg.com/profile_images/662405288/draw_logvideogamereport http://a2.twimg.com/profile_images/255363262/man_smilgameaddictor http://s.twimg.com/a/1279901730/images/default_profile jennaruse http://a0.twimg.com/profile_images/276430880/meme_nmikeeredd http://a2.twimg.com/profile_images/295166682/O.o_nor

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 103/475

highlightsgame http://a0.twimg.com/profile_images/147303292/avatar_nsabberopi http://s.twimg.com/a/1279750718/images/default_profiletechwatching http://a2.twimg.com/profile_images/64158478/techwatchiatkuwait http://a2.twimg.com/profile_images/620804174/kuwait_nbuhashim http://a1.twimg.com/profile_images/980785942/me_normq80s http://a3.twimg.com/profile_images/961638943/kuwait-fl

aywaa http://a1.twimg.com/profile_images/229322033/aywaa_nisafat_ http://a2.twimg.com/profile_images/958676198/icon_norkuwaitmarketing http://a3.twimg.com/profile_images/983858627/index_noearlyautism http://a2.twimg.com/profile_images/150179406/autism-rips3_4free4u http://a2.twimg.com/profile_images/335981058/2c11300

alainaugsburger http://a2.twimg.com/profile_images/486460086/Alain_norpowerguiorg http://a1.twimg.com/profile_images/283487946/powerguiscottmarlowe http://a1.twimg.com/profile_images/667238745/me-watekuwaitads http://a3.twimg.com/profile_images/1060260017/classifie

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 104/475

maartinmorales http://a0.twimg.com/profile_images/1087300220/Dibujo_taty9950 http://a0.twimg.com/profile_images/1047225824/IMG_00claudio_viana http://a1.twimg.com/profile_images/999297145/ln_norma _everton_ton http://a0.twimg.com/profile_images/1031028944/tinton_andersonof http://a1.twimg.com/profile_images/659172344/no2_010.xboxlinks http://a0.twimg.com/profile_images/682053172/xbox_noraaronrockey http://a1.twimg.com/profile_images/1084665917/aaron3_sparklezstars http://a0.twimg.com/profile_images/1042051976/199_norshannonnjames http://a0.twimg.com/profile_images/392960744/Me___Jahelenarecife http://a3.twimg.com/profile_images/288484903/foot_nordaringdarling20 http://s.twimg.com/a/1279322210/images/default_profilelaiskopein http://a0.twimg.com/profile_images/957441176/SDC1249danielegomesed http://a0.twimg.com/profile_images/1048080220/EU.2_nogorocube http://a1.twimg.com/profile_images/208498329/glassblad

f16flightsim http://a0.twimg.com/profile_images/541603612/bigstockpf_pandakun http://s.twimg.com/a/1278724399/images/default_profilepulseonmsft http://a1.twimg.com/profile_images/348049277/msft_nordreamfilmmakers http://a2.twimg.com/profile_images/196533586/filmstripbengineercareer http://a3.twimg.com/profile_images/81767247/452104_scalltop_mac http://a2.twimg.com/profile_images/381918870/alltop_buomrimaids http://a3.twimg.com/profile_images/761627683/BLD0656mbekezm http://a2.twimg.com/profile_images/447532966/twitterPrmacosxrss http://a1.twimg.com/profile_images/445452157/apple_no

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 105/475

sherryonline4u http://a3.twimg.com/profile_images/254337875/sherry_n1software http://a1.twimg.com/profile_images/698931673/pc-net_nn2tech http://a3.twimg.com/profile_images/85301841/Picture_43asraffab http://a3.twimg.com/profile_images/1031187951/f_norm

games_reviews http://a2.twimg.com/profile_images/519857538/Balloon_liketaurus http://a3.twimg.com/profile_images/823143639/twitterPr360it http://a3.twimg.com/profile_images/466409111/360_IT_n

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 106/475

kakroo http://a0.twimg.com/profile_images/728721728/P113097infosec http://a1.twimg.com/profile_images/53013113/2008-04-1roercom http://a1.twimg.com/profile_images/618722505/roerlogoli

itmst71 http://a2.twimg.com/profile_images/649932938/date_nor

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 107/475

azu_re http://a2.twimg.com/profile_images/660061378/3ce9edfasitfu http://a1.twimg.com/profile_images/750567561/watchfulincome007 http://a2.twimg.com/profile_images/1060836010/msn_nooswaldo_rios http://a1.twimg.com/profile_images/1069490164/134397

philippe_lagane http://a3.twimg.com/profile_images/1080990175/2b98e1asslate http://a0.twimg.com/profile_images/1082855040/Avatar_prem_niloufer http://a3.twimg.com/profile_images/383302695/EU_normmatijakapic http://a3.twimg.com/profile_images/1008320547/ja-cut_nmaseve http://a0.twimg.com/profile_images/88223320/Marko_Serosepimenttel http://a1.twimg.com/profile_images/365786549/Nova_Impcdirect2u http://a0.twimg.com/profile_images/1081542956/sale2_nemilevoogt http://a1.twimg.com/profile_images/1083490421/em_noraudio_college http://s.twimg.com/a/1279901730/images/default_profile

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 108/475

technationdaily http://a2.twimg.com/profile_images/957101562/tnd_normdeeowdeeoh http://a0.twimg.com/profile_images/609885236/befunky_talonedge http://a1.twimg.com/profile_images/565495106/gayguy_neu_mesmot http://s.twimg.com/a/1279901730/images/default_profilereinvestinfo http://a3.twimg.com/profile_images/325874607/Robert1_exercise_daily http://s.twimg.com/a/1279901730/images/default_profileinternetmarkets http://a0.twimg.com/profile_images/106106792/IMnews_4alldigitalpr http://a2.twimg.com/profile_images/1011203734/Untitled

cashking1983 http://a1.twimg.com/profile_images/878333005/DSC0044yummymashup http://a1.twimg.com/profile_images/853980333/woman_l _kinect http://a2.twimg.com/profile_images/995865494/kinect_ngamaken5 http://a0.twimg.com/profile_images/733163908/Image45koza4ok http://a0.twimg.com/profile_images/667040828/kermit_nautovolk http://a1.twimg.com/profile_images/697058673/1194781lusianalo http://a1.twimg.com/profile_images/787000949/images_n

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 109/475

ykomparu http://a2.twimg.com/profile_images/808358990/leptop_aalcheme http://a2.twimg.com/profile_images/53116838/jae_normarobdimaggio http://a1.twimg.com/profile_images/500536832/RobDiMadjgraphics_uk http://a0.twimg.com/profile_images/667762952/Logo-twitpaidajulinha http://a3.twimg.com/profile_images/1054134875/curr_noconsultjob http://a1.twimg.com/profile_images/81761573/935588_p

datadrill http://a1.twimg.com/profile_images/870366733/DataDrillagilemanagement http://a1.twimg.com/profile_images/727884065/lonniepro

joaopedro_xd http://a1.twimg.com/profile_images/295831033/Juliane__decolms http://a0.twimg.com/profile_images/360391116/n139553muycomputer http://a3.twimg.com/profile_images/67085705/muyc-logoleadersummaries http://a1.twimg.com/profile_images/234582894/logo_lead javier_pc http://a1.twimg.com/profile_images/654102797/fototwittudomsak http://a3.twimg.com/profile_images/965336883/cfbbf8d5-llun http://a1.twimg.com/profile_images/917483293/avatar-sq jimmypons http://a0.twimg.com/profile_images/445448360/Imagen_marycertad http://a1.twimg.com/profile_images/213962720/DSC_419lcluengo http://a1.twimg.com/profile_images/1078803213/yo_norklischnet http://a3.twimg.com/profile_images/694156819/50_Olymapplenewsdaily http://a1.twimg.com/profile_images/689505042/screenshigetyounews http://a2.twimg.com/profile_images/744281978/logosquapandakun_f http://s.twimg.com/a/1279649509/images/default_profilegreg_vdw http://a0.twimg.com/profile_images/568045204/photo__2vmblogcom http://a0.twimg.com/profile_images/60004532/vmbloggfxvirtualpath http://a3.twimg.com/profile_images/496911067/Michael_paddlestone http://a3.twimg.com/profile_images/78098047/logi-singappunteros http://a0.twimg.com/profile_images/766305864/8127_12txaumes http://a1.twimg.com/profile_images/462964518/yo_norm

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 110/475

kashyapa http://a3.twimg.com/profile_images/856725159/twitterPrschestowitz http://a0.twimg.com/profile_images/816692760/roy_normtechweb http://a1.twimg.com/profile_images/996331408/ubm-techmarcelonovaes http://a0.twimg.com/profile_images/310728728/eu_mari_gneumann http://a0.twimg.com/profile_images/540701988/n515828

jquerybot http://a0.twimg.com/profile_images/1044718204/JQueryBbenzingamedia http://a3.twimg.com/profile_images/588708499/bz5_nornasdaq_100 http://a2.twimg.com/profile_images/383143958/NASDAQ deskmais http://a1.twimg.com/profile_images/674059341/logo6_nocanttim http://a1.twimg.com/profile_images/791387441/280_norcantim_org http://a1.twimg.com/profile_images/685119253/img1_norgestaltemitalte http://a2.twimg.com/profile_images/112167814/Flo_in_gr

dominic_stoiber http://a0.twimg.com/profile_images/1087616308/q10056airfare2010 http://a1.twimg.com/profile_images/801950648/airfare20testgotd75 http://s.twimg.com/a/1279901730/images/default_profiletweet2sweep http://a0.twimg.com/profile_images/979337100/England_chem_plast http://s.twimg.com/a/1279901730/images/default_profilevworlddotnl http://a0.twimg.com/profile_images/905124580/avatar_s _ipadforumsnet_ http://s.twimg.com/a/1279901730/images/default_profileruthvilar http://a3.twimg.com/profile_images/682441131/n128148wiizeels http://a1.twimg.com/profile_images/1002836996/wiizeels

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 111/475

geekytechnews http://a2.twimg.com/profile_images/797188658/geeky_tedailytechnews_ http://a3.twimg.com/profile_images/964907887/___normchloefisher1 http://a3.twimg.com/profile_images/675697385/ist1_465

aboringblog http://a0.twimg.com/profile_images/789708096/image_nrunegri http://a2.twimg.com/profile_images/1033573938/tryne_nhotcandidates http://a1.twimg.com/profile_images/445166824/climber_lmcob http://a3.twimg.com/profile_images/58658559/mikeyAFCuseridk http://a3.twimg.com/profile_images/922294553/CAT_REA justgames1 http://a1.twimg.com/profile_images/968563544/Sonic_th

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 112/475

sharpie9hukd http://a1.twimg.com/profile_images/815520153/_sharpie jakky_rodrigues http://static.twitter.com/images/default_profile_normal.pdonca http://a0.twimg.com/profile_images/1087437096/kqmNhrennon09 http://a1.twimg.com/profile_images/617438729/kamome j0scelyn http://a3.twimg.com/profile_images/821391493/twitter_nmariaalicefaria http://a1.twimg.com/profile_images/614593109/maga_yu

hansoidolor http://a0.twimg.com/profile_images/495972732/twitterPr janinharesende http://a2.twimg.com/profile_images/1014665482/CABELOthechannelfit http://s.twimg.com/a/1279901730/images/default_profilehotnewss http://s.twimg.com/a/1279901730/images/default_profilekinectgamer http://a0.twimg.com/profile_images/1049658120/Kinect-pbitesizedgeek http://a3.twimg.com/profile_images/756967115/Picture_4conceptiagroup http://a2.twimg.com/profile_images/788378934/print_honilupak http://a3.twimg.com/profile_images/911643815/76a21ca9dj_alle http://a3.twimg.com/profile_images/269135323/Twitter_nandresreitze http://a2.twimg.com/profile_images/1087501822/fec2474vivihmoura http://a1.twimg.com/profile_images/890576788/virginia_hamazy http://a1.twimg.com/profile_images/39937192/HI360019chijmestan http://a3.twimg.com/profile_images/1081620083/chijmesolivialow http://a3.twimg.com/profile_images/897065751/Mei_picgfacesearch http://a3.twimg.com/profile_images/585720119/images02freak_beat http://a2.twimg.com/profile_images/776572546/earth_nocontactsearch http://a2.twimg.com/profile_images/604068854/images_nwisdeo http://a2.twimg.com/profile_images/743589642/wisdeo-oakemoi http://a2.twimg.com/profile_images/52060586/vitcontlem

marweb http://a1.twimg.com/profile_images/938339345/0605201tvnpanama http://a3.twimg.com/profile_images/1056852635/twicon_arnoldwender http://a1.twimg.com/profile_images/715499385/aw_normroyzilla http://a0.twimg.com/profile_images/906732800/IMG0014merloyy http://a0.twimg.com/profile_images/988439412/27747_1hindustanhostin http://s.twimg.com/a/1279831293/images/default_profilesecureonline http://a2.twimg.com/profile_images/407324598/secure-oblogging2020 http://s.twimg.com/a/1279901730/images/default_profilebestdamnscripts http://a2.twimg.com/profile_images/426998038/bestdamcompprogbiz http://a0.twimg.com/profile_images/1049651212/CompPrpolarplatinum http://a2.twimg.com/profile_images/865652518/PolarPlati

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 113/475

mintch http://a2.twimg.com/profile_images/810847906/Self_nor2moto5 http://a2.twimg.com/profile_images/481457886/test2_nocarmenhill8 http://a0.twimg.com/profile_images/630118768/dali_norwinappz http://a1.twimg.com/profile_images/793318741/downoadplaveb http://a2.twimg.com/profile_images/837209562/logo_norraddevelopment http://a1.twimg.com/profile_images/829263245/Untitled-

rostacik http://a3.twimg.com/profile_images/1005158877/31963_viniciussep16 http://a3.twimg.com/profile_images/1080103875/avatar-ekristryx http://a0.twimg.com/profile_images/734611420/Sin_t_tulisuntangle http://a3.twimg.com/profile_images/744363429/lonnieprovicu11 http://a1.twimg.com/profile_images/1031629905/scaryavnhaaima http://a3.twimg.com/profile_images/762242995/Capture_lordmanley http://a3.twimg.com/profile_images/534183319/56763_1

lukosan http://a1.twimg.com/profile_images/936834821/luke_pry

wallstpostgame http://a3.twimg.com/profile_images/661934427/Wallst_P

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 114/475

tricomts http://a3.twimg.com/profile_images/860346163/TriCom-Ictherecruiterguy http://a3.twimg.com/profile_images/752415495/mashabledesigner_sm http://a2.twimg.com/profile_images/994162038/Untitled-generacionmac http://a2.twimg.com/profile_images/977572850/Screen_s

passtor http://a1 Show

itreview http://a2 Showfooyoh_f http://a0 Showisaiah_mustafa http://s.t Shownewsbot_msoft http://a3 Showircpresident http://a3 Showanalist_be http://a1 Showgordonatnos http://a1 Showsdcrdc http://a1 Showkerryg_packtpub http://s.t Showvinwareznic http://s.t Showmaxim_pyzh http://s.t Showyamanecoan http://a3 Showfredstyle88 http://a0 Showitjobs_tt http://a0 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 115/475

ohgitake http://a0 Showlindsay_lotion http://s.t Showthepeopleplace http://a3 Showangelazhang_f http://s.t Showtuexpertojuegos http://a0 Showcaptainskyhawk http://a2 Showstevetobak http://a2 Show

sdiaz831 http://a2 Showfullthrottl6 http://a0 Showgutomass http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 116/475

jeffcv1 http://a3 Showpatrixxz http://a1 Shownicjosemm http://a1 Showvodacomm http://a3 Showmattjfriend http://a0 Showelfamiliar http://a0 Showhyphas http://a3 Show

antonyticktock http://s.t Showdwwtc http://a0 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 117/475

mantrafish http://s.t Showmarinthal http://a1 Showevrithingmsft http://a2 Show jmedinap http://a0 Showstockscatalog http://a3 Showwindowsvn http://a1 Showamuron_amie http://s.t Showvivian_hsu2010 http://s.t Showdesideratist http://a0 Showsnlkagannews http://a1 Showmoneysherpa http://a2 Showkunals89 http://a3 Show joshuaharryprab http://a0 Showchicharitomufc http://a1 Show

andysteer http://a1 Showcyb3rc0n http://a1 Show jenswehrmann http://a2 Showalejandrameteve http://a1 Showsfitriana http://a0 Showtinycamp http://a0 Showschatorje http://a3 Showgalpaodaweb http://a0 Showshiriappleby_f http://s.t Showwendy_blair http://a3 Showkaldata http://a0 Showschiebde http://a3 Showprincessary7 http://a3 Showvcastro http://a2 Showmskwt http://s.t Showsam8201 http://s.t Showeonisfluxed http://a0 Showchiqlets1 http://s.t Showrobin_m_steele http://a3 Showpatpoh2009 http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 118/475

taylodl http://a1 Show jly_ http://a2 Showtylerjoynt http://a0 Showmichelramirez http://a1 Showtheiafm http://a1 Shownicovideovip http://a1 Show

onurozy http://a2 Showrapsen21 http://s.t Showu2anil http://s.t Showtrucuriwindows http://a1 Showakshayahotel http://a1 Showwindowswolf http://a3 Showleilatongning http://a2 Showdelicious50 http://a0 Show jun8414 http://a1 Show

osctonline http://a2 Show

mwor http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 119/475

webdevelope http://s.t Showniubie2 http://a2 Show

waqazali http://a2 Showkennydioo http://a0 Showrecentinside http://a1 Showprc_cares http://a0 Shownick_web http://s.t Showlorenabella102 http://s.t Showbrunns_ http://st Showpsytechnics http://a0 Showevahuangshengyi http://a1 Showasp_net_king http://a1 Showstoconsortium http://a2 Showvdc_embeddedsw http://a0 Showsolevangelist http://a0 Showdpmworld http://s.t Showthenewslist http://a2 Show

jobservede http://a3 Showmastercompu http://a1 Showfatbutcute http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 120/475

danny_wasp http://a3 Showwiiplaywii http://s.t Showkitchenologie http://a1 Show

kamakil http://a0 Showxh3mrock http://a1 Showheadlineportal http://a0 Showqwillkomerz http://a0 Showgsccorp http://a2 Showrajeshvedicsoft http://a3 Showappleproducts http://a0 Showpshmike http://s.t Show jmac0000 http://a1 Showmarylandit http://a1 Showmymobilegeek http://a2 Showcioworldnews http://a1 Showclicks2customer http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 121/475

mrharris569 http://a1 Showguitarmadness http://a1 Showlatestdealsus http://s.t Showmachelase http://s.t Showsreerajvr http://a3 Showlakshmini http://a0 Showbarcafans http://a1 Showcdeadpoetz http://a1 Show jimgardner http://a3 Showcuic_portnoy http://a2 Showearlybirdclicks http://a2 Showunodata http://a0 Showpaulfreed http://a0 Showamishriaz http://s.t Showruzhovt http://a1 Showdustinmueller54 http://s.t Showglaucohenrique http://a2 Show jamesgowers http://a1 Show jikoyck9 http://a1 Showtomlap http://a1 Showcqdude http://a3 Show

ronnie051178 http://a2 Showmatheusdarosa http://a3 Show

almina http://a1 Show joesmorganason http://s.t Showstarburst1977 http://a2 Shownew2udirect http://a3 Showmaarcelorosa http://a2 Showanggasaputraaaa http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 122/475

english_news_w http://s.t Showbarrons400index http://a0 Showtechwindows http://a3 Showleandro_oliva http://a2 Showleowolf21 http://a1 Showlucathas http://a3 Show

smjobssea http://s.t Showdealingsexy_f http://a3 Showpeacekaren_25 http://a2 Showhostingverde http://a0 Showemmothefloor http://a1 Showfaabo_seo http://a1 Show

ravero http://a2 Show jrick http://a3 Show jaszlee http://a1 Showtech_revs http://a0 Show jld http://a2 Showhanureddyrealty http://a2 Showarttodraw http://s.t Showbeyonce_f http://a3 Showesoftdownloads http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 123/475

vistaheads http://a3 Showlaurie_bot http://s.t Showrobertreginald http://a3 Showiplaynetru http://a3 Showblessqe_com http://s.t Showalomaximo http://a3 Show

antoniokool http://s.t Showpricedown http://a1 Showpcnupdates http://a3 Showwolvo5 http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 124/475

homegazine http://s.t Showtyce_com_ua http://s.t Showadrianomarinho http://a3 Showbelindahalime http://a0 Showlinkbuildingguy http://a1 Show jonmwilliams http://a3 Show

cjw_razorwire http://a3 Showhobbypsychologe http://a2 Showendijs http://a0 Show

halouniverseru http://a1 Show

latt3girl http://a1 Show

jjluke77 http://a2 Showbekinlaw http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 125/475

omissis http://a0 Showrenoyanuar http://a3 Showthenetwork_g http://a2 Showthefutureonline http://a3 Showkillagamez http://a3 Showurban_gamez http://a2 Show

juanwire http://s.t Showipad_forumsnet http://s.t Showtjc3844 http://s.t Showanermosh http://a3 Showbuildawebbiznes http://a3 Showbuvai http://a3 Showadaindia http://a0 Showdegriffes http://a1 Showmetserve http://a1 Showecko http://s.t Showmacgenio http://a0 Showpwninstein http://a2 Showspritneybeers http://a3 Showgabrielzaba http://a0 Showbrad_1992 http://s.t Showbankrec411 http://a1 Showmuratyagci http://s.t Show

rayvandenbel http://a2 Showcodestonegroup http://a0 Showrubel_khan_ http://a0 Showgazetevatancom http://a0 Showwallck http://a0 Showsidconjectures http://s.t Showpwhitereviews http://s.t Showtpenzzz http://a0 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 126/475

phfrebelo http://a1 Show

bluesjlh http://a3 Show jimkennedy http://a3 Showchicago_cp http://a1 Showlewistull http://a3 Show

aggie_ceo http://a3 Showykasugai http://a1 Show

ramonsantoyov http://s.t Showrameshpsarathy http://s.t Show

mummersmania http://s.t Showsibnomer http://s.t Show juliochaves_ http://a2 Show jmagna16f8 http://s.t Showsourcews_uk http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 127/475

thiagomatteus http://a1 Showlinggabranadi http://a0 Showmzayed http://a0 Show

marcq http://a0 Showcopernix http://a2 Showdowtimingal http://a1 Showopensource4life http://a0 Showangiechock http://a0 Show

katiealley http://a0 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 128/475

revmail http://a3 Showcysynthia http://a2 Showksukalac http://a3 Show3rdbrain http://a1 Showstarry_ari http://a3 Showexcelcom_aus http://a1 Show

meccacomputers http://a0 Showicepts http://a3 Showfcoferreira_ti http://a0 Showtherealgeekette http://a2 Showomnlinkedin http://a2 Show

nempiskota http://a3 Showyesanpark http://a1 Show

apticassociacio http://a3 Showbfisher008 http://a3 Show joewager http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 129/475

matemorphoses http://a2 Show

think_smartz http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 130/475

rinilkunhiraman http://a3 Show

kitkitpig http://a0 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 131/475

deydeyyy http://a0 Show

amoriese http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 132/475

ccameelaa http://s.t Show

genevagirl19 http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 133/475

haileygirl20 http://s.t Show

bsbdeary http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 134/475

alliemome http://s.t Show

gracivali http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 135/475

ll__ralph__ll http://a3 Show

cliribi http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 136/475

gachajessie http://s.t Show

michieloost http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 137/475

perceptiveone http://a1 Show

siteoptmize http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 138/475

hireseoexpert4u http://s.t Show

victor_batista http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 139/475

slumpey79 http://a3 Showstorecloset http://a1 Show jacook11 http://a3 Showchlweekly http://a0 Show

tehwebguru http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 140/475

phillycodehound http://a1 Show

techinlife http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 141/475

technewsstories http://a0 Show

geekurls http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 142/475

dokodoko88 http://a3 Show

songbiz http://a3 Shownhabudhabi http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 143/475

brandbizniss http://a1 Showllwillia http://a2 Show

schirello http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 144/475

garagebob http://a2 Show

bargainlaptops http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 145/475

newsbyifm http://s.t Show

kimberlyalexan http://a0 Showspincasting http://a0 Showyou_tek http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 146/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 147/475

craft_13 http://a1 Show

freshmegabit http://a2 Showmediafire4u http://a1 Showiphonesomething http://s.t Showrochacbruno http://a1 Showmarcelo_paiva http://a0 Showuksqljobs http://a3 Showsheila_willis86 http://a2 Showialejukebox http://s.t Showmichaeltechnews http://s.t Showmystartnews http://a3 Showvsvlachos http://a3 Showtrans4you http://s.t Showlevithegeek http://a3 Showfranckohrel http://a3 Showsupranees http://a0 Showinfokubo http://s.t Showphpprogramm http://s.t Showchadmpaul http://a2 Showlavoisierneto1 http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 148/475

retwitteame http://s.t Showstephanya http://a1 Showpallisso http://a0 Showthomaucoin http://a1 Showzonabinaria http://a2 Shownormanuk http://a1 Show

syunrou http://a2 Show

technguide http://a0 Showknitspirit http://a2 Shows0ulistic http://a3 Showaaplnowcom http://a1 Showamnetinc http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 149/475

auramis http://a2 Showadiosgoogle4 http://s.t Show

tomalbart http://a3 Show joebankspr http://a3 Showkanishmohan http://a2 Showmothersdayfan http://a1 Showinterobsharfr http://s.t Showkingswayhq http://a1 Showgreenmanvideos http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 150/475

tnbgaming http://a2 Showne_digital http://a3 Showmalditogeek http://a1 Showrobor http://a3 Show justnews_de http://a1 Showschlagzeilen http://a3 Show

royalusa http://a1 Showtextitute http://a1 Showmateamargonerds http://a3 Showmaxmckane http://a0 Show

japokdan http://a1 Show

sheenamullally http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 151/475

thegamewatch http://s.t Showlazonajuvenil http://a0 Showsanfrantowing http://a3 Showcs_usa http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 152/475

ogawan http://a1 Show

christianmaass http://a1 Showwarezpredator1 http://a1 Showmpnindia http://a1 Showshift http://a3 Showhypothesard http://a0 Showpiscess02 http://a0 Showhjkong http://a0 Showtechnaa http://a0 Showuntoku http://a2 Showshakitagehr2485 http://a3 Show jake_aiden http://a1 Showmarkus_beckmann http://a1 Showhb860rss http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 153/475

garyetal http://a3 Showcharmaineelaine http://a1 Showalbertsc79 http://a2 Show

pushkar_reader http://a3 Show

billgamebase http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 154/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 155/475

arinyan486 http://a2 Show

windowsgood http://a3 Showvinielavarasan http://a1 Showhikyaku http://a0 Shownafufuorgua http://s.t Showweblinkindia http://a2 Showtruband_network http://a0 Showpzrq http://s.t Showcollegejobwire http://a0 Showiphonelatam http://a0 Showpolianaamorim http://a3 Showruudslaats http://a2 Showdjjoene http://a0 Showexpernova http://a1 Showrameshalianil http://s.t Showkaule http://a1 Showahmed_castiel http://a1 Showtodaygamenews http://s.t Showcleber301207 http://s.t Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 156/475

ttcycler http://a2 Showpetermolyneux2 http://a1 Showastera_ru http://a3 Show jeetesh21 http://a3 Showtanzansupre http://s.t Show

ttolentino212 http://a2 Show

actualnet http://a1 Showseo_profesional http://a2 Showcraiglees http://a1 Showsupportangel http://a3 Showkrish_lee http://a0 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 157/475

icfti http://a0 Showcaskanja http://a0 Show

testuser77 http://s.t Showbenklopfer http://a1 Showds2600 http://a0 Showsatsumahan http://a1 Showmobilarena_hu http://a2 Showvlbsweeps http://a1 Showeverytbb http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 158/475

yamanyan http://a1 Showrobmitchsr http://a1 Showarthurlyra2502 http://a1 Showkatanaxxx_ http://a2 Showdr_teatime http://a3 Show

laozaa http://a1 Show

producerlymedia http://a0 Showbuterfly_effect http://a2 Showsundaytwist http://a3 Showitcjobsch http://a0 Showciojobs_tt http://a2 Showthreedaymonk http://a1 Showshearerrima http://s.t Shownoobenforcer http://a0 Showthiagogomes_ http://a0 Showoliverkingsbury http://a0 Showsuniltech1 http://s.t Show jvence http://s.t Showdesinerd http://a3 Showthe_gilb http://a2 Showaanbudi http://a0 Showmanna_ro http://a1 Showeugene_li3 http://a2 Showbrokerbase http://a1 Showntm23 http://a1 Showtheregusjobs http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 159/475

grenangle http://a2 Showyogeshmalik http://a2 Showblkti http://a3 Showadeccobrasil http://a1 Showhegelsom http://a0 Show

ntcsoft http://a2 Showtechnnewshawaii http://s.t Show

g_informatique http://a1 Showmytwitrss http://a2 Showbuckley007 http://a0 Showstanley198 http://a0 Showstory_teller_kp http://a3 Showlarchcomputers http://a1 Showmichellarue http://a2 Showmobile_news_ua http://s.t Showbarbmosher http://a1 Showillogicabot http://a1 Showyadla http://a2 Showadvancingwomen http://a1 Showharaldfelgner http://a1 Showcustompc http://a0 Showwebhostingpl http://a1 Showyssamisa http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 160/475

josephseven http://s.t Showtonyraiber http://a3 Showdelanisafrissy http://a2 Show

the_infoscion http://a1 Showdavidwaldock http://a0 Showshyobaba http://a3 Showflashdeveloper1 http://s.t Showrtokuhisa http://a3 Showbenchwebsite http://a2 Showdobreprogramy http://a2 Showpinavina http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 161/475

busiestyoong http://a2 Showrowntreemusicuk http://a1 Showapeoholic http://a1 Showmarubinisikhipa http://a3 Showdirkuijt http://a3 Shownewsparadies http://a3 Show

paralegalconsul http://a3 Showdavideimparato http://a1 Shownaveenmadhawa http://a1 Showen_art http://a1 Showsurfandbiz http://a2 Showphilikon http://a0 Showerase_rewind http://a3 Showsonyjtp http://a0 Showdotinfomatome http://s.t Show

jackmasosan http://a1 Showfivestaraccount http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 162/475

ymori805 http://a3 Showutahpulse http://a3 Showcdausacker http://a0 Show

noktasizvirgul http://st Show

dowlive http://a1 Showgsma_mbb http://a3 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 163/475

asyscolombia http://a2 Shownnctoday http://a3 Showr3publican http://a2 Show jaygarrett http://a3 Showretwmt http://a2 Showesportcollected http://a2 Show

ycarobrambila http://a2 Showfreshcoupons http://a0 Showlexscriptaesq http://a2 Showihuffingtonpost http://a2 Shownewsfeeding http://a1 Show

cvandervelden http://a3 Showbillyhayward http://a1 Showrevistasumma http://a2 Show joeharker http://a3 Shownewssearching http://s.t Show johnraav http://a2 Show

tb2g_ipad http://a3 Showtmcnetcom http://a1 Showdanubio_soares http://a2 Showcareerplan4me http://a1 Showbanovciinrs http://a3 Showbartvanooijen http://a0 Showmarcomgilde http://s.t Showpatadadourso http://a2 Showi_nieuws http://a0 Showmarketing_feeds http://a2 Showdjwmedia http://a2 Showwatchking http://a1 Showpeterlubs http://a0 Showbilldraper http://a3 Showsylow http://a1 Showspsoldier http://a2 Showogd_ict http://a3 Showgugaoliveira http://a2 Showwin7newsinfo http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 164/475

walkandpause http://a1 Showallelekt http://a0 Showyukishi_ http://a1 Show josettwitts http://a2 Showstayhard_ http://a1 Showshravanp http://a0 Showalloviacie http://a3 Showdindaabastian http://a3 Show

scaled_wurm http://a3 Showmarucozy http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 165/475

jenysamuels http://s.t Shownerdfeed http://s.t Showtkamimoto http://a1 Show

concept_machine http://a0 Showlongmountain http://a0 Showkaairi http://a0 Showgamesit http://a1 Showwolseywe http://s.t Shownntsugu http://a1 Showfunya_akira http://a1 Showalupen http://a1 Showemiratesmac http://a0 Showteam_scuba_owl http://a0 Showxenicom http://a3 Showsanfrantaxi http://a1 Showtraceroyal http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 166/475

jobdevmobile http://a2 Showkunal_pandya http://a1 Show

sonicnexus6 http://a3 Show justbeegenerous http://a2 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 167/475

namagaki_feeds http://a3 Showm2_2m http://s.t Show20qbe http://a1 Showaprinfo http://a3 Showmkaysi http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 168/475

mediatours360 http://a3 Showvolkan_ali http://a3 Showbarriebramley http://a1 Show

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 169/475

Other Columns

TooltipAdd Your OwnColumns Here Followed Followers Tweets Favorites Description Time Zon

normal.PNG 65 212 7494 0 Blog, Cinéma, Paris648_normal.jpg 131 106 4273 132 Jeune (et con Paris-9631-4d17-8ae4-1e0ff9713d7 120 162 1540 17 Tweets von u Berlin

normal.jpg 910 2461 8758 4 Press Officer Berlin0_2_normal.jpg 280 123 1450 0ormal.jpg 30 2725 1026 4 Twitter oficial Brasiliarmal.jpg 70 29 28 2 Brasilia

rmal.jpg 436 208 2085 0 New twitteira, tentand _normal.jpg 65 29 985 0 Brasilial.JPG 161 60 2196 2 Ser feliz sem motivo ég 169 67 886 0 _normal.JPG 91 100 1132 0 Technical AccLondonon2_normal.png 0 493 11776 0 Technology NCentral Ti23_1628165_2602772_normal 25 564 5722 2 Marketing, Pr Central Ti _logo_normal.png 4 8616 6046 1 We break Ap Pacific TiONITA_-_Capacete_WILLIANS_ 449 125 2563 1 Somos Mae (Istela) e Fil3_normal.png 1 367 23632 0 Pacific Ti

twitter_normal.png 291 9807 18532 1

How do youusetechnologyto poweryourbusiness?

@InformationWeekcovers ITnews andinformationforbusinessesthat usetechnologyto make adifference. Eastern T

al.png 7 710 74860 0 RT a todo lo qCentral Tiwitter_pro_normal.png 112 270 3536 0 A hopeless te London501_1767_normal.jpg 96 60 481 1 Just ordinary Jakartaitter_normal.gif 6 80 1724 0 Sumber informasi terdepx_normal.png 30 14 122 0 IT; SharePoinBerlin-logo_300_normal_normal.jpg 1238 1737 4851 1 Technologie- Berlin50_normal.jpg 2002 873 10476 1616 A general int Stockhol3_normal.png 1 760 66445 06_normal.png 4 11 221 0 Answers on VCentral Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 170/475

s_normal.gif 58 88 6017 0 Sharepoint, . Central Tis_normal.gif 30 26 747 0 Sharepoint Wiki0_normal.png 109 51 140 0nMagz_normal.jpg 1 7367 83032 2 Sharing about Pacific Tinormal.bmp 202 104 1496 0

3-4-21-12-9-574_normal.png 1999 1380 22831 7 Stay at home Eastern T

6_normal.png 2067 2028 5663 0 A genuine sm Mountaidesign-logo_normal.jpg 586 899 1874 1 Zebra Web D London

mal.jpg 140 109 113 2

Father,entrepreneur,photographer, traveler.

Co-founderofCoreMotives- a digitalmarketingsolution forMicrosoftCRM Eastern T

ynamics-square-small_normal. 13 35 102 0 Travi@ta is a MicrosoftfilePhoto_normal.jpg 220 263 5303 0 Mexico C

121_3039_normal.jpg 636 442 280 2 Athens _ageor_cropped_normal.jpg 2001 1383 4380 11 Construction, Athens

eller_normal.JPG 4007 3673 679 3 intern. ProjekBerlin

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 171/475

_normal.JPG 27 622 18855 3 Web addict

rmal.jpg 0 1344 42671 0 Net related bl Central Tinormal.jpg 2281 5847 36813 180 BBC=Building Dublinarist_heavy_metal_normal.jpg 0 66 1755 0 Hawaii

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 172/475

al.jpg 1830 1711 25317 0 I will follow back~!Than

en_normal.jpg 21 1431 75117 0 Central Tindler_normal.jpg 25 240 2955 0er_normal.jpg 37 262 3930 0rford_normal.jpg 124 213 3968 0 Twitter is my Central Titon_normal.jpg 2 173 1986 0 Central Tiwn-logo-facebook_normal.png 73 416 12103 3 A Resource siHawaii7223861918_1567382227_30 170 212 4614 2 Aspiring film Lisbon _bigger_normal.png 408 76 125 0 Aditi TechnolKolkata

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 173/475

normal.jpg 421 1014 2757 166 Husband to o Eastern T _Schrier-1_Charcoal_1a_norm 179 2143 3268 0 CTO (CIO) CitPacific Ti

mal.png 1974 927 7464 0 Xbox Update Eastern T0_normal.png 0 96 1951 0 Tech News, RHawaii

ormal.jpg 439 52 47 0 Computers Ebooks3_normal.png 1 74 4117 0 St. Peter

a_normal.jpg 1 31 525 0

0_normal.png 0 51 1350 0al.png 3 38 1209 0 Download Ev Hawaii

al.gif 134 115 3478 3

TechnicienInformatique|Langages:HTML +AIML|Passions:Informatique, Science,Actualité,du Fun|Perso:Regardamusé mais juste sur lemonde.Partageons! Paris

-avatar_bigger_normal.png 203 7828 12221 2 www.journal Hawaiihirt_normal.jpg 114 107 966 6 Pacific Tilloween_normal.png 362 578 6412 33 Mac Fan, reti Jakarta

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 174/475

le_normal.jpg 80 98 294 1 Eastern T

0_normal.png 11 15 98 0ult_avatar_normal.png 0 66 277 0 This is a feed Eastern T

o_normal.png 3 237 1833 0 Eastern Togo_normal.png 3 268 1066 0 Eastern Tormal.jpg 588 422 4276 2 Politiek | Gro Greenlannormal.jpg 806 837 10825 7 Zzzz Amsterdnormal.jpg 188 280 8078 89 apple, mac os Berlinnormal.jpg 21 775 9200 1 Enlaces en tie Quito4_normal.jpeg 4554 4495 14861 2 Sales 2.0 ena Pacific Ti2_normal.JPG 2859 2865 8879 3 We love to saLondon _normal.png 1093 1244 34115 1 Pacific Tirmal.jpg 483 473 3193 226 Un blog phot Greenlan

00012012780XSmall.jpg_norm 1028 235 1199 0 I enjoy entertaining, re4_normal.png 11 129 18959 04_normal.png 67 187 22219 0

ook_normal.jpg 777 788 233 0 Internet-Prog Greenlanrmal.jpg 80 46 310 1 Pacific Tishot_2010-06-22_at_5.38.44_P 319 188 379 0 HR Locker is a human rmal.jpg 380 5110 130958 1 The Tech GanSaskatchers2_normal.jpg 8 701 24047 0 @CloudCareeMountai2_normal.png 3 399 13643 0 All about soft Hawaiiitter_normal.jpg 130 88 357 4 Aprendiendo Madrid08-Personal-RECORTADA_nor 6963 9749 26713 877 Consultor y cMadridal.jpg 16534 16244 19046 19 Licenciado en Madridnormal.png 381 434 5921 2 A goddamned KolkatafilePhoto_normal.jpg 69 1347 3079 4 Microsoft M Internati

er.73_normal.png 745 612 8680 1 Twitter Cyborg enhancmal.jpg 1 114 1336 0ormal.jpg 169 85 824 2 Out Of Contr Parisal.png 165 71 627 10 Le blog qui voHawaii

_Susan_2x2.5_normal.jpg 135 93 167 0 CPA firm marQuitondelsohn_Twitter_logo_2_nor 136 110 205 1 Maryland CP Eastern TTwitter_normal.jpg 12 48 50 0 Dynamics GP Eastern T5_normal.png 558 603 7181 0normal.jpg 2419 2920 405 0 A web develo Melbour

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 175/475

n_fire_1__normal.gif 90 39 670 0ews_logo_normal.png 777 2524 57721 1 Get Latest W Hawaii52_7577_normal.jpg 103 52 55 1 Cairon_fire_1__normal.gif 528 145 865 0

3_normal.png 1096 1140 6643 0

BusinessPlans

MarketingPlansMarketingSolutions

Central Ti3_normal.png 0 601 47663 0 Pacific Tinormal.gif 240 65 1279 0rmal.png 31 723 8917 0 SEO / SEM AnMumbai

rofile_4_normal2_normal.png 30 59 2071 26 Tokyosei_normal.jpg 191 115 4808 11 Tokyoormal.jpg 14 22 943 0 Retweets esp Central Ti _normal.jpg 607 512 7414 11 It's all about Berline_twitter_icon_normal.png 10 22974 27881 0 News aus der Berlinvettes_logo01_normal.jpg 1648 937 7342 0 Covettes is a Berlinn_normal.gif 1009 648 606 0 I love Tech News | Pleaal.gif 3306 3241 7403 0 Following bacJakarta

7_normal.png 26393 26384 14075 3 PC Hilfe ForuBerlin

ormal.jpg 462 449 8101 2 Finjo ser desi Brasilial.jpg 925 175 412 0 Brasiliaual.com_normal.png 13 14433 8859 1 AppleWeblog Madridmal.jpg 859 1065 9854 3 Entrepreneur, Abu Dhamal.gif 4529 4375 602 0 Covering news and info

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 176/475

e256_normal.png 5215 5821 38946 1

Cruising4News! PopularconsumerreviewsUK★USA

☛Dailyfreebies +iPhoneApps.In2Wildlife,WordPress,Tech,AffMarketing,Biking✈Say Hello☺ Thanks4visiting

Edinburgibords_normal.jpg 606 1140 38336 23 Editeur dével Greenlanormal.jpg 1416 918 163 0 Working withCentral Tinormal.jpg 0 299 5989 0 Follow & Learn Everythix_twitter_avatar_normal.png 133 115 2150 1 Tu gambades Parismeinung-02_normal.png 242 1028 59781 1 News by Frei Berlinmal.gif 1876 1342 34863 0 Berlin6011132_normal.jpg 1942 941 11658 1al.jpg 7371 7349 6476 0 I am running Amsterd

go_normal.jpgx_normal.png 1921 864 911 3 All things WeGreenlanal.jpg 3413 3284 1535 0 PC Service, WBerlin

_normal.jpg 29802 27184 57024 134 The newest TGreenlan _lowres_normal.jpg 179 44 415 11 Rechtsanwalt Berlin

igger_normal.jpg 1194 556 2921 5 The best gadgets news6_normal.png 0 669 33089 0 Posts from th Central Ti _normal.PNG 55 34 1160 0 The Tech Riot providesed_normal.jpg 2 541 9747 0 Internet and t London

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 177/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 178/475

rmal.jpg 6643 6367 61243 0 Automated a Pacific Tinormal.png 15 602 37532 8 This account Berlinnormal.jpg 107 107 650 1 Just another West Cenrmal.jpg 0 140 4618 0 Amsterdg-01-top_normal.jpg 95 873 18660 1 RSS: http://bit.ly/9Rdknormal.jpg 730 133 597 0al.png 390 398 2236 6 WLG | MSP | Seoul

c-919b-46a1-bf95-456cf26892 75 107 867 268

Microsoft

TeamSystem MVP.NETProfessionalVisual StudioVisualStudioExtensibilityTFSALMSoftwareDesign &DevelopmentSystemCenter(IaaS) Hawaii

normal.jpg 567 207 3528 1 Только самые свежие _normal.png 135 545 250340 0 новини, съби Sofia3_normal.png 260 269 18109 0 Quito4738_normal.jpg 355 710 20641 1 Kyiv

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 179/475

ormal.jpg 199 127 853 1 Web Develop Eastern Tal.jpg 2539 3046 51570 631 I'm a Social InCentral Tir_normal.jpg 211 218 3568 0 Anything worCentral Tibusiness-people-walking-towar 315 1703 38854 0 Careers and J Pacific Tiunstan_normal.jpg 258 199 3379 0 Realtor, fathe Eastern Tnormal.jpg 2717 3415 1888 1 Port4Growth Amsterd

mal.jpg 151 573 31791 0 Я занимаюсь Abu Dha

dia_marketing21_normal.jpg 26 606 36535 0 Freedom Santiago

normal.jpg 377 346 3431 3 PR Consultan AmsterdM_Burlage_LThumb_normal.jp 138 328 295 13 CTO Wortell, Amsterd5141020062008_normal.jpg 55 100 320 0 Amsterd

el_normal.jpg 21 130 4969 0 All the latest news aboApple_logo__480x480__norm 10098 10420 30514 0 Find great de Pacific TifilePhoto_normal.jpg 470 393 7870 263 Passionate ab Eastern Trmal.png 280 229 284 1 UK based WinLondonk-200x200_normal.png 254 319 1234 0 Editor and AuCentral Ti712-7_normal.jpg 18904 17454 45993 5 Web Designe PerthLogo_65_x_13_normal.jpg 357 67 307 0 The #1 twitteAlaska

wright_objection_normal.jpg 32 638 22082 32 Beijingsucher_normal.png 751 1555 7032 11 Web 2.0, Ope GreenlanfilePhoto_normal.jpg 188 177 4310 709 IT-Mensch, seBerlin

ormal.jpeg 2001 412 5710 06_normal.png 292 356 6333 0

mal.jpg 39 13 166 0 Answers on TCentral Tihowdhury_png_normal.png 135 135 1756 177 Silverlight EntChennaihousetree1_cnn_normal.jpg 87 1815 36615 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 180/475

3_normal.png 21 1410 49178 0 Hawaii _logo_str_normal.JPG 967 992 1336 0 Share and staNew Del _normal.jpg 291 262 148 0 Microsoft LeaNew Delogo_Thumbnail_Small_normal. 548 685 223 0 Official twitteAlaskaair_20Loss_20Treatment_norm 19 66 2484 0 Программы St. Peter5_normal.png 125 158 6510 0 На этом сайт Santiago48_normal.png 498 2957 2542 0 Gameblog.fr Parisormal.jpg 812 776 11332 7 Tokyoormal.JPG 3694 3652 37244 0 Writer, AffiliaCentral Ti0_normal.png 1964 336 82 0

x73_bigger_normal.jpg 1 93 1412 0 News, views, Eastern TonWeekSMBlogo_twitter_norm 5 768 2015 2 The TechnoloPacific Tirmal.jpg 81 78 505 1 Another bori Chennai0_normal.png 1687 1687 7629 0 Into video ga Quito

mal.jpg 1951 1217 9814 0 Xbox gaming! Greenlanormal.jpg 6684 6526 8913 0 the EVERYTHICentral Tian_normal.jpg 3121 3002 17416 0 Hi, Im Ty. My Brisbanermal.jpg 1 136 1631 0 Collecting the HawaiiS_normal.gif 4447 4146 15797 35 Top Brand PrPacific Tiormal.jpg 651 723 1281 0 Get your han London3_normal.png5_normal.png 24 777 11987 0 Pulls latest th Lima

mal.gif 557 421 8704 0 IT News - alleBerlinnormal.png 1580 2000 14274 0 Watch eBay i Hawaii

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 181/475

al.jpg 7349 7960 92988 0 Enjoy BreakinCentral Ti5_normal.png 916 871 3733 0 Berlin4_small_normal.jpg 182 271 11529 0 GreenlanTwitter_normal.png 387 567 25316 1 MVP Cliff HobLondon

ung_normal.jpg 2001 1300 58581 1

Alles überPolitik,

Inland,Ausland,Panorama,Wirtschaft,Wissenschaf t, Technik,Gesundheit,Skurriles,Promis,Sport undBundesliga.Follow@henrik_tintrup Berlin

1_normal.png 36 2110 68323 0 Free Download Allal.jpg 39 1310 34122 0 Proactive DefEastern TorldNews-twitter-avtar_norm 279 201 3900 0 Technology world news

310481532_526_q_normal.jpg 994 185 6049 7 The Internet Kuala Lual.jpg 895 439 379 0 Find the Best and Cheamal.png 1644 751 371 0 The latest an Quito

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 182/475

normal.jpg 145 112 237 2

Ikroh is allaboutethical SEO,

innovativesocial mediamarketingand one-to-one service.We also likecoffee andsushi.FB Page:http://companies.to/ikroh-seo London

p_normal.png 0 2033 19191 0 A river of SEO Hawaii _normal.bmp 3412 3796 8153 0 Web develop Athens _normal.gif 639 447 2749 1 PHP Web DevLondonkins-twitter-photo_normal.png 591 1152 18642 0 eBay Powers Sydneyller-twitter_normal.jpg 1168 3535 58558 1 eBay Teacher Sydneyo_normal.gif 55 161 2209 0-itespresso-twitter_bigger_fr_n 1018 883 2591 1 Site d’inform ParisfilePhoto_normal.jpg 98 157 7182 2 Sélectionne p Parisrt2_normal.jpg 2175 5866 889 0 Compte OfficiParis

4_normal.png 4 1 2 0 Pretoriaot_2010-01-08_at_7.17.42_P 32 14 13 0 Pretorianormal.jpg 1144 497 97 0 Call us for all of your Re

a_normal.jpg 0 126 9919 0 Rome

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 183/475

_normal.JPG 255 720 5310 61 GOOD AT MENew Delssell_normal.jpg 142 208 3329 0 _normal.png 2646 2403 22300 0 Quanrel TechLondonmal.jpg 1984 468 1353 0 Making sure that I brinfilePhoto_normal.jpg 50 726 8624 8 BBA#17 TU | Bangkok72_normal.jpg 248 242 10583 0 Experto y ConCaracas483864375_normal.jpg 4371 4671 16029 88 Describiendo Caracas

003spn001_normal.jpg 86 61 328 0 Jakarta

0_normal.jpg 24 135 952 0 Marius Oiaga, Greenlaniconnews_-_twitter_normal.gif 39 585 3558 0 La actualidad Madridwitter_normal.gif 212 503 664 0 Este es el twit Madridormal.jpg 194 132 1811 3 Me dedico al Madrid

-itespresso-twitter_normal.jpg 68 1172 3101 0 Toda la actual Madrids_button_8_normal.jpg 729 742 3149 2 The number Amsterd

on_normal.png 139 86 186 0 Bureau gespe Brusselsl.jpeg 164 100 4595 0 I am a Halo fanatic. Garules_normal.jpg 23 241 5865 0 The official teEastern Tmal.jpg 1231 1143 1570 0 In addition to Eastern T _normal.jpg 366 415 9088 14 16|schüler|n Berlinormal.png 521 549 133 0 Offizieller TwiBerline_normal.jpg 33 454 540 0 Microsoft TecGreenlanormal.jpg 736 1218 4840 0 For all your XPacific Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 184/475

ormal.png 0 362 22772 0 Central Tial.jpg 3595 3496 25349 92_normal.png 549 303 3585 0al.gif 254 367 1094 0 Tweeting the Eastern T

_normal.jpg 56 364 14862 03_normal.png 36 141 12994 0 Hier werden Berlina1_normal.jpg 79 281 21301 3 http://top-sf Moscow

d16f70d5_L_normal.jpeg 1 41 1021 12_normal.png

5-0aab-424e-ab7a-d3fde94744 170 204 1428 1 Windows cha Amsterdta_normal.jpg 70 91 74 0 Microsoft Par Amsterdogo_normal.gif 5318 5021 182877 7 http://mentalAlaska

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 185/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 186/475

1-5227-43fa-a11d-5c3c9e5ad8 1580 3151 62899 6

“Winnersare notthose whonever fail,but those

who neverquit”

I tweet alot, but I amnot a bot. Eastern T

d_Nana_Da_normal.JPG 1901 1430 24006 219 Love being a Central Ti0508_normal.jpg 130 129 3855 0 Berlinal.jpg 182 90 308 0 Philipp BegaßBerlin

one_normal.jpg58648988080_1281544236_3 2036 1859 3988 0 Love #LOVE quotes. Pard-3_normal.png 7 954 57009 0mal.jpg 356 234 451 1 Business Dev Central Tiormal.jpg 77 28 89 0 Advanced Ad Central Ti

ormal.jpg 7326 6673 73896 6 Much more is Brasilia

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 187/475

3_normal.png 4188 4091 10729 0 Tech News, GPacific Tiar_2_normal.jpg 226 487 6388 0 Chief Geekol Atlantic Tde_normal.png 381 1310 6158 1 Journalist, M Berlinrmal.jpg 593 756 23886 1009 Berlin

o_normal.png 4572 4516 4226 2 Hi, I blog abo Central Tiov_normal.jpg 17769 16557 11619 0 Welcome to Greenlan _06-LunarEclipse-web_normal. 4255 5673 79435 0 I provide the latest new0_normal.png 319 99 1630 0

ormal.jpg 2194 2469 3582 0 Committed t Eastern T

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 188/475

es_normal.jpg 9058 8233 17860 0 Resource Spe Singapor

ormal.gif 747 402 1146 1 Plecco Techn Eastern Tid_new_copy_normal.jpg 961 305 3991 0 Chattertrap is Pacific Ti

nathan-small_normal.jpg 676 393 2770 32 Photographe Indiana (

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 189/475

normal.jpg 2715 4587 114895 0 Livin the bachPacific Ti7a_normal.jpg 10169 10516 23184 0 On the rebou Eastern T _normal.jpg 630 1148 2416 34 Digital ArchitEastern Tormal.png 2636 2396 2089 0 World Class HPacific Ti6_normal.png 0 341 18461 00_normal.png 0 301 27575 034982889929_1091781379_1 482 689 17749 2 Happy go luc New Del _normal.png 5180 9691 3585 4 Web DevelopAlaska

3_normal.png 762 1417 53439 0 pigment, azo New Delc_normal.bmp 6070 5668 44471 0 Twitter vision Mountai _11_normal.jpg 10755 9880 15189 0 Eastern Tal.jpg 1388 1322 1889 0 After a career Alaska

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 190/475

g 2264 2528 10232 0 Jobs in India, IHawaii

al.png 2002 1656 6183 89 If you travel oCentral Tir__Internet_3_0_normal.png 1410 1390 21024 0 I introduces t HawaiiessedSmallBobHeifler_normal.J 2001 1751 1048 0 MyAccessProPacific TirNarrow_normal.JPG 1192 1032 1013 0 Microsoft AccPacific Tial.jpeg 1673 1662 6484 1 Avnet’s Soluti Pacific Tirmal.JPG 10 2081 2564 0 News for soluCentral Tibigger_copy_copy_normal.jpg 46 666 30413 2 Latest trend oHawaiiez_normal.jpg 33 142 3491 0 Self-confesse Eastern T

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 191/475

g 2002 1170 18854 0 Central Timal.jpg 3698 6555 11476 101 Entrepreneur, Mountai4_normal.jpg 5985 10182 6519 1 former, recov Quito

oYf_normal.jpg 1957 1359 4782 9 The word 'imHong Ko

ormal.jpg 25 301 14619 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 192/475

s_normal.bmp 601 1044 6646 4 Your ultimate Hawaii8_normal.jpg 691 203 347 0 I teach people how to i

filePhoto_normal.jpg 1254 1520 7746 20 Mobile Phon Londonnormal.jpg 2242 2010 2381 10 Orgulhe-se! NBrasilia

rmal.jpg 395 137 342 0 I am creating Pacific Ti3_normal.jpg 893 571 363 0 Get My FREE Mountaiormal.jpg 1975 1957 33406 0 NEW'S poste Eastern Tormal.gif 72 134 3727 0 Londonal.gif 496 574 2664 0 London

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 193/475

normal.png 4630 4556 4734 0 Professional SGreenlannormal.jpg 1016 1669 33660 1081 infosec, secur Greenlan6_normal.png 2002 2057 2775 0 Denver Jobs Central Ti2_normal.png 0 363 28021 0

normal.jpeg 688 505 22463 1 New Del

mal.jpg 681 522 20133 1389

IT

Tweet Amazon

http://bit.ly/bGniQx

Tokyo333_6265_normal.jpg 294 2141 7286 0 Tokyoormal.jpg 10 15 52 1 Eastern Tw1_bigger_normal.jpg 91 93 127 0 Total SolutionEastern T

lag_of_Brazil_svg_normal.png 330 72 1931 0 Santiagog 1118 282 10684 7 Greenlan _normal.JPG 126 75 891 1 Um Rubro-neBrasilialambendo_tela_bigger_normal 780 325 8500 2 Nunca perca Brasilia

3_normal.jpg 618 195 1863 0

S_001_reduzida_normal.jpg 1755 1455 22813 6

Sou cidadãdo mundo!Sou mãe!Tenho odom deperdoar eamo todos!!!

Brasilia

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 194/475

g 148 32 2672 118

EmanuelSantana.MúsicoViolinista... Não sou

nada alémdo quepossa ser...Me mercoem quatrocordas e meacho nosom... Santiago

-28b2-4fc3-8b4a-a17425d1126 136 173 1189 6 Quero sair, p Brasilia

g_normal.jpg 128 68 523 0

DynamicsCRMConsultantandProjectManagement Lima

l.jpg 4 2727 18846 0 CRM News - Mountai

normal.jpg 44 3071 13364 36 All Things iPh Eastern T0_normal.jpg 386 244 4373 19 Web Develop Eastern T

ogo_Thumbnail_Small_normal. 10 14 41 0 MicrosoftKB1 Alaska3-d8e7-4c47-9612-665f4410e6 1902 1291 25364 17 Wife and Mo Central TiE_BREATH_IN_..........._normal. 2498 2697 51003 145 ER NURSE I KCentral Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 195/475

-thumb-48x48_normal.JPG 1477 648 9338 28-692e-400a-a593-392c414ee 2551 2424 122438 538 Follow at you Eastern Tl.jpg 33 5 78 0 Brasilia-c64d-471d-9d7f-79549bba4eb 209 83 1865 3 Brasilial.JPG 568 158 3152 6 Santiago _normal.JPG 105 34 129 12

normal.jpg 1315 1453 767 0 O Prêmio MicSantiagog 330 213 3872 3 Ser FELIZ é a GreenlanRobot_normal.jpg 813 399 1279 0 Wondering w Londonell_normal.jpg 1944 1795 27284 0 I work on co Pacific Til.jpg 151 90 364 2 Jaaa-Buuu-La Brasiliaal.jpg 137 67 176 467 O cofre do ba Brasilia

e_normal.jpg 127 205 6428 1 TRUST-IT (TRAthensrmal.bmp 10597 9658 89016 0 Self LeadershiPacific Ti6_normal.png 1 2203 45660 0g 168 273 3847 1 Soy una pers Greenlanormal.png 1038 999 1297 0 I write about anything.

normal.png 252 349 9518 0tphoto_normal.jpg 760 279 202 0 I love technology. I live

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 196/475

_256_normal.png 2842 2584 39907 1 Eastern T _Symbol_normal.png 62 1052 77222 0 EntertainmenLondonon1_normal.png 1568 1438 60924 0 One place, Tech News formal.png 38 682 14371 0 Featuring the Pacific Tinormal.png 87 289 24826 0 Communauté Paris

filePhoto_normal.jpg 8357 7871 119174 18 I know you're Brasilia

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 197/475

al.jpg 1027 88 49 0

I'm a big fanofoverclocking...TakingCPU's/GPU'sto the MAX!www.maxoverclocker.inf o Greenlan

logo_normal.png 0 1544 51907 0 Top articles of the day0_normal.png 0 431 21566 0

r_-_C_pia_normal.jpg 837 583 10804 1 Sou como vo BrasiliaJaneiro_137_normal.jpg 163 48 1149 2al.JPG 256 214 1506 5 Brasiliarmal.jpg 919 959 3369 23 Media Profes Brasiliaormal.jpg 44 1455 6854 3 Follow V3 on twitter to7-dfbc-4a16-a59a-ed88d7f4dd 186 159 953 17 Pacific Timal.jpg 76 54 289 1ain_small_normal.jpg 395 267 307 0 Blue Logic is Lisbon

ormal.jpg 2879 2989 14908 0 Woman alwa Quito _normal.jpg 196 156 929 78 Chief ArchiteCopenhaofGravatar_normal.jpeg 274 795 10327 198 Opinionated, Amsterdal.jpg 174 113 443 0 Aspiring soft Stockholes_normal.jpg 167 186 256 0 Copenha _normal.jpg 219 3524 7080 3 Chief ArchiteJerusale-01-20100127_normal.jpg 231 366 30566 3 Pacific Ti

al.jpg 0 1310 20093 0iphone_normal.jpg 56 81 2343 13 New Calete1_normal.png 37 13 341 0 Brusselsanker_normal.jpg 195 196 1520 04_normal.png 1318 805 6 0 Твиттер и сео. Как сдеedHeadshot_normal.JPG 1888 1834 1603 1 MyAccessProPacific Ti45_normal.jpg 3335 3039 8852 0 New Delrmal.png 402 4606 23222 1068 Twitter, socia London

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 198/475

5_normal.png 20 1334 47929 0 Hawaii6_normal.png 0 1373 121045 0logo2_normal.GIF 146 2435 64339 0 SEO, SEM, SMKolkata

e_normal.jpg 1184 805 5301 0file_pic_normal.jpg 723 335 1392 0.0-180x180-ohne_normal.jpg 61 304 12033 0 Esport-Clan s Berlin

riff_Logo_normal.jpg 577 576 3495 0 Daily Tech News From

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 199/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 200/475

ger_normal.jpg 20 248 6625 0 Online Shop PAlaska.jpg 1642 1561 24663 86 Parenting, Co Eastern T

rmal.png 0 1216 35556 0 Amsterd4_normal.png 0 161 2297 04_normal.png 0 148 3821 0

ormal.jpg 57 785 31541 22 • Горещи гей Sofia

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 201/475

al.jpg 3 1629 91560 0 http://myspa Berlin

-green-48_normal.png 9 54 2278 0

Trader in aBankIn ourgroup, wesharing

stock insiderinformationand news. Bern

_normal.png 87 36 499 0 Vascaino, PiloBrasilianormal.jpg 22 290 3293 2 Microsoft M Mumbai1_normal.png 590 192 5109 0normal.jpg 720 344 4063 0 Your typical gPacific Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 202/475

ormal.gif 161 257 10951 0 Daily TechnicPacific Ti

al.png 98 1083 44211 0al.png 38 1874 64867 0 Junk Food for Amsterdo.php_normal.jpg 1279 1092 10217 0 Your Ultimat Mountailing_normal.jpg 5183 5107 27624 0 Video Game Pacific Ti0_normal.png 225 183 1510 0 Game lover, i Tokyormal.jpg 1382 773 8336 0 I love tanning Eastern Tal.JPG 1981 1859 6188 0 Making this yPacific Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 203/475

rmal.jpg 5939 5756 6923 0 Xbox 360, WiiPacific Ti2_normal.png 1 307 12958 0 Berlin

ing_twitter_bigger_normal.png 1114 3667 165887 0 This is the fee Alaskaormal.png 7 36 65 0 Kuwait Daily Kuwaital.jpg 151 57 522 0 Travel and di Kuwaitg_normal.png 88 118 898 1 Kuwait Blog, Kuwait

rmal.gif 25 659 354 0 Web design c Kuwaital.png 650 126 192 0 Kuwait Free Kuwaitrmal.jpg 337 87 105 0 Find all Sales & Savingsbon_normal.jpg 7863 7744 8612 0 Learn more a Pacific Ti-b2de-45af-895d-c5be753c73b 733 5866 172961 0 Eastern T

mal.jpg 30 238 7706 0 Alain is a SwisGreenlan96_normal.png 1 425 2951 0 Hello, I am ht Pacific Tifall-closeup2_normal.png 1001 1130 7306 2 lead software Central Tis_normal.jpg 30 7 32 0 ع اي ر اش لز يد د يق د ياج و ك ل رسا ي جس ا ر رد يق ئ ر ه يك ز ل ا و Kuwait

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 204/475

ormal.JPG 1979 4052 5829 63

Soydemasiadosimpatico!

Obligado alDesktop! ¬¬ SiempreTuiteo cosasimportantes.

martin.morales@live.cl Quito

30_normal.JPG 1493 370 32238 2 Brasilial.jpg 396 107 2537 0 Santiagoormal.jpg 336 144 4385 0 Bio Brasiliapg_normal.jpg 86 59 2791 6

mal.jpg 845 728 9333 0 Microsoft XBGreenlannormal.png 903 307 276 0 Almost 40, al Canberramal.JPG 944 939 40882 26 Love Contests and Give

es_Christmas_2006_normal.j 339 277 5360 3 I've been mar Quitoal.jpg 123 53 47 05_normal.png 456 80 594 0.2_normal.jpg 135 44 405 0 Estudante e e Brasiliarmal.JPG 343 127 845 0s_icon_normal.png 112 1230 83332 126 Tokyo

hoto_F__In_Flight_576128_nor 1589 1000 7655 0 This is an aweEastern T2_normal.pngmal.gif 5 489 8295 0 Follow the fr Mountailue-main_Full_normal.jpg 300 624 37275 0 Let's make dr Mumbaiale_ruler_2_normal.jpg 7 734 126343 0 The Newest Engineer Jtton_normal.png 0 667 19913 0 A river of twe Hawaii3_normal.jpg 349 314 18346 0 We offer trained, skillefilePhoto_normal.jpg 1987 879 18506 3 Internet addi Hawaii

rmal.png 12 555 17931 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 205/475

rmal.JPG 42 331 13672 0 Central Tirmal.jpg 0 600 17698 0 Get the BEST Hawaii

9_normal.jpg 836 838 3605 6 Computer Bo Central Til.jpg 90 160 13428 5 i am who i amSingapor

ormal.bmp 47 515 14918 0 Games News, Pacific TifilePhoto_normal.jpg 78 327 6098 3 MCT/MCPD/ Greenlan

ormal.jpg 1537 490 352 0 360° IT event London

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 206/475

_normal.jpg 1083 1281 17889 1

InfoSecBlogger,AmateurPhotographer,GadgetFreak

,GreatFriend&now asecurityresearchintern. London

_142646_normal.gif 65 690 1651 0 Protecting priGreenlanonontop_normal.png 782 726 6875 0 Roer.com is a Paris

mal.jpg 81 88 2905 10 Firefox add-o Tokyo

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 207/475

9aa06f2d118fc9a0d6c36de3_n 429 991 35304 609

Firefox,Greasemonkey,JavaScript

TL

http://wrapper.wiki.zoho.com/

40post/day Tokyo

ye2_normal.jpg 0 1018 54703 0 Taking a ClosPacific Tirmal.JPG 1797 855 11256 0 IM Wizard, CMelbour59_normal.jpg 645 683 24406 9 Ser humano a Mexico C

9-1ca4-4435-aafe-b713c5a6e7 468 3998 11718 3 Le Web de de Parisormal.jpg 166 167 383 0 Si vous voule Jerusaleal.JPG 74 39 144 16 Além de muitBrasiliaormal.jpg 235 264 2355 1 Student of Or Zagreber_normal.JPG 127 157 163 0 Academic De Zagrebgem__1__normal.JPG 230 94 57 1 Brasiliarmal.gif 639 679 19640 0 See PHOTOS of my curral.jpg 143 156 694 5 experienced Amsterd

2_normal.png 7404 7124 43717 0 Central Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 208/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 209/475

er_normal.jpg 2001 1268 2808 0

http://u-kompa.ru

music, newmovies anda lot .....

all free andavailable Londonl.jpg 3073 3338 15682 1 Web Design Dublinggio_normal.jpg 5946 6300 37642 13 Web Design, Pacific Titer_normal.jpg 154 106 475 6 HTML, CSS, JLondonmal.jpg 140 35 757 7 Brasiliaper_money_people_normal.jp 12 1633 92310 0 Consulting Jobs. Tweet

Social_Media_normal.jpg 178 72 1881 0 DataDrill deliEastern Tfile3_normal.jpg 986 1117 11873 2 All-in-One AgiEastern T

015_normal.jpg 95 59 1914 2 Sigam me os Santiago488_33603_807_normal.jpg 47 26 589 1 Brasilianormal.jpg 1633 1475 7044 5 Información t Madrid

ersummaries_normal.jpg 925 655 658 1 Lo mejor de l Madridrjavier_normal.jpg 48 33 481 0 Apasionado d Madrid9e74-432e-95bc-3ae4dbba880 292 359 19032 2525 Interrest in sp Bangkok _normal.png 112 489 22071 195 /īm/ /ə/ /prō Bangkok _normal.png 292 1639 6553 1095 Born in MENMadrid _ed_normal.JPG 569 702 8597 43 Sociologa, deCaracasal.jpg 392 381 3881 298 Madridia2010_normal.jpg 595 493 8931 1097 rock´n media Berlint_normal.png 3320 3180 10545 0 Finest and m Eastern Te_normal.jpg 98 144 6933 0 iGetYouNews.com - All4_normal.png 47 10 240 0 __normal.JPG 245 359 2589 1 Managed PrinMountainormal.gif 416 726 1952 0 David MarshaCentral Ti

Mattel_small__normal.JPG 4366 4165 7766 3 VirtualPath ut Pacific Tiore08-CWT_normal.jpg 732 896 28636 0 Innovative MPacific Ti174734850_127368694850_2 138 222 944 0 Si quieres est Madridl.jpg 214 269 1721 2 Periodista, bl Madrid

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 210/475

filePhoto_normal.jpg 338 132 1614 46 32 year old m Chennaial.png 928 957 19381 1 Software EngiHawaiiweb-web_twitter_b_normal.pn 15 1174 7046 0 The Global Le Pacific Timaior_normal.jpg 241 343 5880 40 I'll pull your cBrasilia80_1304964_5834_normal.jpg 155 645 4685 13 Product Desi Brasilia

ot_normal.png 1294 1380 14677 19

$(world).ready(function(){$(world)

.removeClass('Poverty')

.addClass('Love PeaceHonesty BrotherHood');

});Hawaiial.jpg 141 1240 62599 0 Stock Ideas, Eastern Tnormal.jpg 0 678 16870 0rmal.png 781 483 543 0 Greenlanal.png 112 85 758 3 As vezes não Greenlan

mal.jpg 564 326 532 0au_mit_haenden_2_normal.jpg 53 78 763 0 Berlin

6074_4544_normal.jpg 172 149 331 0 Greenlan10_normal.jpg 5511 5511 53944 0 I love to travel the worl6_normal.png 9 3 41 0 Central Tiormal.jpeg 1094 593 7113 78 I love to ente Central Ti0_normal.png 557 1008 38070 0 Pigment Testing Lab Eqall_normal.png 149 60 439 1 Amsterd3_normal.png 14 114 18535 0242_1661444_8496_normal.jp 484 517 3446 1 periodista y c Buenos Aavicon150-3_normal.gif 2879 2760 58735 0 Covering videCentral Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 211/475

h_news_normal.png 1180 1044 4349 0 Breaking gee Pacific Til.jpg 0 322 27715 0023-note-over-mouth_normal.j 1890 1455 2447 0

rmal.jpg 2002 1826 37451 13

Tweetingtechnology,randomnews, anddeals.I follow back Eastern T

rmal.jpg 454 241 1474 14 Happy compuCopenhaogo_normal.gif 15 2582 82637 0 Our best can Pacific Ti _normal.jpg 1605 443 613 1 Online Innov Pacific TiH_MOUSE_Feb09_ws2_norm 596 331 16973 0 Pacific Ti _hedgehog_2006_game1_nor 471 155 2106 0 I love playing video gam

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 212/475

_normal.jpg 0 677 30937 0 HotUKDeals Londong 240 77 340 0normal.jpg 1927 1954 72538 170 Tokyo0_normal.jpg 1003 742 17450 2185 ※ Tokyo

ormal.jpg 282 246 2983 58 I work, play &Eastern T _normal.jpg 141 62 2174 0 Maria Alice F Brasilia

filePhoto_normal.jpg 293 169 119 1 Pacific TiJAN_037_normal.jpg 177 76 1012 26_normal.png 85 22 237 03_normal.png 4 208 6571 0

ress-launch-004_normal.jpg 1781 432 826 0 I love my xbox and i ca _normal.png 320 281 7476 25 Cupcake enthPacific Tie_normal.PNG 305 189 177 0 Agencia de mSantiago

-512c-4f23-9494-ec5ad7d1443 57 1056 55056 1 “root is alway Alaskaormal.jpg 152 76 1398 0 DJ e professor de Educ2-878b-445b-a17a-6b6a30fe47 695 316 4147 16 Un bombero Santiagooura_designerAVATAR-2_nor 418 278 3677 1 Designer Santiago

normal.jpg 205 166 1598 8 an Osaka-bas Osaka _normal.png 3771 3700 25559 0 True Friends Singapor

d_normal.JPG 60 378 20557 0 Singapor _normal.jpg 479 788 28798 0 The Official FPacific Tirmal.gif 489 672 24807 0ormal.jpg 494 842 28588 0 Pacific Tinormal.png 4207 4168 29738 0 Wisdeo.com i Pacific Ti

ur2_normal.jpg 101 111 3160 0 Paris

-yo_profile_normal.jpg 230 140 3950 0

Web

Programmerin panama,makingwebsitesince 2002.PHP /MYSQL /ASP / SQL /SEO / PPC /CSS / AJAX Mountai

normal.jpg 0 3111 6450 0 TVN Panama, Eastern Tal.jpg 1942 1602 4104 2 SEO Expert & Mexico C1-20100308-1017_normal.jpg 29 38 547 0 EMO can des Singapor52673011028_1057471460_3 166 184 6148 0 All day full wiJakarta0_normal.png 60 771 20650 0 Domain, HostMumbailine_normal.JPG 24 1284 42693 0 Online SecuriMumbai1_normal.png 17 797 31142 0 Blogger, BlogKolkatasciptslogo_normal.jpg 37 696 18196 0 Free Scripts, New Del

ogBiz_normal.jpg 282 290 2618 0 Follow me an Santiagonum_normal.jpg 273 415 3123 537 Success is nei Central Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 213/475

al.jpg 276 354 557 19 (´ ` Tokyomal.jpg 74 35 1106 0 Tokyoal.gif 1305 1296 7483 0 I'll follow you Eastern T

-128x128_normal.png 24 440 3005 0 Free- & SoftwLondonal.png 255 277 810 4 Professional Pacific Ti

_normal.jpg 180 155 2022 0 Technical WitCentral Ti

451491574822_1459255776_ 250 88 381 0 programmer Bratislavu_normal.jpg 261 97 2955 0 Futuro design Brasilia _normal.png 54 21 322 0 En actualizaci Buenos Afile4_normal.jpg 464 339 9432 1 All-in-One AgiSantiagotar12_20091003_1070238230 628 346 1267 0

normal.JPG 42 45 113 0 Amsterd _normal.jpg 41 743 9760 14 Tall, blond anLondon

r_normal.jpg 137 58 496 2 Top 5 80's co London

st_Game_Logo_resize_normal. 5714 5461 45363 1

DeliveringEquity andM&AAnalysis,Stock Picks,andFinancialMedia /

PersonalTwitter:@anupamk130LinkedIn:http://www.linkedin.com/in/anupamk Central Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 214/475

on-Small_normal.jpg 283 211 900 0 Information TCentral Ti _normal.jpg 461 4756 9432 30 Talent Engag Central Ti _normal.png 1848 596 2552 0 :: participand Brasiliaot_2010-06-10_at_12.50.20_P 198 132 943 66 Centro Apple Mexico C

0 589 99164 0 The first russiMoscow

1991 544 473 1 ИТ и IT-бизн Moscow82 17 348 091 26 250 0

0 27 1896 0 All Microsoft Central Ti540 1588 17769 17 A Biomedical Cairo

12 86 5877 0 Amsterd21 27 281 0 Nerds On Site Pretoria

107 70 267 45 Madrid1 1 1 00 257 15775 0 Budapest1 1 6 0 Quito

68 220 2132 13 Tokyo308 20 442 63 Why worry? Central Ti

3 29 775 0 TechTarget helps techn

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 215/475

950 725 1760 15

IT

/movie/Soccer/NFL/IT/Mobile/Car/motoGP/F1/SecondLife/Cycling/Business/ Tokyo

0 2 265 07 112 2009 0 The People PlEastern T

36 8 298 03 33 782 0

47 156 3738 2 Big, mean, naCentral Ti554 883 927 1 Strategy cons Pacific Ti

219 247 6718 0 College stude Pacific Ti9 6 124 15 Big hair. London

27 24 294 2 Brasilia

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 216/475

25 138 5291 1 Quito12 38 390 2 Patrick DolinsBerlin

774 552 17758 6 Quito27 27 362 0 Pacific Ti

280 139 575 5 Quito0 14 9 1 Bogota

108 405 33643 0 Paris

0 79 1291 023 72 2438 1 Microsoft TraArizona

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 217/475

0 55 1249 024 23 139 1 Addicted to GEastern T

8 134 4074 0 We monitor t Pacific Ti38 18 73 0 Tech, softwar Bogota40 12 127 0 A complete investors g32 159 2044 2 Windows For Hanoi

116 23 261 091 15 254 084 79 1039 7 Esperantistin London

1 107 956 0 SNL Kagan. MEastern T0 1312 34964 0 Online source for the la

393 598 10235 0 voracious rea Mumbai61 85 3205 1 Jakarta

173 93 1047 1 w biasa aja... Jakarta

158 128 569 199 MD of a BI CoLondon49 140 3937 1 P990i & P1i Singapor0 6 127 0 mobile mögli Berlin

121 45 29 0 Nothing is impossible t104 34 315 0 married with Jakarta

21 11 94 2 networker, penguin ab354 338 2390 8 HRM - interimAmsterd428 95 149 2 Toda tecnolo Santiago

55 11 258 0856 724 2462 0 President, EMEastern T

0 348 10543 0 Най-важните Sofia2 463 1340 0 journalist Berlin0 2043 108408 0 The Real OfficJakarta

1753 1174 2972 0 e-Commerce, Eastern T82 81 574 24 Tokyo28 24 195 0 I am IbukunolWest Cen64 57 1334 1 85.27% gingeHarare65 20 283 0 Alaska

243 164 237 0 Social media Quito1415 1010 3896 0 Purely conjec Alaska

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 218/475

203 210 1757 3 Is an enterpri Eastern T157 183 5832 192 can you gues Adelaide139 73 1126 5 i love design. Eastern T

36 7 16 2 Eastern T1933 961 425 0 The IAFM proBern

5 6 271 0 VIP

859 466 6339 6 Internet Strat Amsterd1 113 2897 05 439 62121 01 7 504 0 Trucuri si pro Buchares

31 7 25 0 The AKSHAYA New Del0 38 1058 0 Buenos A

84 10 289 04 1338 50831 0 Most recent Pacific Ti

16 14 178 0 Seoul

78 20 98 10

On-SiteComputerTrainingprovidesqualitytraining thatisconvenientfor ourcustomersat an

affordablerate. The PerfectTraining ForFraidy Cats!! Eastern T

103 55 741 1

DynamicsCRMDynamics GPDynamics SLDYnamicsNAVDynamicsRMSOCSSQLVMWareSharePoint2010 Pretoria

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 219/475

0 175 2885 0 twitter de niu Santiago

13 6 7 0 Islamaba90 127 3667 8 believe in urs Pacific Ti

1 185 6011 0 Hawaii369 290 170 0 The cause ma Eastern T

13 109 4753 0 Moscow4 219 9359 0 Love travellinPerth

90 88 9173 1 Brasilia98 112 139 0 The world autLondon50 16 344 054 30 39 1 Software EngiHawaii76 126 664 0 Professional Berlin18 38 45 0 Steve has nin Eastern T

141 153 1475 1194 A Solution EvCentral Ti3 8 144 0 Rome

105 118 5389 0 News from ar Hawaii

0 76 4674 033 7 135 0 Soy DJ y tengBuenos A397 207 2998 0 Bestekar,müh Istanbul

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 220/475

82 76 871 1 A music loverLondon67 62 1257 0 Play wii? Central Ti20 11 288 0 Alaska

266 272 2467 120

Entrepreneur. Technologyenthusiast. Because of

technology,I jet out ofbedeveryday.It's trulyexciting. Nairobi

74 54 1338 0 Pacific Ti0 421 11369 0 Business, Fin Eastern T

62 40 1051 0 Jakarta

2720 2339 2070 0 Rajesh Web dEastern T206 700 15189 7 Like to tweet Pacific Ti

6 9 37 0 All things Po Quito90 454 7046 1 .Investor.Tec Pacific Ti

101 152 2200 1 IT Account ExEastern T52 414 9772 3 A Technology Eastern T

6 162 2962 0 Worldnews v Berlin483 277 437 0 Clicks2Custo Pretoria

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 221/475

31 29 1244 37

I'M FROMNYC &Student oflife &Move Maker

$$$$$$ Eastern T67 64 4570 3 ♥ǝq oʇ ǝɯ ʇuSingapor0 82 2820 0 Quito

92 11 432 063 105 279 0 Electronics,DiChennai

100 24 373 0 tall dark and beautiful?957 6786 1607 0 Stay up to dat Madrid

23 15 60 0 naughty but nice83 140 1282 48 I consult with Central Ti34 31 11 2 Brasilia

265 265 7369 1 Products You Arizona1 7 14 0 AntiSpam Brasilia

23 379 7502 9 Pissing off rigMountai50 13 100 018 36 301 12 Kyiv42 52 1075 0 Central Ti37 111 73 0 Brasilia

1618 1357 1471 13 Interested in London104 16 19 0451 255 261 36 Technology e Central Ti105 119 4539 23 Geeks, know Bangkok

788 600 3405 3 Technology ENew Del61 55 351 1 Gaúcho, estudante de

0 95 3810 030 33 901 5 Design, HTMBerlin

610 571 17482 0 ...Products YoArizona78 96 955 085 251 8472 16 gue ya gue Pacific Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 222/475

4 70 18848 0 1833 1804 18079 0 Current news Quito

1 35 1043 0634 501 2553 1 degradável. NGreenlan

47 37 293 055 66 827 1 Brasilia

15 352 2568 0 Looking for SPacific Ti46 10 418 017 200 3935 1 Central Ti

1173 1198 6922 0 Tecnología V Santiago129 79 2042 3 Hi there!I'm fauzi a.k.a114 230 5210 0 A river of tweets (ROT)

95 38 216 21

Trabalhocomtecnologiaonde souumtremendoentusiasta!Além dissogosto deassuntos deconhecimento geral e

espiritualidade! Detestofutilidades emodismos. Brasilia

464 1154 6694 33 NJ-born, NY-eEastern T107 69 2356 2 I rock. Singapor

1 156 7522 0 Your source f Abu Dha67 181 6320 28 Music lover, Lisbon47 339 13317 0 International Real Estat

2 34 977 0 Tashkent98 41 424 0

138 109 1674 2 Your Search ENew Del

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 223/475

0 383 10490 0 Dublin44 33 139 0 Eastern T74 100 1246 0 Saxophonist, Jakarta

0 33 1592 057 66 1947 2 Quito

0 74 2993 00 490 65829 0 Amazon.co.jp Tokyo

11 441 129061 0 IT Pro, Webd Berlin84 87 1403 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 224/475

58 15 263 00 53 1916 0 Kyiv

18 31 368 1 Brasilia194 176 4172 10 ♥ Kuala Lu

97 104 1061 0 Building qualiPretoria

1 464 18567 0 Watching the Quito72 71 661 0 Berlin121 450 2582 0 Riga

13 35 335 1 Moscow

100 197 3149 2 Real blonde. London

88 122 5019 3

=The law ofthe jungle.IT tech,Intranetmanager,Catalogphotographer,Mountainbiker,Runner,IndoorsFreeclimber,TV seriesand AnimeLover. Rome

90 163 629 1 Chairman BarQuito

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 225/475

103 61 476 1 kinda geek, I lRome

0 63 641 00 59 641 0

20 61 702 00 48 641 0

0 194 4366 014 121 19484 011 11 182 0 A great AmeriQuito11 9 170 2 Novosibi

984 1058 2261 0 Discover how London18 18 212 0 Vladivost

6 55 529 0 Web develop New Del2 209 6417 0 Greenlan1 81 3561 0 Web Design London

58 66 316 1 NYC Born anEastern T604 704 7040 2 Creativo visioSantiago

30 17 156 0 Quito1114 562 5237 1 London150 144 1107 0 Brasilia

43 72 1324 053 34 14 015 52 708 0 Istanbul

27 1965 15818 3

CorporateDynamics &Interaction

Strategist

Personal /corporatebrand &communitystrategist,coach,trainer,consultantand ownerOpenNetworkers.info Amsterd

14 39 240 0 Codestone is London71 84 301 0 Training, OpeEastern T

0 104 207 0 Istanbul53 134 2390 2 Nerd Santiago

9 2 3 0 New Del0 85 2914 0

13 14 249 0 Jakarta

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 226/475

197 74 328 0 Brasilia

538 700 18338 1233 sometimes cr Greenlan125 104 1153 0 Dublin, kayakiDublin

5 2157 65437 0 Chicago City Quito70 35 33 0 London

1289 942 30879 6

The One....#Gamer #TechGeek#Realist Eastern T

30 477 1517 3 User ExperienTokyo

127 55 17 1 Entrepreneur Central Ti16 5 11 0 IT Pro fond of Messagin

0 72 2711 00 21 1280 0

69 64 158 0 Diretor Tarus Brasilia25 36 96 0

9 105 4780 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 227/475

23 21 28 0 Sempre serei Brasilia89 76 836 0 Jakarta64 177 720 2 Cairo

219 148 1048 5 Rent-a-seanc Quito16 9 35 0 Professional Bern68 141 1846 0 I'm an analytics expert54 46 402 068 162 3267 0 Citizen activisEastern T

132 169 973 10 I'm an AmericBuenos A

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 228/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 229/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 230/475

1651 492 879 0 Technology EMumbai

35 32 1271 2 Multimedia P Hong Ko

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 231/475

357 900 25031 58 friendly, love Pacific Ti

98 47 1638 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 232/475

153 75 2686 0

137 75 2158 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 233/475

80 63 2263 0

99 83 2656 0 Arizona

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 234/475

53 65 2357 0

150 37 1198 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 235/475

12 58 2454 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 236/475

146 37 1463 0

2 18 723 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 237/475

96 157 2552 0 Business OwnLondon

32 73 2033 0 We all want to be high

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 238/475

59 166 4720 0

54 39 135 0 Analista de S Brasilia

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 239/475

2 143 7987 088 41 35 0 Off-price stor Eastern T70 114 3443 0 Husband : FatCentral Ti

476 526 1059 19 Construction Central Ti

250 103 4033 3

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 240/475

73 68 2803 0 Philly Web D Eastern T

887 458 4321 0 let's share begin

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 241/475

0 186 10957 0 Tech news, reCentral Ti

92 484 20093 0 The Tech AggPacific Ti

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 242/475

0 108 8322 0

1 466 24111 0 my Workz on Seoul7 46 16 0 With over 30 Abu Dha

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 243/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 244/475

45 182 8068 0 Buy,Sell & TrAlaska

22 40 4050 0 Sydney

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 245/475

1 472 30338 0 Top stories fr Pacific Ti

398 323 10234 00 2 6 0 Оптовые и р Moscow0 194 3260 0 http://you-te Alaska

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 246/475

2404 2430 1509 6 Developer of London447 527 11715 1 Normally I acSingapor

0 269 13773 0 Snarf! Tijuana

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 247/475

262 139 2426 156

/ /

/PC/ /VMware/

/…etc

Tokyo

1 194 12271 02 79 5599 00 35 771 0

417 545 6502 697 web, python, Santiago117 150 594 0 Brasilia

0 98 3157 0 The Top IT JoLondon24 60 847 062 61 2216 2 Studente di li Rome

0 11 332 014 8 36 0 Rome59 33 93 0 Athens

0 223 7614 0141 74 1312 21 I hate the Int Central Ti

22 76 712 0 - Founder an Paris0 269 12831 00 115 11745 0 Osaka

46 27 1187 1 Eastern T76 17 68 0 Brasilia

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 248/475

0 90 7078 0 Intentaremos Bogota279 778 21141 597 R.I.P Michael Melbour109 43 111 0 cup, taliban b Berlin

1998 1590 107 0 Researcher Eastern T7 67 2575 0 Con Los Bites Caracas7 38 743 0 World leader London

128 119 11040 1147 Tokyo

13 93 3982 3

Certainly a Tech Fan.Currently inSingapore. Singapor

74 414 9298 8 knitting addic Greenlan215 231 6574 90 I am: 25 year Eastern T

2 17 679 0 Apple news frHawaii352 303 388 2 Professional cMountai

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 249/475

0 47 1673 0 Auramis ConsBerlin1 76 5018 0

108 95 627 1 Motor-uitlaat Amsterd64 65 188 0 Tech/energy London

177 172 354 0 Knowledge a Eastern T2027 1837 22477 0 Hawaii

0 34 4562 059 388 17327 88 Best Source f Eastern T

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 250/475

13 16 16 0 One of the lar Eastern T368 83 304 0 Automatisierter Feed a445 266 1953 8 Safe from borMadrid198 104 97 1 Media consul Berlin

0 575 97297 0 Berlin0 881 163329 0 Greenlan

17 8 1125 3 Gotta walk Eastern T17 45 1623 2 Textpipe friction and as148 231 1789 0 Noticias sobr Buenos A

14 47 2049 0 Good Hand Berlin

42 48 730 3

/ /IT/ //

Seoul

40 16 95 2 I'm Sheena a Dublin

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 251/475

0 0 1 0144 220 3483 0 Programa de Hawaii

20 619 6660 0 415-494-860 Central Ti145 146 1294 0 IT profession Eastern T

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 252/475

227 172 5030 196

FX2

8051

Osaka

100 163 373 13 Bertelsmann Berlin14 203 22415 0

1 463 264 0 The Official TNew Del234 173 807 3 London

10 54 2272 14 Paris239 299 25523 81 ... A simple ABangkok

2 12 244 0 Quito2 73 2420 0 Technology News & Art

91 18 269 0 Online designer/develo101 54 10 0 well i am easygoing ,se

17 94 3794 29 London130 105 1014 8 SW-EngineeriBerlin

0 14 1011 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 253/475

91 123 8448 0 Computers. Sydney97 31 135 0 I love Muse t London

6 2 3 0 Paris

0 405 21902 0 Hawaii

90 38 197 0

R & D atSpecialEffect

www.gamebase.info

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 254/475

0 497 40414 0 Central Ti26 25 155 0 Attempting t London52 81 791 0 Brasilia

210 748 71 2 Senior ExecutEastern T226 209 6528 114 I'm a proud J Kuala Lu

6 74 203 0 Sledujeme IT, Prague266 445 10838 0 Amsterd

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 255/475

524 268 1566 368

★

VOCALOID PC(CPU Windows ) IT

VOCALOIDVOCALOID

(Append

)Tokyo

23 8 123 5 windowsgoo Baghdad143 40 276 0 I m doing my Chennai486 318 8075 80 Apple][c,MacTokyo

0 15 2525 0 Quito1038 1243 1011 1 A team, on a New Del

28 10 45 0 Truband is an Hawaii37 10 104 0 Final year Co Sydney

0 48 1913 0 Helping you find a job y4 98 7681 0 Eastern T

477 459 4958 29 E só perde qu Brasilia48 38 446 1 Amsterd54 34 555 1 dj/producer Amsterd

130 16 6 1 Expernova ha Greenlan0 0 1 0 smart&sensitive guy

82 44 381 0 M.Sc. in ComCopenha84 80 1016 0 Kuala Lu

0 202 11526 01 0 2 0

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 256/475

97 40 417 1

Environmentalist,CyclingAdvocate,NYS

Ombudsman Eastern T6 1444 241 0 Obviously thi Greenlan1 24 649 0 новости компьютерно

142 367 22062 0 Chennai0 38 1012 0

111 94 386 0

A Strategictechnologistkeeping upwithemergingtechnologytrends inhardware,software,webware,webmarketing,social mediaand security.

Eastern T

287 436 4306 0 L'actualité du Greenlan99 323 8179 0 Internet Mar New Del102 117 983 0 IT Support, HSydney

0 1 825 0 Helping users Sydney70 24 215 0 Chennai

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 257/475

59 103 3585 0 It Came From Eastern T0 3 200 0 Forum za stic Belgrade

0 596 21793 043 44 151 0 Senior Softw Eastern T

126 105 1193 5 Leader for Ha Osaka78 126 4583 2 Microsft MVP Tokyo

0 275 1211 0 Hungary's nu Budapest624 474 7820 5 bookkeeper, Pacific Ti

84 32 415 0 A Networking Quito

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 258/475

398 325 4750 935 Tokyo4 21 927 0 I live in MA I Quito

17 10 973 0 Santiago5 261 21053 6 What´s going on?8 82 5849 0

13 101 1125 0 Hanoi

90 138 7288 0 Central Ti554 540 2235 0 16yr.AerosmiHawaii1631 2195 29069 25 I love reality tDublin

0 81 3150 0 Offizieller TwiBern6 16 426 0

351 649 10860 19 Internet vigilaLondon1370 648 302 0180 991 5314 19 Sacred Egotis London

88 47 1522 1 Santiago0 79 977 0 Mountai

82 80 207 07 6 14 0

54 84 5587 0 Django, pyth Central Ti31 12 271 1 i am a maddd London26 133 1728 0 Jakarta63 134 6624 1 a legeslegesle Greenlan29 97 2572 0

850 647 2960 231 communicati Berlin1 51 1158 0 IT/Technolog Eastern T

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 259/475

24 10 131 0 horticulture atheism hu331 333 2954 2 Technology ECentral A

1025 199 47 0 Estamos foca Brasilia7 148 811 1 O Grupo Ade Brasilia

15 80 4339 0 passie:onderwijs en tec

26 60 2726 1

If you haveanycomment orquestion,you'll findmy contactinfo on page:http://www.facebook.com/arpad.totpal?v=info Belgrade

147 40 1259 0 Hawaii

17 85 3916 899

VOTRESPECIALISTEMAC ADOMICILELANGON33210Du Lundi au

Samedi9H00 -19H00 Paris

0 30 1558 0 Greenlan166 89 2599 0

33 154 4518 024 59 2307 0

207 47 94 0 An accredited ISO 90018 3 19 1 Eastern T

21 8 193 0 Kyiv751 764 689 0 Managing EdiAtlantic T

26 36 7816 0 Ik tweet een Amsterd619 299 1448 0 Entrepreneur,Alaska

57 1047 15039 1 AdvancingWoCentral Ti1606 1487 4768 2 Mobile User Paris

8 781 1444 0 The life of PC London0 338 6801 0 Portal techno Warsaw

92 197 1149 233 I'm a person Hong Ko

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 260/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 261/475

88 135 3099 54 ♥♡ It's nothin Pacific Ti360 1680 17570 17 Uk Producer - Alaska110 38 200 3 Stockhol

35 17 37 0 President of SQuito82 86 1671 0 No! I'm not t Amsterd18 887 102902 3 Berlin

19 144 164 0 26-year caree Eastern T1724 652 938 0 Social Media Rome175 214 5497 6 ASP.net DeveMumbai

90 357 14105 0 Will you give Arizona797 456 9203 0 European and Paris119 376 4185 4 Mozilla hackeBerlin

63 36 1206 7 Graphic Desi London111 189 1292 0 romantic,trav Mumbai

2 127 5946 0

35 38 1768 0 Tokyo1 33 503 0 Five Star AccoEastern T

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 262/475

103 53 623 15

4

⇒

TV

Tokyo110 1149 4091 2 Utah Pulse - Pacific Ti

1172 188 951 5 Técnico em inBrasilia

184 220 1491 27

PlastikOrdek.Modern

HalkKahramani.VerifiedAccount✔ Istanbul

262 295 3250 1

Updates andcommentson globaleconomy,stockmarkets,forecastingand someoff-topictidbits.About me? Ihave a lot ofopinions. Berlin

12 1296 1369 0 Mobile Busin London

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 263/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 264/475

126 53 6371 3

I never gaveyou areason tohate me.You're justcreating

your owndrama ofyour pureinsecurity.

Singapor15 33 366 16 http://websu Moscow63 75 4108 35 IT Tokyo

154 145 1151 5 Nieuws en w Amsterd1988 1265 4392 0 Sofia1323 1350 16638 1 Get Latest Up New Del

31 23 284 1227 261 14541 72 followme if y Pacific Ti

128 127 5426 36

M1

SS

18

:

Tokyo171 93 3334 0 I'm a researc Eastern T

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 265/475

0 45 1842 021 184 9298 3

474 542 4100 7 Tokyo

108 20 13 0 Graphic desigBudapest155 72 307 6 Specialties: MAmsterd

69 104 11059 51 fuck it, im go Eastern T403 397 3223 1 Greenlan

741 717 8947 1324 Hawaii97 58 1029 1 Tokyo47 200 13274 0 Проект для друзей

146 305 1426 0 Posts from th Abu Dha

29 48 536 1 Rome20 497 5429 0 415-671-733 Central Ti

9 255 2034 0 I love web/gr Eastern T

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 266/475

6 95 1698 0 Paris57 43 337 0 Cloud CompuLondon

6 20 467 0

/

/

/

/

/

Tokyo2 1 30 0 Finding each person's i

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 267/475

0 24 1521 0 Tokyo4 13 430 0 Pacific Ti

53 195 5817 2 Expert Social Chennai2 276 57931 9 Hawaii

101 38 1212 155 Helsinki

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 268/475

1998 1683 11998 0

UNCCharlotteStudent -SoftwareInformationSystems.Architectural

Photographer.

I'm a Mac. Eastern T15 13 531 0 Istanbul

633 622 2943 661 Curious fathe Pretoria

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 269/475

Time Zone UTC Offset Joined Twitter Da Custom Menu Item Custom Menu Item Tweet Tweet Dat3600 Mon May 18 20:0Open Twitter Page http://twitter.com @Alexizzz 2010-07-23600 Sat Feb 07 16:52:Open Twitter Page http://twitter.com Ce test de 2010-07-23600 Mon Oct 12 17:3 Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Sun Mar 11 17:08Open Twitter Page http://twitter.com Microsoft 2010-07-2Thu May 27 18:4 Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Mon Nov 16 01:2Open Twitter Page http://twitter.com Quero dua 2010-07-2-10800 Thu Jun 24 11:21:Open Twitter Page http://twitter.com RT @comp 2010-07-2

me manter antenada Sun Feb 28 15:31:Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Wed Jun 16 02:0 Open Twitter Page http://twitter.com RT @comp 2010-07-2

mais autêntica forma Tue Jul 13 18:51: Open Twitter Page http://twitter.com RT @comp 2010-07-2Fri Apr 09 20:30: Open Twitter Page http://twitter.com RT @comp 2010-07-2

0 Wed May 20 23:5Open Twitter Page http://twitter.com RT @EON 2010-07-2-21600 Tue Nov 03 16:38Open Twitter Page http://twitter.com Vizioncore 2010-07-2-21600 Sat Nov 22 21:06:Open Twitter Page http://twitter.com RT @9to5 2010-07-2-28800 Fri Aug 22 13:06:Open Twitter Page http://twitter.com New Post: 2010-07-2

lha (Camila) pois a mãe Thu Jun 24 14:23:Open Twitter Page http://twitter.com RT @comp 2010-07-2-28800 Fri Apr 04 23:33: Open Twitter Page http://twitter.com Microsoft, 2010-07-2

-18000 Wed Jan 23 22:1 Open Twitter Page http://twitter.com Microsoft, 2010-07-2-21600 Mon Oct 26 08:0 Open Twitter Page http://twitter.com RT @mska2010-07-2

0 Sat Dec 22 10:13:Open Twitter Page http://twitter.com Tools: Mic 2010-07-225200 Fri May 14 10:05:Open Twitter Page http://twitter.com RT @techn 2010-07-2

pan teknologi Microso Sun May 02 01:4 Open Twitter Page http://twitter.com #TechnetB 2010-07-23600 Thu Apr 15 12:44:Open Twitter Page http://twitter.com RT @silico 2010-07-23600 Thu Jan 22 16:22:Open Twitter Page http://twitter.com Womit un 2010-07-23600 Sun Mar 07 11:20Open Twitter Page http://twitter.com RT @dage 2010-07-2

Fri Aug 21 13:41:Open Twitter Page http://twitter.com IDG: En mi 2010-07-2-21600 Sun Jul 25 21:18: Open Twitter Page http://twitter.com Don, See 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 270/475

-21600 Sat Jun 26 21:42: Open Twitter Page http://twitter.com LINK : fatal2010-07-2Wed Jul 14 11:39:Open Twitter Page http://twitter.com #Wiki An e 2010-07-2Wed Jun 30 21:1 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-28800 Thu Oct 15 13:21:Open Twitter Page http://twitter.com 5 Reasons 2010-07-2Wed Jun 09 17:1 Open Twitter Page http://twitter.com RT @Deals 2010-07-2

-18000 Wed Feb 18 13:3 Open Twitter Page http://twitter.com I just enter 2010-07-2

-25200 Sat Sep 26 16:48:Open Twitter Page http://twitter.com Microsoft 2010-07-20 Fri Jun 12 11:53:2Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Wed Jul 08 13:17:Open Twitter Page http://twitter.com RT @DaxA 2010-07-2Gold Certified Partner Thu Mar 11 11:1 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-21600 Thu Jun 18 18:01:Open Twitter Page http://twitter.com Script Cent 2010-07-2

7200 Tue Aug 11 00:05Open Twitter Page http://twitter.com RT @kapsi2010-07-27200 Mon Feb 18 14:1 Open Twitter Page http://twitter.com Slideshow: 2010-07-2

3600 Tue Mar 24 09:14Open Twitter Page http://twitter.com

AllArticlesonVisualizationPrinciples-Chandoo.org -LearnMicrosoftExcelOnlinehttp://bit.ly/crEVM4 #fb #in 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 271/475

Wed Sep 09 08:2 Open Twitter Page http://twitter.com

Twitter:TeleNavForum ::Viewing

profile:sharingweb page#website#usa#microsof thttp://forum.telenav.com/pro...http://bit.ly/aoJJpp 2010-07-2

-21600 Wed Dec 17 14:0 Open Twitter Page http://twitter.com

#Gadgets: Saitekkeepsflightsimulation alive

with newgear, noword onrobot airhostesses:Microsoftmayhave...http://bit.ly/a0YebD 2010-07-2

0 Fri Oct 05 23:11: Open Twitter Page http://twitter.com @Serendi 2010-07-2-36000 Mon Sep 28 12:2 Open Twitter Page http://twitter.com Saitek kee 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 272/475

k you to RT~From MarSun Jan 17 08:54:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-21600 Sat Jan 09 23:33: Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alive

with newgear, noword onrobot airhostesses:Microsoftma...http://bit.ly/bgczKD

#BreakingNews #fb 2010-07-2

Thu Jun 10 08:53:Open Twitter Page http://twitter.com iPad: Micr 2010-07-2Thu Jun 10 09:43:Open Twitter Page http://twitter.com Microsoft, 2010-07-2

-21600 Fri Jun 11 13:16:1Open Twitter Page http://twitter.com Microsoft, 2010-07-2-21600 Tue Jun 01 12:13:Open Twitter Page http://twitter.com Microsoft, 2010-07-2-36000 Sun Oct 11 16:43:Open Twitter Page http://twitter.com New Micr 2010-07-2

0 Sat Dec 13 12:39:Open Twitter Page http://twitter.com RT @9to5 2010-07-219800 Thu Apr 29 10:23:Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 273/475

-18000 Wed Apr 02 03:4 Open Twitter Page http://twitter.com Please @ 2010-07-2-28800 Thu Oct 09 14:04:Open Twitter Page http://twitter.com Time for St 2010-07-2-18000 Mon Oct 05 09:2 Open Twitter Page http://twitter.com IndieSpot 2010-07-2-36000 Thu May 21 12:5 Open Twitter Page http://twitter.com New Post: 2010-07-2

Fri Jul 23 16:59:3Open Twitter Page http://twitter.com Microsoft 2010-07-210800 Tue Jul 06 13:36: Open Twitter Page http://twitter.com Новости и 2010-07-2

Fri Jun 04 14:59:1Open Twitter Page http://twitter.com #ipad #ma 2010-07-2

Fri Jul 23 19:55:2Open Twitter Page http://twitter.com

MicrosoftOfficeSmallBusiness2007FULLVERSIONhttp://bit.ly/b372vE #Software,Amazon#Amazon 2010-07-2

-36000 Sun Sep 14 03:54:Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Thu Oct 02 12:42:Open Twitter Page http://twitter.com Microsoft 2010-07-2-36000 Sun Oct 26 14:48:Open Twitter Page http://twitter.com [News] Mi 2010-07-2-28800 Thu Dec 25 10:10Open Twitter Page http://twitter.com Ternyata 2010-07-225200 Mon Jan 15 17:4 Open Twitter Page http://twitter.com Microsoft i 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 274/475

-18000 Tue Jun 17 14:03:Open Twitter Page http://twitter.com Microsoft 2010-07-2

Fri Feb 05 11:17: Open Twitter Page http://twitter.com

Faces of#OpenSource @

Microsofthttp://www.microsoft.com/opensource/people.aspx 2010-07-2

-18000 Fri Jan 08 20:29:0Open Twitter Page http://twitter.com Interview 2010-07-2-18000 Mon May 10 17:3Open Twitter Page http://twitter.com INPUT DE2010-07-2-18000 Thu May 13 16:1 Open Twitter Page http://twitter.com CAMERAS2010-07-2-10800 Mon Oct 13 14:5 Open Twitter Page http://twitter.com @arjanok: 2010-07-2

3600 Tue Jan 01 12:49:Open Twitter Page http://twitter.com in het lope 2010-07-23600 Thu Jan 07 08:03:Open Twitter Page http://twitter.com RT @WinF 2010-07-2

-18000 Thu Oct 23 01:04:Open Twitter Page http://twitter.com [Apple We 2010-07-2-28800 Sat Apr 25 23:26:Open Twitter Page http://twitter.com In the CIO 2010-07-2

0 Thu Aug 06 08:07Open Twitter Page http://twitter.com office 201 2010-07-2-28800 Thu May 07 22:1 Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Wed Jun 10 14:2 Open Twitter Page http://twitter.com RT @Journ 2010-07-2

ding, hiking, cooking, Fri Jul 02 22:18:1Open Twitter Page http://twitter.com One week 2010-07-2Sat Jul 03 06:49:3Open Twitter Page http://twitter.com HP, Micro 2010-07-2Tue May 25 16:0 Open Twitter Page http://twitter.com I just enter 2010-07-2

-10800 Thu Sep 24 21:08Open Twitter Page http://twitter.com Das neue 2010-07-2-28800 Sat Apr 25 01:47:Open Twitter Page http://twitter.com “@9to5m 2010-07-2source admin solution Tue Jun 22 16:30:Open Twitter Page http://twitter.com #Microsoft 2010-07-2

-21600 Mon Jul 06 17:07:Open Twitter Page http://twitter.com #Cisco #Cl 2010-07-2-25200 Sun Oct 18 14:29:Open Twitter Page http://twitter.com #Cloud #C 2010-07-2-36000 Fri Mar 19 09:31:Open Twitter Page http://twitter.com Microsoft, 2010-07-2

3600 Wed Oct 21 19:2 Open Twitter Page http://twitter.com ¡¡Atentos 2010-07-23600 Sun Dec 16 19:36Open Twitter Page http://twitter.com 4 Cosas Mi 2010-07-23600 Sun Nov 22 05:34Open Twitter Page http://twitter.com @caligula 2010-07-2

19800 Wed Apr 23 09:5 Open Twitter Page http://twitter.com There are 2010-07-2-39600 Sun Mar 22 14:47Open Twitter Page http://twitter.com Giveaway: 2010-07-2

d by PowerWF for TwiThu Mar 25 22:2 Open Twitter Page http://twitter.com #nl2en @ 2010-07-2Thu Jan 28 11:03:Open Twitter Page http://twitter.com #Cisco #Cl 2010-07-2

3600 Sat Aug 15 13:45:Open Twitter Page http://twitter.com RT @Journ 2010-07-2-36000 Thu Feb 25 11:04Open Twitter Page http://twitter.com RT @Journ 2010-07-2-18000 Sat May 30 10:49Open Twitter Page http://twitter.com RT @Gros 2010-07-2-18000 Tue Jul 14 13:31: Open Twitter Page http://twitter.com Just poste 2010-07-2-18000 Tue Jul 14 13:19: Open Twitter Page http://twitter.com Just poste 2010-07-2

Tue May 25 12:4 Open Twitter Page http://twitter.com Senior Con 2010-07-236000 Thu Nov 27 16:49Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 275/475

Sun Jul 18 19:14: Open Twitter Page http://twitter.com Microsoft 2010-07-2-36000 Wed Aug 19 14:2Open Twitter Page http://twitter.com Microsoft' 2010-07-2

7200 Tue Mar 10 20:47Open Twitter Page http://twitter.com Change of 2010-07-2Sat Jul 17 21:30:0Open Twitter Page http://twitter.com Microsoft 2010-07-2

-21600 Fri Jun 25 06:13:4Open Twitter Page http://twitter.com Microsoft 2010-07-2-28800 Sun Apr 25 18:19:Open Twitter Page http://twitter.com Microsoft 2010-07-2

Sun Jul 18 19:23: Open Twitter Page http://twitter.com Microsoft 2010-07-219800 Sun Feb 08 08:34:Open Twitter Page http://twitter.com 5 Reasons 2010-07-2

32400 Sat Nov 21 15:46:Open Twitter Page http://twitter.com 2010-07-232400 Fri Mar 07 23:32:Open Twitter Page http://twitter.com 20 2010-07-2

-21600 Thu Mar 25 14:3 Open Twitter Page http://twitter.com Jim Poshib 2010-07-23600 Wed Mar 11 16:0 Open Twitter Page http://twitter.com RT @heise 2010-07-23600 Mon Apr 02 09:2 Open Twitter Page http://twitter.com Anja Kruse 2010-07-23600 Wed Nov 11 18:1Open Twitter Page http://twitter.com RT @heise 2010-07-2

se follow me if you likeSat Jul 24 06:26:3Open Twitter Page http://twitter.com Microsoft 2010-07-225200 Mon May 03 16:2Open Twitter Page http://twitter.com Microsoft: 2010-07-2

3600 Mon Apr 27 10:4 Open Twitter Page http://twitter.com [#NEWS E 2010-07-2

-10800 Sat Nov 29 05:18:Open Twitter Page http://twitter.com De que adi 2010-07-2-10800 Sun Mar 22 23:50Open Twitter Page http://twitter.com Super Segr 2010-07-23600 Mon Feb 12 08:5 Open Twitter Page http://twitter.com Microsoft 2010-07-2

14400 Sat Nov 01 20:20:Open Twitter Page http://twitter.com Reading 2010-07-2rmation about comput Fri Feb 12 09:45: Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 276/475

0 Mon Apr 20 03:3 Open Twitter Page http://twitter.com Software*: 2010-07-2-10800 Sat May 09 08:54Open Twitter Page http://twitter.com chez @Fre 2010-07-2-21600 Wed Jul 07 14:56:Open Twitter Page http://twitter.com Microsoft I 2010-07-2

ing You Need To Know Mon Jun 21 21:0Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Wed Aug 12 23:4Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Fri Sep 04 08:47: Open Twitter Page http://twitter.com Anja Kruse 2010-07-23600 Wed Oct 28 16:0 Open Twitter Page http://twitter.com Anja Kruse 2010-07-2

Sat Nov 28 10:38:Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Wed Apr 08 12:4 Open Twitter Page http://twitter.com Anja Kruse 2010-07-2

Open Twitter Page http://twitter.com Anja Kruse 2010-07-2-10800 Fri Jun 27 06:43:5Open Twitter Page http://twitter.com Web-New 2010-07-23600 Sun May 24 19:4 Open Twitter Page http://twitter.com Microsoft l 2010-07-2

-10800 Tue Mar 24 07:10Open Twitter Page http://twitter.com Is This HT 2010-07-23600 Sun Jun 20 14:22:Open Twitter Page http://twitter.com Anja Kruse 2010-07-2

o simplify your life ! Sat Jul 03 04:20:5Open Twitter Page http://twitter.com Microsoft 2010-07-2-21600 Fri Feb 26 18:50: Open Twitter Page http://twitter.com New Micr 2010-07-2

the latest technology n Mon Jun 28 14:3 Open Twitter Page http://twitter.com Microsoft 2010-07-20 Tue Jun 01 22:50:Open Twitter Page http://twitter.com V3 News: 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 277/475

-28800 Thu Jul 10 16:33:Open Twitter Page http://twitter.com

EngadgetUpdate:Saitek

keepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftma...http://bit.ly/a0YebD 2010-07-2

-16200 Tue Jul 14 00:39: Open Twitter Page http://twitter.com #FreeMedi 2010-07-2-10800 Sun Jul 12 20:24: Open Twitter Page http://twitter.com #sp New 2010-07-2

14400 Fri Jul 10 13:24:3Open Twitter Page http://twitter.com

Saitekkeeps

flightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/cC3ioP 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 278/475

-28800 Tue Jul 07 18:19: Open Twitter Page http://twitter.com

Faces of#OpenSource @

Microsofthttp://www.microsoft.com/opensource/people.aspxhttp://bit.ly/cGAfRc2010-07-2

3600 Fri Aug 28 17:12:Open Twitter Page http://twitter.com heiseonlin 2010-07-23600 Tue May 12 17:1 Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Mon Jan 25 16:1 Open Twitter Page http://twitter.com Microsoft 2010-07-2

K Tue Apr 06 20:04:Open Twitter Page http://twitter.com Microsoft 2010-07-2Tue Jul 07 17:28: Open Twitter Page http://twitter.com Microsoft 2010-07-2

32400 Thu Mar 19 17:3 Open Twitter Page http://twitter.com RT @powe 2010-07-2

-36000 Thu Sep 03 09:18Open Twitter Page http://twitter.com Support M 2010-07-2новости IT сферы со вWed Jun 23 13:2 Open Twitter Page http://twitter.com В руковод 2010-07-2

7200 Sun Jul 05 12:04: Open Twitter Page http://twitter.com Microsoft 2010-07-2-18000 Mon Jun 28 21:1 Open Twitter Page http://twitter.com Общедост 2010-07-2

7200 Mon Jan 11 23:1 Open Twitter Page http://twitter.com Общедост 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 279/475

-18000 Mon Feb 01 20:0 Open Twitter Page http://twitter.com RT @alisa 2010-07-2-21600 Tue Feb 03 19:24:Open Twitter Page http://twitter.com Microsoft 2010-07-2-21600 Fri Jun 11 13:21:0Open Twitter Page http://twitter.com Microsoft, 2010-07-2-28800 Tue Jun 15 01:36:Open Twitter Page http://twitter.com 4 Reasons 2010-07-2-18000 Fri Jun 11 13:32:1Open Twitter Page http://twitter.com Microsoft, 2010-07-2

3600 Fri Jan 09 11:00:3Open Twitter Page http://twitter.com Office 201 2010-07-2

14400 Mon Dec 21 20:2 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-14400 Mon Apr 19 19:0 Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

3600 Thu Jul 30 08:14:Open Twitter Page http://twitter.com RT @mtim 2010-07-23600 Fri Mar 20 22:12:Open Twitter Page http://twitter.com RT @arjan 2010-07-23600 Thu Jan 29 14:07:Open Twitter Page http://twitter.com eBay To U 2010-07-2

t apple, Iphone, Ipod, IMon Mar 29 10:4Open Twitter Page http://twitter.com Microsoft' 2010-07-2-28800 Thu Jan 28 00:22:Open Twitter Page http://twitter.com Microsoft, 2010-07-2-18000 Fri Jul 06 02:30:0Open Twitter Page http://twitter.com RT @KevD 2010-07-2

0 Fri Mar 12 14:19:Open Twitter Page http://twitter.com How’s my 2010-07-2-21600 Tue Dec 18 15:49Open Twitter Page http://twitter.com How to Re 2010-07-228800 Tue May 05 03:0 Open Twitter Page http://twitter.com Windows 2010-07-2

-32400 Sun Jun 21 10:38:Open Twitter Page http://twitter.com Microsoft 2010-07-228800 Wed May 13 07:3Open Twitter Page http://twitter.com RT @9to5 2010-07-2

-10800 Thu Jun 26 07:30:Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Sun Nov 30 07:12Open Twitter Page h ttp://twitter.com RT @Wiss 2010-07-2

Mon Oct 12 07:0 Open Twitter Page http://twitter.com Download 2010-07-2Fri May 28 07:43:Open Twitter Page http://twitter.com Video2Brai 2010-07-2

-21600 Mon Jul 26 02:05:Open Twitter Page http://twitter.com Don, See 2010-07-219800 Tue Apr 07 05:48:Open Twitter Page http://twitter.com RT @The 2010-07-2

Sun Dec 27 13:23Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 280/475

-36000 Thu Oct 08 05:16:Open Twitter Page http://twitter.com

http://tinyurl.com/38ppgcCómoforzar a

Kerberosa usarTCP enlugar deUDP enWindowsServer2003, enWindowsXP y enWindows2000 2010-07-2

19800 Mon Mar 22 09:5Open Twitter Page http://twitter.com Check this 2010-07-219800 Mon Apr 26 11:0 Open Twitter Page http://twitter.com Special Off 2010-07-2

-32400 Thu Feb 25 02:30Open Twitter Page http://twitter.com Where did 2010-07-210800 Sun Feb 14 04:58:Open Twitter Page http://twitter.com Оригинал 2010-07-2

-14400 Thu Nov 05 09:40Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Wed Jun 10 07:2 Open Twitter Page http://twitter.com Microsoft 2010-07-2

32400 Sun Jun 22 00:09:Open Twitter Page http://twitter.com HP 2010-07-2-21600 Sun Feb 07 03:19:Open Twitter Page http://twitter.com Microsoft 2010-07-2

Wed Mar 10 17:0 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Mon Jan 04 20:2 Open Twitter Page http://twitter.com #itjobs #jo 2010-07-2-28800 Tue Jan 13 17:49:Open Twitter Page http://twitter.com Microsoft, 2010-07-219800 Sat Sep 19 00:41:Open Twitter Page http://twitter.com Giveaway: 2010-07-2

-18000 Thu Jun 04 23:59:Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Wed Aug 26 18:3Open Twitter Page http://twitter.com Microsoft 2010-07-2-21600 Mon Mar 08 16:3Open Twitter Page http://twitter.com Update: C 2010-07-236000 Wed Aug 12 18:4Open Twitter Page http://twitter.com Microsoft 2010-07-2

-36000 Sat Sep 05 13:22:Open Twitter Page http://twitter.com BUS. NEW 2010-07-2-28800 Thu Mar 11 23:3 Open Twitter Page http://twitter.com #Xbox #ga 2010-07-2

0 Thu Mar 04 11:4 Open Twitter Page http://twitter.com Microsoft 2010-07-2Open Twitter Page http://twitter.com Microsoft: 2010-07-2

-18000 Wed Jul 01 22:20:Open Twitter Page http://twitter.com #bugtraq 2010-07-23600 Wed Feb 03 20:5 Open Twitter Page http://twitter.com Heise: Anj 2010-07-2

-36000 Thu Jan 15 13:56:Open Twitter Page http://twitter.com On eBay: 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 281/475

-21600 Mon May 19 15:3Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/aWnE2Y 2010-07-2

3600 Thu Oct 22 22:52:Open Twitter Page http://twitter.com Marketing 2010-07-2-10800 Thu Aug 13 14:52Open Twitter Page http://twitter.com How the R 2010-07-2

0 Tue Jan 05 09:45:Open Twitter Page http://twitter.com *TechNet 2010-07-2

3600 Thu Mar 04 18:0 Open Twitter Page http://twitter.com Anja Kruse 2010-07-2Tue Feb 23 04:02:Open Twitter Page http://twitter.com Software 2010-07-2

-18000 Fri Aug 21 16:24:Open Twitter Page http://twitter.com News Upd 2010-07-2 , updates, information.Wed Jun 23 05:0 Open Twitter Page http://twitter.com How the R 2010-07-2

28800 Mon May 18 01:1Open Twitter Page http://twitter.com How the R 2010-07-2est Decorative Hardw Thu Jul 01 19:38:Open Twitter Page http://twitter.com New Micr 2010-07-2

-18000 Wed Jun 16 01:1 Open Twitter Page http://twitter.com New Micr 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 282/475

0 Tue Jun 10 10:07:Open Twitter Page http://twitter.com 5 Reasons 2010-07-2-36000 Mon Aug 31 15:2Open Twitter Page http://twitter.com 5 Reasons 2010-07-2

7200 Thu Jul 02 13:18:Open Twitter Page http://twitter.com 5 Reasons 2010-07-20 Mon Aug 04 21:0Open Twitter Page http://twitter.com 5 Reasons 2010-07-2

36000 Sat Nov 14 04:48:Open Twitter Page http://twitter.com unveiled it 2010-07-236000 Tue Jun 02 01:17:Open Twitter Page http://twitter.com unveiled it 2010-07-2

Thu Mar 25 11:1 Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Fri Mar 06 14:02:Open Twitter Page http://twitter.com Office 201 2010-07-23600 Fri Apr 24 13:05: Open Twitter Page http://twitter.com Office 201 2010-07-23600 Wed Jul 08 11:19:Open Twitter Page http://twitter.com Dans les c 2010-07-2

7200 Thu Feb 18 18:15Open Twitter Page http://twitter.com RT @social 2010-07-27200 Thu Sep 10 12:33Open Twitter Page http://twitter.com Social Flu 2010-07-2al Estate Needs! Turni Wed Apr 21 22:2 Open Twitter Page http://twitter.com HP, Micro 2010-07-2

3600 Mon Feb 08 11:1 Open Twitter Page http://twitter.com Nuovo arti 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 283/475

19800 Mon Jul 27 15:43:Open Twitter Page http://twitter.com

MicrosoftinvitingMacusers to join

Office2011betatestinggang:Microsoftis doingits bestto temptusersto...http://bit.ly/90NoaV 2010-07-2

Sat Mar 20 10:51:Open Twitter Page http://twitter.com Microsoft, 2010-07-20 Sat May 02 14:55Open Twitter Page http://twitter.com 4 Reasons 2010-07-2

the best deals, and th Sun May 16 00:0 Open Twitter Page http://twitter.com Google Mi 2010-07-225200 Fri Oct 09 08:28: Open Twitter Page http://twitter.com where can 2010-07-2

-16200 Mon Jun 15 22:4 Open Twitter Page http://twitter.com La preside 2010-07-2-16200 Mon Feb 16 00:1 Open Twitter Page http://twitter.com La preside 2010-07-225200 Thu Jan 29 06:25:Open Twitter Page http://twitter.com RT: @mari 2010-07-2

-10800 Mon Jan 11 10:3 Open Twitter Page http://twitter.com There is sti 2010-07-23600 Tue Jan 26 13:00:Open Twitter Page http://twitter.com Aquí está 2010-07-23600 Mon Jan 18 16:5 Open Twitter Page http://twitter.com RT @silico 2010-07-23600 Fri Apr 03 14:50: Open Twitter Page http://twitter.com RT @silico 2010-07-23600 Thu Feb 12 10:04Open Twitter Page http://twitter.com [NetMedia 2010-07-23600 Thu Jan 08 08:54:Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Tue Oct 06 09:54:Open Twitter Page http://twitter.com NetApp en 2010-07-2

ertag josh6199.Look Fri Apr 30 21:41:Open Twitter Page http://twitter.com Microsoft 2010-07-2-18000 Wed Oct 07 22:3 Open Twitter Page http://twitter.com Microsoft 2010-07-2-18000 Tue Apr 06 06:43:Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Sat Feb 21 19:30:Open Twitter Page http://twitter.com gReader a 2010-07-23600 Tue Jun 01 20:39:Open Twitter Page http://twitter.com @BaufiSp 2010-07-2

-10800 Wed Sep 23 12:4 Open Twitter Page http://twitter.com #TechNet 2010-07-2-28800 Tue May 05 18:3 Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 284/475

-21600 Fri Aug 15 18:41:Open Twitter Page http://twitter.com

Engadget:Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay have...http://bit.ly/aWnE2Y 2010-07-2

Fri Jun 05 21:34:0Open Twitter Page http://twitter.com Microsoft 2010-07-2Sat Feb 13 21:21:Open Twitter Page http://twitter.com #Microsoft 2010-07-2

-18000 Sat Aug 22 01:00:Open Twitter Page http://twitter.com 1600 Micr 2010-07-2Fri Mar 26 02:29:Open Twitter Page http://twitter.com RT @New 2010-07-2

3600 Wed Dec 09 20:5 Open Twitter Page http://twitter.com Anja Kruse 2010-07-210800 Fri Aug 28 08:39:Open Twitter Page http://twitter.com Microsoft 2010-07-2

Mon Feb 01 15:4 Open Twitter Page http://twitter.com Microsoft 2010-07-2Open Twitter Page http://twitter.com Русский ш2010-07-2

3600 Fri Jan 23 22:51:0Open Twitter Page http://twitter.com We're all i 2010-07-23600 Fri Sep 25 11:17: Open Twitter Page http://twitter.com RT @Dann 2010-07-2-32400 Fri Apr 24 08:02: Open Twitter Page http://twitter.com http://On 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 285/475

-18000 Wed Mar 25 13:3Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/a0YebD 2010-07-2

-18000 Mon Mar 23 13:5Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/a0YebD 2010-07-2

-18000 Thu May 14 00:0 Open Twitter Page http://twitter.com I just enter 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 286/475

-18000 Mon Aug 25 13:1Open Twitter Page http://twitter.com I just enter 2010-07-2-21600 Sun Sep 20 00:55:Open Twitter Page http://twitter.com I just enter 2010-07-2

3600 Mon Mar 29 11:0Open Twitter Page http://twitter.com Anja Kruse 2010-07-23600 Sun Feb 15 01:29:Open Twitter Page http://twitter.com RT @PCSe 2010-07-2

Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith newgear, noword onrobot air

hostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

sion to share and mak Sun Jun 27 02:56:Open Twitter Page http://twitter.com What Doe 2010-07-2Sat Oct 17 22:23:Open Twitter Page http://twitter.com New Micr 2010-07-2

-21600 Wed Mar 04 14:0Open Twitter Page http://twitter.com RT @adva 2010-07-2-21600 Sun Jul 04 15:15: Open Twitter Page http://twitter.com MediaPost 2010-07-2-10800 Wed May 20 09:2Open Twitter Page http://twitter.com New Micr 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 287/475

-28800 Tue Dec 15 21:35Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-14400 Mon Apr 21 18:4 Open Twitter Page http://twitter.com Invitations 2010-07-23600 Wed Jan 28 14:5 Open Twitter Page http://twitter.com :: techVIP: 2010-07-23600 Wed Jul 18 06:46:Open Twitter Page http://twitter.com RT @WinF 2010-07-2

-21600 Wed Nov 19 22:4Open Twitter Page http://twitter.com

Saitek

keepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-10800 Mon Aug 31 22:1Open Twitter Page http://twitter.com How the R 2010-07-2s and updates on all th Sat Aug 01 13:37:Open Twitter Page http://twitter.com Xbox 360: 2010-07-2

Wed Jan 20 15:1 Open Twitter Page http://twitter.com Fix Windo 2010-07-2-18000 Wed Mar 04 19:5Open Twitter Page http://twitter.com Microsoft' 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 288/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 289/475

-28800 Sun Mar 29 21:00Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/a0YebD 2010-07-2

-18000 Fri Jun 26 16:02:4Open Twitter Page http://twitter.com Microsoft, 2010-07-2-18000 Sun Sep 14 03:30:Open Twitter Page http://twitter.com Ex-Micros 2010-07-2-28800 Thu Sep 24 21:07Open Twitter Page http://twitter.com OPTIMIZE: 2010-07-2

Fri Jun 11 14:36:3Open Twitter Page http://twitter.com Microsoft 2010-07-2Mon Jun 14 06:0 Open Twitter Page http://twitter.com ms crm cu 2010-07-2

19800 Thu May 27 00:3 Open Twitter Page http://twitter.com Etc: In a ra 2010-07-2-32400 Thu Jan 08 04:54:Open Twitter Page http://twitter.com OPTIMIZE: 2010-07-2

19800 Sun Nov 15 13:09Open Twitter Page http://twitter.com Microsoft I 2010-07-2-25200 Mon Jul 27 01:17:Open Twitter Page http://twitter.com Microsoft 2010-07-2-18000 Wed Jul 15 02:19:Open Twitter Page http://twitter.com Microsoft 2010-07-2-32400 Tue Nov 10 10:13Open Twitter Page http://twitter.com New Micr 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 290/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 291/475

-21600 Fri May 01 12:21:Open Twitter Page http://twitter.com New Micr 2010-07-2-25200 Wed Oct 15 15:3 Open Twitter Page http://twitter.com Inside Mic 2010-07-2-18000 Thu Feb 12 01:37Open Twitter Page http://twitter.com RT @alpha 2010-07-2

28800 Fri Aug 14 00:17:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

Fri Jan 01 22:42:5Open Twitter Page http://twitter.com

Saitek

keepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 292/475

-36000 Fri Aug 14 08:32:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

corporate for free! es Tue Feb 23 00:56:Open Twitter Page http://twitter.com "News Up 2010-07-2

0 Thu Feb 19 10:40Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-10800 Sat May 02 13:47Open Twitter Page http://twitter.com RT: @Desk 2010-07-2-28800 Tue Feb 23 05:35:Open Twitter Page http://twitter.com "News Up 2010-07-2-25200 Sun Feb 21 01:11:Open Twitter Page http://twitter.com "News Up 2010-07-2-18000 Sun Jan 24 17:28:Open Twitter Page http://twitter.com Is This HT 2010-07-2

0 Fri Jan 22 14:56:5Open Twitter Page http://twitter.com Microsoft 2010-07-20 Sun May 24 19:2 Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 293/475

-10800 Tue Aug 04 09:26Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Sat Apr 18 09:23:Open Twitter Page http://twitter.com RT @InfoS 2010-07-2-21600 Tue Apr 14 13:19:Open Twitter Page http://twitter.com Denver Jo 2010-07-2

Wed Nov 25 14:0Open Twitter Page http://twitter.com What will 2010-07-219800 Thu Mar 05 04:1 Open Twitter Page http://twitter.com Is This HT 2010-07-2

32400 Sat May 05 14:26Open Twitter Page http://twitter.com Microsoft 2010-07-232400 Sun Apr 19 12:08:Open Twitter Page http://twitter.com Foursqu 2010-07-2

-18000 Fri Jan 08 03:34:1Open Twitter Page http://twitter.com New Articl 2010-07-2-18000 Wed Jun 10 18:1 Open Twitter Page http://twitter.com New Articl 2010-07-2-14400 Thu Jul 01 17:07:Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Sun Aug 30 00:58Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Thu Mar 26 21:5 Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Wed Nov 25 22:1Open Twitter Page http://twitter.com RT @comp 2010-07-2

Thu May 27 14:4 Open Twitter Page http://twitter.com RT @comp 2010-07-2

-10800 Mon Jan 05 07:3 Open Twitter Page http://twitter.com RT @comp 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 294/475

-14400 Sun Aug 09 22:32Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Wed Jun 24 14:4 Open Twitter Page http://twitter.com RT @comp 2010-07-2

-18000 Mon Jul 06 01:40:Open Twitter Page http://twitter.com RT @Good 2010-07-2-25200 Sun Jan 04 15:14:Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Tue Feb 24 14:10:Open Twitter Page http://twitter.com

#iPhoneMicrosoftinviting

Macusers to joinOffice2011betatestinggang:Microsoftis doingits bestt...http://bit.ly/cyqiOq@9to5mac 2010-07-2

-18000 Fri Dec 26 17:50:Open Twitter Page http://twitter.com RT @9to5 2010-07-2-32400 Wed Jun 30 05:3 Open Twitter Page http://twitter.com Where did 2010-07-2-21600 Sun Oct 25 13:17:Open Twitter Page http://twitter.com I just enter 2010-07-2-21600 Tue Dec 30 13:34Open Twitter Page http://twitter.com I just enter 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 295/475

Sat Oct 17 16:30:Open Twitter Page http://twitter.com I just enter 2010-07-2-18000 Tue Apr 28 10:32:Open Twitter Page http://twitter.com I just enter 2010-07-2-10800 Tue Jun 22 16:27:Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Mon Aug 17 16:5Open Twitter Page http://twitter.com RT @comp 2010-07-2-14400 Tue May 25 16:0 Open Twitter Page http://twitter.com RT @comp 2010-07-2

Tue Mar 16 09:32Open Twitter Page http://twitter.com Prêmio Ed 2010-07-2

-14400 Fri Feb 13 19:48: Open Twitter Page http://twitter.com Olá @rodri 2010-07-2-10800 Sun Feb 07 16:40:Open Twitter Page http://twitter.com RT @comp 2010-07-20 Fri Jan 15 00:44:3Open Twitter Page http://twitter.com Microsoft' 2010-07-2

-28800 Wed Apr 21 05:2 Open Twitter Page http://twitter.com Microsoft I 2010-07-2-10800 Sun Dec 06 02:09Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Fri Sep 04 00:47: Open Twitter Page http://twitter.com RT @comp 2010-07-2

7200 Wed Sep 30 10:5 Open Twitter Page http://twitter.com Microsoft, 2010-07-2-28800 Wed Oct 07 16:4 Open Twitter Page http://twitter.com New Micr 2010-07-2

Wed Jan 06 16:5 Open Twitter Page http://twitter.com Embrace 2010-07-2-10800 Thu Nov 12 02:15Open Twitter Page http://twitter.com RT @comp 2010-07-2

I follow back. Wed May 12 19:3Open Twitter Page http://twitter.com Anja Kruse 2010-07-2

Sat Feb 13 16:56:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith newgear, no

word onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

for shiny new gadgets, Mon Jun 07 18:5 Open Twitter Page http://twitter.com Apple nee 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 296/475

-18000 Mon Dec 21 15:5 Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/cFkf6C 2010-07-2

0 Thu Sep 10 13:00Open Twitter Page http://twitter.com CheckOut 2010-07-2rom everywhere! Wed May 26 17:5Open Twitter Page http://twitter.com Microsoft 2010-07-2

-28800 Mon Jun 29 01:4 Open Twitter Page http://twitter.com Saitek kee 2010-07-23600 Sun Nov 22 13:27Open Twitter Page http://twitter.com From Philh 2010-07-2

-10800 Thu Apr 03 02:18:Open Twitter Page http://twitter.com

@ Saitekkeepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed its...http://bit.ly/a0YebD 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 297/475

-10800 Fri Jul 23 15:51:4Open Twitter Page http://twitter.com

Microsoft: IE8BattedAway 1Billion

MalwareDownloads:

Byline:

Paul...http://bit.ly/dgIe6i 2010-07-2

owered by the news a Mon May 10 17:1Open Twitter Page http://twitter.com http://bit.l 2010-07-2Mon May 17 09:0Open Twitter Page http://twitter.com Microsoft' 2010-07-2

-10800 Thu Aug 27 11:35Open Twitter Page http://twitter.com RT @comp 2010-07-2Thu Jun 03 17:30:Open Twitter Page http://twitter.com RT @comp 2010-07-2

-10800 Wed Aug 05 17:5Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Fri Apr 27 23:20: Open Twitter Page http://twitter.com Does Micr 2010-07-2

get the news fastest. Wed Sep 03 10:2 Open Twitter Page http://twitter.com Microsoft I 2010-07-2-28800 Fri May 30 06:31:Open Twitter Page http://twitter.com RT @John 2010-07-2

Fri Sep 11 21:03: Open Twitter Page http://twitter.com RT @comp 2010-07-20 Mon Feb 01 10:0 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Sat Jul 04 00:49:3Open Twitter Page http://twitter.com Windows 2010-07-23600 Sun May 20 07:4 Open Twitter Page http://twitter.com @henrikse 2010-07-23600 Thu Dec 11 18:06Open Twitter Page http://twitter.com RT @Tore 2010-07-23600 Wed Dec 26 15:5 Open Twitter Page http://twitter.com RT @Tore 2010-07-23600 Wed Sep 24 21:0 Open Twitter Page http://twitter.com I am very 2010-07-27200 Thu Mar 20 18:5 Open Twitter Page http://twitter.com Microsoft' 2010-07-2

-28800 Tue Feb 02 17:23:Open Twitter Page http://twitter.com HP, Micro 2010-07-2Wed Jan 27 18:1 Open Twitter Page http://twitter.com iPad news: 2010-07-2

39600 Wed Dec 16 04:1 Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Thu Jun 17 09:16:Open Twitter Page http://twitter.com Phone 7 v 2010-07-2

Wed May 05 19:5Open Twitter Page http://twitter.com CRM New 2010-07-2ать людей ближе. Fri Jun 11 11:15:3Open Twitter Page http://twitter.com RT @heifle 2010-07-2

-28800 Tue Jan 08 22:13:Open Twitter Page http://twitter.com Microsoft 2010-07-219800 Thu Jan 15 12:53:Open Twitter Page http://twitter.com Microsoft 2010-07-2

0 Sat Mar 08 18:53:Open Twitter Page http://twitter.com "Be What' 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 298/475

-36000 Wed Oct 14 00:4 Open Twitter Page http://twitter.com

http://tinyurl.com/29szbexComo

criar umperfil deusuáriomóvel noWindowsServer2003 2010-07-2

Fri Apr 16 09:58: Open Twitter Page http://twitter.com http://mic 2010-07-219800 Thu Aug 20 05:17Open Twitter Page http://twitter.com #Webmast 2010-07-2

Sat Jul 03 17:36:3Open Twitter Page http://twitter.com PDC10: No2010-07-2Sun Jul 04 17:20: Open Twitter Page http://twitter.com PDC10: No2010-07-2

3600 Tue Oct 13 17:41:Open Twitter Page http://twitter.com #heise #ne 2010-07-2

reat Sources Around Tue Jul 13 17:00:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith newgear, noword on

robot airhostesses:Microsoft...http://bit.ly/dzdLiM#tech#internet#web 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 299/475

Sun Dec 20 05:17Open Twitter Page http://twitter.com

Saitekkeeps

flightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveax...http://bit.ly/dzdLiMEngadget 2010-07-2

-14400 Thu Sep 18 16:57Open Twitter Page http://twitter.com Allure Bay 2010-07-2-10800 Thu Dec 04 21:01Open Twitter Page http://twitter.com Allure Bay 2010-07-2-10800 Mon Oct 05 20:0 Open Twitter Page http://twitter.com Allure Bay 2010-07-2

0 Wed Apr 30 23:4 Open Twitter Page http://twitter.com RT @wpu 2010-07-2-10800 Thu Mar 18 16:3 Open Twitter Page http://twitter.com RT @comp 2010-07-2

d by PowerWF for TwiThu Jul 01 15:04:Open Twitter Page http://twitter.com RT @Opti 2010-07-2

3600 Thu May 14 08:5 Open Twitter Page http://twitter.com How to Re 2010-07-2Thu Jun 10 17:44:Open Twitter Page http://twitter.com Microsoft 2010-07-2Mon Jun 28 08:5 Open Twitter Page http://twitter.com Microsoft 2010-07-2

налов Mon Jul 05 10:35:Open Twitter Page http://twitter.com Протокол 2010-07-2-18000 Fri Jan 08 02:33:2Open Twitter Page http://twitter.com 24 Hours o 2010-07-2-21600 Sun Jul 18 04:39: Open Twitter Page http://twitter.com Microsoft 2010-07-2

0 Wed Jul 29 15:06:Open Twitter Page http://twitter.com Microsoft 2010-07-2-21600 Wed Apr 22 09:4 Open Twitter Page http://twitter.com APPCRAFT2010-07-2-28800 Wed Aug 12 17:0Open Twitter Page http://twitter.com vtango: Th 2010-07-2-10800 Wed Jan 16 12:3 Open Twitter Page http://twitter.com RT @ricar 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 300/475

-32400 Wed Jun 03 14:3 Open Twitter Page http://twitter.com

Microsoft: IE8BattedAway 1BillionMalware

Downloads:

Byline:

Paul...http://bit.ly/9sVw0B 2010-07-2

-18000 Wed Feb 11 07:4 Open Twitter Page http://twitter.com I just enter 2010-07-2

3600 Mon May 25 12:5Open Twitter Page http://twitter.com

#interesting Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay ha...http://bit.ly/a0YebD 2010-07-2

Sat Jul 24 07:35:5Open Twitter Page http://twitter.com Software 2010-07-2Fri Jul 23 04:07:1Open Twitter Page http://twitter.com HOT!: How 2010-07-2

7200 Sun Sep 20 00:04:Open Twitter Page http://twitter.com TechNews:2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 301/475

3600 Tue Jan 23 06:24:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/a0YebD 2010-07-2

3600 Tue Oct 20 08:09:Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Fri Nov 27 01:13:Open Twitter Page http://twitter.com Quero dua 2010-07-219800 Thu Jan 01 16:35:Open Twitter Page http://twitter.com Giveaway: 2010-07-2

Fri May 14 22:25:Open Twitter Page http://twitter.com New post: 2010-07-2-28800 Thu Jul 15 08:09:Open Twitter Page http://twitter.com HP's Rahul 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 302/475

-28800 Mon May 24 15:5Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

Mon Mar 16 15:2Open Twitter Page http://twitter.com

Microsoftto banish'responsib

le' fromdisclosuredebate: ---Quote---

Microsofthassubmittedaproposalaimed ...http://bit.ly/cH8uDa 2010-07-2

3600 Mon Jun 15 13:2 Open Twitter Page http://twitter.com Microsoft I2010-07-2-25200 Fri Jan 29 05:21:1Open Twitter Page http://twitter.com Microsoft 2010-07-2-28800 Sun Jun 07 19:33:Open Twitter Page http://twitter.com Microsoft 2010-07-232400 Thu Jun 03 05:39:Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Mon Jun 22 13:4 Open Twitter Page http://twitter.com HP's Rahul 2010-07-2-28800 Fri Jul 03 07:31:4Open Twitter Page http://twitter.com Breaking g 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 303/475

-28800 Fri Apr 17 02:50: Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Fri Apr 24 12:53: Open Twitter Page http://twitter.com -Winfutur 2010-07-2

-32400 Tue Nov 11 17:41Open Twitter Page http://twitter.com Microsoft i 2010-07-210800 Sat Jan 09 20:20: Open Twitter Page http://twitter.com RT @BuHa 2010-07-210800 Fri Jun 04 11:11:1Open Twitter Page http://twitter.com Microsoft 2010-07-210800 Sun May 24 15:2 Open Twitter Page http://twitter.com RT @BuHa 2010-07-2

10800 Mon May 25 09:2Open Twitter Page http://twitter.com RT @BuHa 2010-07-210800 Wed Jun 02 18:3 Open Twitter Page http://twitter.com RT @BuHa 2010-07-2in Kuwait in One Place. Sat Jun 12 17:51:Open Twitter Page http://twitter.com RT @BuHa 2010-07-2

-28800 Tue Apr 21 06:02:Open Twitter Page http://twitter.com Search Res 2010-07-2-18000 Mon Jul 27 23:42:Open Twitter Page http://twitter.com Hot* Error 2010-07-2

-10800 Mon May 11 02:4Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay have

axed itsF...http://bit.ly/a0YebD 2010-07-2

-28800 Tue May 26 09:4 Open Twitter Page http://twitter.com PowerShel 2010-07-2-21600 Mon Mar 24 17:4Open Twitter Page http://twitter.com Even With 2010-07-210800 Thu Jul 08 02:45:Open Twitter Page http://twitter.com RT @BuHa 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 304/475

-18000 Sat May 22 19:42Open Twitter Page http://twitter.com Vodafone 2010-07-2-10800 Tue Aug 04 17:10Open Twitter Page http://twitter.com RT @comp 2010-07-2-14400 Wed Apr 28 18:3 Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Fri Apr 09 22:30: Open Twitter Page http://twitter.com RT @comp 2010-07-2

Wed Jan 27 18:1 Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Sun Feb 07 18:56:Open Twitter Page http://twitter.com #Microsoft 2010-07-236000 Fri Apr 23 01:07: Open Twitter Page http://twitter.com NBE: Micr 2010-07-2

aways! Have 2 beautif Wed Dec 02 19:1 Open Twitter Page http://twitter.com I just enter 2010-07-2-18000 Mon Aug 31 19:0Open Twitter Page http://twitter.com I just enter 2010-07-2

Mon Jun 29 11:5 Open Twitter Page http://twitter.com RT @comp 2010-07-2Tue Apr 06 06:28:Open Twitter Page http://twitter.com Microsoft 2010-07-2

-10800 Thu Apr 29 13:08:Open Twitter Page http://twitter.com RT @comp 2010-07-2Tue Mar 23 13:27Open Twitter Page http://twitter.com Quero dua 2010-07-2

32400 Tue May 12 11:3 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Tue Nov 24 11:43Open Twitter Page http://twitter.com Private Pil 2010-07-2Open Twitter Page http://twitter.com Microsoft 2010-07-2-25200 Tue Aug 04 19:31Open Twitter Page http://twitter.com HP's gami 2010-07-219800 Sat May 02 14:08Open Twitter Page http://twitter.com Microsoft: 2010-07-2

bs Tweeted every cou Tue Feb 03 17:09:Open Twitter Page http://twitter.com Microsoft 2010-07-2-36000 Sun Aug 23 20:49Open Twitter Page http://twitter.com Microsoft i 2010-07-2

, experienced, domest Fri Mar 19 07:05:Open Twitter Page http://twitter.com R1 Micros 2010-07-2-36000 Thu Jul 30 02:18:Open Twitter Page http://twitter.com R1 Micros 2010-07-2

Wed Sep 30 19:5 Open Twitter Page http://twitter.com Microsoft i 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 305/475

-21600 Mon Jan 19 13:4 Open Twitter Page http://twitter.com

@sherryonline4uSaitekkeeps

flightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay...http://bit.ly/a0YebD 2010-07-2

-36000 Tue Feb 16 10:39:Open Twitter Page http://twitter.com Vizioncore 2010-07-2-21600 Thu Jul 17 01:21:Open Twitter Page http://twitter.com Windows 2010-07-228800 Wed Feb 18 12:2 Open Twitter Page http://twitter.com Zomg, I ne 2010-07-2

-28800 Fri Aug 07 13:54:Open Twitter Page http://twitter.com

News: Kinecthardware

salesboost is"bollocks":Microsoft"missedtheboat",sayshttp://url4.eu/6P9R1 2010-07-2

-10800 Mon Oct 06 10:4 Open Twitter Page http://twitter.com Giveaway: 2010-07-20 Mon Oct 12 11:3 Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 306/475

0 Sat Jul 11 06:29:0Open Twitter Page http://twitter.com Latest Mic 2010-07-2-10800 Tue Apr 08 06:02:Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Mon Dec 28 20:1 Open Twitter Page http://twitter.com Latest Mic 2010-07-2

32400 Sun Aug 10 05:26Open Twitter Page http://twitter.com

"Windowscallbacksare neverasynchronousexceptwhere the

documentationexplicitlysays so."http://bit.ly/clENu2

2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 307/475

32400 Tue Mar 18 13:16Open Twitter Page http://twitter.com 2010-07-2-28800 Wed Oct 29 23:2 Open Twitter Page http://twitter.com sitfu.com 2010-07-236000 Thu Jul 08 07:46:Open Twitter Page http://twitter.com 101 Secret 2010-07-2

-21600 Sat Nov 07 20:47:Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Fri Mar 16 20:32:Open Twitter Page http://twitter.com Sur Access 2010-07-27200 Sat Mar 13 17:05:Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Wed Aug 26 22:2Open Twitter Page http://twitter.com RT @eduin 2010-07-2

3600 Sat Apr 28 20:09:Open Twitter Page http://twitter.com RT @mase 2010-07-23600 Thu Mar 05 10:2 Open Twitter Page http://twitter.com WebMatri 2010-07-2

-10800 Mon Apr 20 06:3 Open Twitter Page http://twitter.com RT @comp 2010-07-2ent items up for grabs Fri Jul 02 05:15:2 Open Twitter Page http://twitter.com #VideoGa 2010-07-2

3600 Thu May 07 13:2 Open Twitter Page http://twitter.com RT @Dushi 2010-07-2-21600 Wed Oct 14 15:0 Open Twitter Page http://twitter.com Microsoft' 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 308/475

-18000 Thu May 13 04:0 Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-18000 Thu Aug 14 05:36Open Twitter Page http://twitter.com Microsoft i 2010-07-2-18000 Tue Dec 08 23:24Open Twitter Page http://twitter.com The Micro 2010-07-2-10800 Thu Jun 10 14:07:Open Twitter Page http://twitter.com RT @comp 2010-07-2-28800 Wed Jun 10 21:5 Open Twitter Page http://twitter.com Hot* Error 2010-07-2-36000 Sat Sep 26 10:51:Open Twitter Page http://twitter.com How the R 2010-07-2

0 Tue Mar 17 04:56Open Twitter Page http://twitter.com Microsoft I 2010-07-2Mon Jun 21 17:0 Open Twitter Page http://twitter.com reference 2010-07-2

Thu May 06 14:5 Open Twitter Page http://twitter.com Avaya CEO 2010-07-2-18000 Mon Apr 26 22:4 Open Twitter Page http://twitter.com Should yo 2010-07-2

entertainment to life Wed Jun 16 00:0 Open Twitter Page http://twitter.com Microsoft 2010-07-2-36000 Mon Dec 14 01:4 Open Twitter Page http://twitter.com How the R 2010-07-2-10800 Sun Jan 31 11:11:Open Twitter Page http://twitter.com R10 Micro 2010-07-2

3600 Sun Feb 07 20:11:Open Twitter Page http://twitter.com База Micr 2010-07-2 but I do have an extra Sun Apr 05 08:07:Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 309/475

0 Fri Apr 09 03:05: Open Twitter Page http://twitter.com Microsoft 2010-07-20 Sat Jul 14 23:44:3Open Twitter Page http://twitter.com Microsoft 2010-07-2

-28800 Fri May 22 15:09:Open Twitter Page http://twitter.com If you're M 2010-07-20 Fri Aug 28 19:03:Open Twitter Page http://twitter.com If Apple w 2010-07-2

-10800 Tue Jul 06 03:30: Open Twitter Page http://twitter.com RT @comp 2010-07-2d every couple hours. Mon Feb 23 14:4 Open Twitter Page http://twitter.com Senior Con 2010-07-2

-18000 Sat Apr 17 00:14:Open Twitter Page http://twitter.com

Slideshow:Microsoft'sWindowsPhone 7Revealed http://ow.ly/2glF0 2010-07-2

-18000 Tue May 19 20:4 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-14400 Fri Jul 03 18:48:0Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Wed Aug 12 16:4Open Twitter Page http://twitter.com RT @comp 2010-07-23600 Mon Oct 13 11:3 Open Twitter Page http://twitter.com Reconocim 2010-07-23600 Wed May 27 15:0Open Twitter Page http://twitter.com RT @Yorie 2010-07-23600 Mon Jan 25 10:2 Open Twitter Page http://twitter.com Microsoft 2010-07-2

25200 Thu Feb 19 04:50Open Twitter Page http://twitter.com new versio 2010-07-225200 Sat Feb 02 15:29:Open Twitter Page http://twitter.com zoho 2010-07-2

3600 Sun Feb 03 09:52:Open Twitter Page http://twitter.com Tablet war 2010-07-2-16200 Wed May 06 16:3Open Twitter Page http://twitter.com RT @cRep 2010-07-2

3600 Thu Oct 30 16:36:Open Twitter Page http://twitter.com RT @Cinco 2010-07-23600 Thu May 03 15:5 Open Twitter Page http://twitter.com RT: @Sven 2010-07-2

-18000 Sat Aug 22 01:09:Open Twitter Page http://twitter.com Microsoft 2010-07-2 Apple news in one loc Wed Mar 10 13:1Open Twitter Page http://twitter.com Microsoft i 2010-07-2

Wed Apr 28 07:2 Open Twitter Page http://twitter.com Microsoft 2010-07-2-25200 Mon Dec 22 18:3 Open Twitter Page http://twitter.com MSPment 2010-07-2-21600 Wed Sep 10 11:5 Open Twitter Page http://twitter.com Vizioncore 2010-07-2-28800 Sun Aug 31 17:00Open Twitter Page http://twitter.com VMblog.co 2010-07-2-28800 Fri Feb 13 23:44: Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Mon Aug 31 13:4Open Twitter Page http://twitter.com RT @Yorie 2010-07-23600 Fri Oct 09 16:26: Open Twitter Page http://twitter.com Los mando 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 310/475

19800 Wed Jan 09 04:0 Open Twitter Page http://twitter.com RT @RoyO 2010-07-2-36000 Wed Mar 25 21:5Open Twitter Page http://twitter.com Techrights 2010-07-2-28800 Wed Aug 27 03:1Open Twitter Page http://twitter.com Microsoft, 2010-07-2-10800 Mon Sep 10 15:0 Open Twitter Page http://twitter.com jQuery, A 2010-07-2-10800 Thu Apr 19 22:19:Open Twitter Page http://twitter.com jQuery, A 2010-07-2

-36000 Thu Feb 25 16:45Open Twitter Page http://twitter.com via @Marc 2010-07-2-18000 Tue Dec 22 22:40Open Twitter Page http://twitter.com Barron's S 2010-07-2

Wed Aug 26 15:3Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Wed Jan 27 17:4 Open Twitter Page http://twitter.com Tema Disn 2010-07-2-10800 Tue Jan 26 21:05:Open Twitter Page http://twitter.com RT: @Desk 2010-07-2

Sun Feb 07 13:14:Open Twitter Page http://twitter.com RT: @Desk 2010-07-23600 Fri Mar 27 15:28:Open Twitter Page http://twitter.com RT @domi 2010-07-2

-10800 Fri Dec 19 09:54:Open Twitter Page http://twitter.com Ein klassis 2010-07-2d. I find flights using thThu Mar 25 20:2 Open Twitter Page http://twitter.com ENDORSE 2010-07-2-21600 Wed Apr 21 07:4 Open Twitter Page http://twitter.com Microsoft 2010-07-2-21600 Sun Aug 16 15:17Open Twitter Page http://twitter.com I just enter 2010-07-2

uipment, Lab Fitting, LSun Dec 20 13:57Open Twitter Page http://twitter.com Microsoft I 2010-07-23600 Thu Nov 12 08:57Open Twitter Page http://twitter.com RT @VMBl2010-07-2

Sat Jul 03 06:53:1Open Twitter Page http://twitter.com HP, Micro 2010-07-2-10800 Mon Sep 07 18:0 Open Twitter Page http://twitter.com RT @Yorie 2010-07-2-21600 Thu Nov 12 22:43Open Twitter Page http://twitter.com New post: 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 311/475

-28800 Sun Apr 04 14:12:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed...http://tinyurl.com/35wegdv 2010-07-2

Sun Jun 06 11:09:Open Twitter Page http://twitter.com HP's Rahul 2010-07-2Thu Feb 04 17:22Open Twitter Page http://twitter.com xbox 360 fi 2010-07-2

-18000 Wed Mar 24 13:3Open Twitter Page http://twitter.com

Saitekkeeps

flightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

3600 Tue Jun 30 07:22:Open Twitter Page http://twitter.com Congratul 2010-07-2-28800 Wed Sep 30 17:0 Open Twitter Page http://twitter.com Welcome 2010-07-2-28800 Thu May 01 16:3 Open Twitter Page http://twitter.com Welcome 2010-07-2-28800 Sat May 08 15:57Open Twitter Page http://twitter.com I just enter 2010-07-2

es and bring you the l Mon Jun 07 17:1 Open Twitter Page http://twitter.com Check out 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 312/475

0 Fri Mar 06 13:38:Open Twitter Page http://twitter.com Microsoft 2010-07-2Fri Sep 25 23:34: Open Twitter Page http://twitter.com RT @comp 2010-07-2

32400 Sun Oct 14 02:09:Open Twitter Page http://twitter.com ✔ Micros 2010-07-232400 Tue Jul 21 17:11: Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Wed Dec 03 20:3 Open Twitter Page http://twitter.com starting m 2010-07-2-10800 Wed Jan 06 22:4 Open Twitter Page http://twitter.com RT @comp 2010-07-2

-28800 Wed Jun 10 02:2 Open Twitter Page http://twitter.com 101 Secret 2010-07-2Fri Apr 23 12:58: Open Twitter Page http://twitter.com RT @comp 2010-07-2Tue Jul 20 08:53: Open Twitter Page http://twitter.com Microsoft 2010-07-2Mon Jun 07 02:5 Open Twitter Page http://twitter.com Microsoft 2010-07-2

t wait till the Kinect coMon Jun 21 20:2 Open Twitter Page http://twitter.com Update: F 2010-07-2-28800 Sat Sep 05 03:59:Open Twitter Page http://twitter.com ~ I just ent 2010-07-2-14400 Wed May 20 22:5Open Twitter Page http://twitter.com RT @Yorie 2010-07-2-32400 Wed Aug 19 08:4Open Twitter Page http://twitter.com pcworld Is 2010-07-2

ção Física. Casado comTue May 05 16:3 Open Twitter Page http://twitter.com RT @comp 2010-07-2-14400 Tue Mar 11 12:53Open Twitter Page http://twitter.com RT @apple 2010-07-2-14400 Tue Aug 26 02:06Open Twitter Page http://twitter.com Microsoft 2010-07-232400 Sun May 06 04:5 Open Twitter Page http://twitter.com @310449 2010-07-228800 Wed Mar 03 16:4 Open Twitter Page http://twitter.com Microsoft 2010-07-228800 Wed May 12 05:2Open Twitter Page http://twitter.com Microsoft 2010-07-2

-28800 Fri Apr 03 06:21: Open Twitter Page http://twitter.com Microsoft 2010-07-2Sat Oct 17 11:44:Open Twitter Page http://twitter.com Microsoft 2010-07-2

-28800 Fri Jan 01 18:50:1Open Twitter Page http://twitter.com Microsoft 2010-07-2-28800 Thu Jul 09 22:55:Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Tue Mar 25 13:21Open Twitter Page http://twitter.com #Clubic Of 2010-07-2

-25200 Wed Dec 12 21:0 Open Twitter Page http://twitter.com #tvnpana 2010-07-2-18000 Thu Aug 27 20:47Open Twitter Page http://twitter.com TVN NOTI 2010-07-2-21600 Sun Mar 30 03:13Open Twitter Page http://twitter.com WebMatri 2010-07-228800 Thu Jun 04 06:48:Open Twitter Page http://twitter.com @Merloyy 2010-07-225200 Wed Sep 02 14:4 Open Twitter Page http://twitter.com Yah"..mks 2010-07-219800 Fri Jan 29 16:36:1Open Twitter Page http://twitter.com #Webmast 2010-07-219800 Wed Sep 09 07:2 Open Twitter Page http://twitter.com #Webmast 2010-07-219800 Wed Feb 24 10:3 Open Twitter Page http://twitter.com #Webmast 2010-07-219800 Mon Sep 21 05:1 Open Twitter Page http://twitter.com #Webmast 2010-07-2

-14400 Sun Jul 04 11:46: Open Twitter Page http://twitter.com Is #Micros 2010-07-2-21600 Sat Apr 17 00:52:Open Twitter Page http://twitter.com #Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 313/475

32400 Thu Apr 12 10:57:Open Twitter Page http://twitter.com 2010-07-232400 Sat Aug 01 12:21:Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Thu Jan 14 04:38:Open Twitter Page http://twitter.com Google Inc 2010-07-20 Wed Sep 30 22:5 Open Twitter Page http://twitter.com #Freeware 2010-07-2

-28800 Fri Dec 26 05:03:Open Twitter Page http://twitter.com Difference 2010-07-2-21600 Mon Apr 05 13:2 Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Wed Jul 01 07:22:Open Twitter Page http://twitter.com http://tiny 2010-07-2-10800 Sun Jul 05 00:46: Open Twitter Page http://twitter.com RT @comp 2010-07-2-10800 Wed Feb 24 20:3 Open Twitter Page http://twitter.com RT @Yorie 2010-07-2-14400 Tue Mar 09 22:03Open Twitter Page http://twitter.com Microsoft 2010-07-2

Sat May 22 09:13Open Twitter Page http://twitter.com Оригинал 2010-07-23600 Sun Feb 01 10:56:Open Twitter Page http://twitter.com RT @Dann 2010-07-2

0 Thu Feb 28 17:03Open Twitter Page http://twitter.com RT @lukos 2010-07-2

0 Mon Jan 19 15:3 Open Twitter Page http://twitter.com

I mightstartwearingone ofthesehttp://bit.ly/dcUcNctocombatthishttp://youve-been-cromwell

ed.org/?p=1079 2010-07-2

-21600 Sun Jan 03 15:00:Open Twitter Page http://twitter.com Barron's S 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 314/475

-21600 Wed Nov 18 20:4Open Twitter Page http://twitter.com RT @Quan 2010-07-2-21600 Mon Jan 14 01:2 Open Twitter Page http://twitter.com RT @Quan 2010-07-2-10800 Thu Apr 15 13:33:Open Twitter Page http://twitter.com Quero dua 2010-07-2-21600 Thu Sep 25 15:23Open Twitter Page http://twitter.com Microsoft 2010-07-2

10800 Sun Apr 12 07:03:Open Twitter Page http://twitter.com

Microsoft

Office2007EnterpriseSP2Russianвсеобновления на25.07.2010 http://passtor.ru/news_302535.html 2010-07-2

10800 Sat Sep 26 17:54:Open Twitter Page http://twitter.com

Microsoftполучиладоступ к

архитектуре ARMhttp://www.astera.ru/news/?id=79059 2010-07-2

Fri Jul 16 10:30:1Open Twitter Page http://twitter.com Microsoft 2010-07-2Tue Jul 20 10:58: Open Twitter Page http://twitter.com Microsoft 2010-07-2

-21600 Sat Jan 16 15:41: Open Twitter Page http://twitter.com Microsoft 2010-07-27200 Thu Feb 01 18:17Open Twitter Page http://twitter.com @Neo_45 2010-07-23600 Mon Mar 16 12:4Open Twitter Page http://twitter.com ABN AMR 2010-07-27200 Mon Oct 26 12:2 Open Twitter Page http://twitter.com RT @ESET 2010-07-23600 Thu Mar 26 13:5 Open Twitter Page http://twitter.com Microsoft 2010-07-2

Mon Jul 26 13:00:Open Twitter Page http://twitter.com @mike_pf 2010-07-23600 Wed Nov 18 17:2Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Sun Nov 08 19:18Open Twitter Page http://twitter.com Руководст 2010-07-232400 Wed Jun 10 06:0 Open Twitter Page http://twitter.com 2010-07-2

-21600 Thu Apr 09 21:21:Open Twitter Page http://twitter.com RT @deals 2010-07-2ology professionals res Wed Jun 16 17:1 Open Twitter Page http://twitter.com #jobs Soft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 315/475

32400 Wed Apr 07 05:5 Open Twitter Page http://twitter.com Mi 2010-07-2Tue Jul 20 11:03: Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Sun Apr 19 08:15:Open Twitter Page http://twitter.com Microsoft 2010-07-2Tue Jul 20 10:50: Open Twitter Page http://twitter.com Microsoft 2010-07-2Wed Jan 13 09:4 Open Twitter Page http://twitter.com Xbox 360, 2010-07-2

-21600 Sun Sep 21 16:45:Open Twitter Page http://twitter.com @drewcha 2010-07-2-28800 Thu Nov 13 21:42Open Twitter Page http://twitter.com Will Micro 2010-07-2

-28800 Mon Apr 20 07:1 Open Twitter Page http://twitter.com

Saitek

keepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

0 Sat Feb 13 23:10:Open Twitter Page http://twitter.com #Microsoft 2010-07-2-10800 Tue Aug 11 23:33Open Twitter Page http://twitter.com RT @mcgr 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 316/475

-18000 Thu Mar 18 13:3 Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

3600 Tue Oct 23 16:04:Open Twitter Page http://twitter.com Microsoft l 2010-07-2-18000 Thu Aug 20 01:23Open Twitter Page http://twitter.com I just enter 2010-07-2-28800 Thu Aug 13 02:29Open Twitter Page http://twitter.com Is This HT 2010-07-2-18000 Fri Mar 28 21:39:Open Twitter Page http://twitter.com CHART OF 2010-07-2-18000 Fri Feb 26 19:49: Open Twitter Page http://twitter.com 40 mil edu 2010-07-2

3600 Sun Feb 21 11:26:Open Twitter Page http://twitter.com Office 201 2010-07-2

Fri Jul 23 08:53:3Open Twitter Page http://twitter.com

sharingweb page#website#usa#microsof thttp://forum.telenav.com/profile.php?mode=viewprofile&u=34957 2010-07-2

-25200 Fri Sep 18 16:19: Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 317/475

Fri Jul 23 09:26:1Open Twitter Page http://twitter.com

http://blog.dancingdeer.com/index.ph

p/member/1798/ #10#cheapdentist#Microsof t great file 2010-07-2

-18000 Wed Mar 04 01:5Open Twitter Page http://twitter.com MS annou 2010-07-2-28800 Wed Dec 30 20:1 Open Twitter Page http://twitter.com Free Wind 2010-07-2-18000 Sun Jul 26 00:03: Open Twitter Page http://twitter.com RT @Scott 2010-07-2

ide,Live stock quotes Mon Jun 07 10:1 Open Twitter Page http://twitter.com Despite its 2010-07-225200 Mon Mar 23 17:5Open Twitter Page http://twitter.com @window 2010-07-2

Tue Jul 20 10:45: Open Twitter Page http://twitter.com Microsoft 2010-07-2Tue Jul 20 10:42: Open Twitter Page http://twitter.com Microsoft 2010-07-2

0 Sat Sep 13 13:28:Open Twitter Page http://twitter.com I know wh 2010-07-2-18000 Mon Jan 25 15:3 Open Twitter Page http://twitter.com Media: Th 2010-07-2

test business and finan Thu Feb 25 09:48Open Twitter Page http://twitter.com √ Is it time 2010-07-219800 Tue Jun 02 18:11:Open Twitter Page http://twitter.com Leaked ph 2010-07-225200 Fri Oct 23 12:13: Open Twitter Page http://twitter.com Microsoft I 2010-07-225200 Thu Jan 14 07:18:Open Twitter Page http://twitter.com Microsoft I 2010-07-2

0 Tue Mar 31 12:55Open Twitter Page http://twitter.com Interestin 2010-07-228800 Wed Jul 15 12:03:Open Twitter Page http://twitter.com Is This HT 2010-07-23600 Sun Jul 04 19:31: Open Twitter Page http://twitter.com Microsoft 2010-07-2

a willing heart. Fri Jun 18 10:17:4Open Twitter Page http://twitter.com With Wind 2010-07-225200 Wed Sep 30 02:3 Open Twitter Page http://twitter.com Sayaa lulu 2010-07-2

ser, wireless ready. Wed May 12 02:3Open Twitter Page http://twitter.com @unixmx: 2010-07-23600 Fri Aug 14 19:03:Open Twitter Page http://twitter.com Hier begrij 2010-07-2

-14400 Mon Aug 17 14:3Open Twitter Page http://twitter.com VideoGam 2010-07-2Tue Jul 20 10:36: Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Tue Dec 30 01:35Open Twitter Page http://twitter.com Online per 2010-07-27200 Wed Apr 15 14:4 Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Sat Jan 31 22:50: Open Twitter Page http://twitter.com #tipps #sc 2010-07-2

25200 Sun Mar 07 05:17Open Twitter Page http://twitter.com Is This HT 2010-07-2-18000 Fri Feb 13 14:56: Open Twitter Page http://twitter.com Yes! RT @ 2010-07-232400 Thu Jan 14 15:30:Open Twitter Page http://twitter.com http://res 2010-07-2

3600 Thu Jul 23 14:23:Open Twitter Page http://twitter.com #iseeinfro 2010-07-27200 Wed Jul 08 13:32:Open Twitter Page http://twitter.com @ianaaro 2010-07-2

-32400 Tue Jul 20 09:18: Open Twitter Page http://twitter.com Microsoft 2010-07-2-18000 Sun Aug 10 11:51Open Twitter Page http://twitter.com Microsoft' 2010-07-2-32400 Tue Apr 07 06:28:Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 318/475

-18000 Wed Dec 31 04:5 Open Twitter Page http://twitter.com The oil spil 2010-07-234200 Wed Apr 08 12:4 Open Twitter Page http://twitter.com finally, our 2010-07-2

-18000 Fri Nov 28 18:51:Open Twitter Page http://twitter.com Good to k 2010-07-2-18000 Wed Apr 08 03:2 Open Twitter Page http://twitter.com RT @enga 2010-07-2

3600 Sun Jul 04 15:51: Open Twitter Page http://twitter.com Avaya Star 2010-07-2Tue Jul 06 11:13: Open Twitter Page http://twitter.com 2010-07-2

3600 Fri Apr 03 13:12: Open Twitter Page http://twitter.com Microsoft, 2010-07-2Sat Jul 17 15:36:5Open Twitter Page http://twitter.com #dental #s 2010-07-2Fri Jul 31 06:53:0Open Twitter Page http://twitter.com http://itan 2010-07-2

7200 Thu Nov 19 18:35Open Twitter Page http://twitter.com Antivirusul 2010-07-219800 Wed May 19 05:5Open Twitter Page http://twitter.com Unable to 2010-07-2

-10800 Wed May 12 01:1Open Twitter Page http://twitter.com [Tutorial] 2010-07-2Fri Jul 16 09:32:4Open Twitter Page http://twitter.com Microsoft 2010-07-2

-28800 Sat Apr 17 20:57:Open Twitter Page http://twitter.com MSDN Virt 2010-07-232400 Fri Nov 27 04:43:Open Twitter Page http://twitter.com 2010-07-2

-18000 Thu May 06 17:4 Open Twitter Page http://twitter.com Few seats l 2010-07-2

7200 Fri Jun 05 20:00:5Open Twitter Page http://twitter.com Every day I 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 319/475

Open Twitter Page http://twitter.com #microsoft 2010-07-2-14400 Wed Nov 11 17:4Open Twitter Page http://twitter.com Ya van cer 2010-07-2

18000 Thu Jul 02 22:58:Open Twitter Page http://twitter.com

SVN forVisual

studio2010http://bit.ly/b3KLZl#SVN#Visualstudio2010 2010-07-2

-28800 Sun Nov 29 08:15Open Twitter Page http://twitter.com Microsoft: 2010-07-2-36000 Thu Jan 07 11:19:Open Twitter Page http://twitter.com Saitek kee 2010-07-2-18000 Wed Jun 10 20:2 Open Twitter Page http://twitter.com PRC is look 2010-07-210800 Thu Mar 04 10:4 Open Twitter Page http://twitter.com Microsoft 2010-07-228800 Thu Mar 04 14:0 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-10800 Tue Mar 24 18:18Open Twitter Page http://twitter.com http://ww 2010-07-20 Tue Dec 11 11:11Open Twitter Page http://twitter.com Psytechnic 2010-07-2

Fri Jul 16 09:20:5Open Twitter Page http://twitter.com Microsoft 2010-07-2-36000 Tue Jun 23 08:30:Open Twitter Page http://twitter.com Ten Must- 2010-07-2

3600 Fri Apr 03 08:09: Open Twitter Page http://twitter.com "Provectu 2010-07-2-18000 Wed Jul 08 13:27:Open Twitter Page http://twitter.com Is #Micros 2010-07-2-21600 Sat Sep 05 22:26:Open Twitter Page http://twitter.com @RackerH 2010-07-2

3600 Wed Jan 20 00:3 Open Twitter Page http://twitter.com Impossibil 2010-07-2-36000 Tue Jul 13 00:44: Open Twitter Page http://twitter.com Microsoft' 2010-07-2

Tue Apr 13 09:32:Open Twitter Page http://twitter.com #job: Proje 2010-07-2-10800 Wed May 05 15:3Open Twitter Page http://twitter.com 26-07-201 2010-07-27200 Wed Apr 21 20:0 Open Twitter Page http://twitter.com Bana Micr 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 320/475

0 Mon Mar 02 12:2Open Twitter Page http://twitter.com

Dell are abunch of

retardshttp://is.gd/dJLjD -"ChooseUBUNTUif:You donot planto useMicrosoftWINDOWS." Um,wtf? 2010-07-2

-21600 Thu Dec 17 01:37Open Twitter Page http://twitter.com New Post: 2010-07-2-32400 Tue May 26 10:0 Open Twitter Page http://twitter.com Microsoft 2010-07-2

10800 Sat May 02 13:09Open Twitter Page http://twitter.com @dndeti I' 2010-07-2-28800 Sat Sep 26 05:15:Open Twitter Page http://twitter.com How the R 2010-07-2-18000 Sat Jun 19 10:28: Open Twitter Page http://twitter.com How the R 2010-07-225200 Wed Nov 18 14:1Open Twitter Page http://twitter.com How the R 2010-07-2

Open Twitter Page http://twitter.com How the R 2010-07-2-18000 Fri May 29 13:49:Open Twitter Page http://twitter.com How the R 2010-07-2-28800 Fri Aug 01 07:13:Open Twitter Page http://twitter.com How the R 2010-07-2-18000 Thu Oct 30 20:35:Open Twitter Page http://twitter.com I'm at Micr 2010-07-2-28800 Fri Jul 17 19:17:2Open Twitter Page http://twitter.com How the R 2010-07-2-18000 Tue Jun 30 20:37:Open Twitter Page http://twitter.com How the R 2010-07-2-18000 Thu Jun 28 00:09:Open Twitter Page http://twitter.com How the R 2010-07-2

3600 Tue Nov 17 14:01Open Twitter Page http://twitter.com Avaya star 2010-07-27200 Tue Aug 25 10:50Open Twitter Page http://twitter.com RT @alleyi 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 321/475

-18000 Tue Mar 16 01:05Open Twitter Page http://twitter.com @ALEXDA2010-07-228800 Fri Oct 23 09:55: Open Twitter Page http://twitter.com To 3E4s,th 2010-07-2-18000 Fri Apr 09 19:08: Open Twitter Page http://twitter.com $26.49 Mi 2010-07-2

Tue Apr 06 06:34:Open Twitter Page http://twitter.com Microsoft 2010-07-219800 Wed Sep 09 10:3 Open Twitter Page http://twitter.com Windows 2010-07-2

I wish! Jus a nice sayin Fri Jun 25 09:07:1Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Sat Apr 04 09:56:Open Twitter Page http://twitter.com Barca next 2010-07-2

Sun Nov 16 08:24Open Twitter Page http://twitter.com Microsoft 2010-07-2-21600 Thu May 22 13:2 Open Twitter Page http://twitter.com RT @adam 2010-07-2-10800 Fri Jul 10 21:12:5Open Twitter Page http://twitter.com @Prof_Fa 2010-07-2-25200 Sat Jul 17 18:34:5Open Twitter Page http://twitter.com #VideoGa 2010-07-2-10800 Tue Aug 25 12:55Open Twitter Page http://twitter.com 60% de no 2010-07-2-25200 Mon Sep 01 14:4 Open Twitter Page http://twitter.com Microsoft' 2010-07-2

Thu Mar 19 20:1 Open Twitter Page http://twitter.com Microsoft 2010-07-27200 Thu Oct 29 11:22:Open Twitter Page http://twitter.com RT @Scott 2010-07-2

-21600 Thu Jun 24 19:28:Open Twitter Page http://twitter.com 13:00 Edit 2010-07-2-10800 Mon Aug 13 17:0Open Twitter Page http://twitter.com No fds ach 2010-07-2

0 Thu Sep 18 12:11Open Twitter Page http://twitter.com Foursquar 2010-07-2Fri Jul 16 06:41:4Open Twitter Page http://twitter.com RT @SQL 2010-07-2

-21600 Wed Mar 04 20:1Open Twitter Page http://twitter.com @adam_h 2010-07-225200 Thu Apr 23 16:05:Open Twitter Page http://twitter.com Hating Mic 2010-07-2

19800 Tue Jan 13 14:55:Open Twitter Page http://twitter.com Microsoft 2010-07-2 ngenharia na PUCRS e Mon Jun 08 00:5Open Twitter Page http://twitter.com Document 2010-07-2

Open Twitter Page http://twitter.com

PC

━━

━━━ ('A`)━━━

━━ !!

http://bit.ly/aEYlV6 2010-07-2

Mon Jul 12 22:47:Open Twitter Page h ttp://twitter.com #internet 2010-07-23600 Fri Sep 18 22:28: Open Twitter Page http://twitter.com RT @fake 2010-07-2

-25200 Sun Jul 04 22:20: Open Twitter Page http://twitter.com #VideoGa 2010-07-2Thu May 28 17:5 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-28800 Sat Jul 11 15:16:1Open Twitter Page http://twitter.com Microsoft I 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 322/475

Thu May 13 15:3 Open Twitter Page http://twitter.com itmedia: [ 2010-07-2-18000 Thu Aug 27 18:32Open Twitter Page http://twitter.com Microsoft 2010-07-2

Wed Jun 09 21:5 Open Twitter Page http://twitter.com How to Re 2010-07-2-10800 Tue Dec 01 21:57Open Twitter Page http://twitter.com Se a Micro 2010-07-2

Fri Jun 04 11:18:3Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Mon Jul 13 13:36:Open Twitter Page http://twitter.com Cloud com 2010-07-2

-28800 Thu Jul 16 20:07:Open Twitter Page http://twitter.com Social Med 2010-07-2Wed Jun 02 04:0 Open Twitter Page http://twitter.com Microsoft 2010-07-2-21600 Thu Jun 24 14:33:Open Twitter Page http://twitter.com Meet CON 2010-07-2-14400 Sat Nov 07 23:12:Open Twitter Page http://twitter.com #CIO Offic 2010-07-2

mmo,I took a photogr Sun Feb 21 15:59:Open Twitter Page http://twitter.com Microsoft 2010-07-2about SEO (Search EngWed Apr 21 09:0 Open Twitter Page http://twitter.com faabo.com 2010-07-2

-10800 Tue Mar 17 13:23Open Twitter Page http://twitter.com Produtos d 2010-07-2-18000 Sun May 06 19:3 Open Twitter Page http://twitter.com Reading: E 2010-07-228800 Tue Sep 08 14:05:Open Twitter Page http://twitter.com Sian, both 2010-07-214400 Tue Mar 16 13:37Open Twitter Page http://twitter.com #Tech Dail 2010-07-2

0 Tue Mar 11 17:57Open Twitter Page http://twitter.com I'm a bit lo 2010-07-2e Company, having braWed Feb 24 00:0 Open Twitter Page http://twitter.com Toyota wa 2010-07-2

18000 Thu Jul 15 13:45:Open Twitter Page http://twitter.com Оригинал 2010-07-2Tue Jun 29 09:47:Open Twitter Page http://twitter.com Microsoft 2010-07-2

19800 Thu May 14 12:2 Open Twitter Page http://twitter.com [UD] Micr 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 323/475

0 Fri Jun 29 10:54:4Open Twitter Page http://twitter.com

OrganasisMyTaskerEPM

1.0.0:Clientsoftwareforofflineaccess toMicrosoftProjectServerfor teammembers.

Mo...http://bit.ly/boefN0 2010-07-2

-18000 Mon Nov 23 22:1Open Twitter Page http://twitter.com @gweber I 2010-07-225200 Thu Oct 16 10:23:Open Twitter Page http://twitter.com http://ww 2010-07-2

Open Twitter Page http://twitter.com HMV says 2010-07-2Wed Apr 14 06:0 Open Twitter Page http://twitter.com Оригинал 2010-07-2

-18000 Sat Jun 27 16:34: Open Twitter Page http://twitter.com Microsoft 2010-07-2

Sat Jul 17 09:28:4Open Twitter Page http://twitter.com

http://www.mydailyprogress.com/index.php/cws/forum/member/20000/ explanatoryguideline#colombia#microsof t #tips 2010-07-2

32400 Thu Oct 29 14:10:Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Wed Mar 10 19:4 Open Twitter Page http://twitter.com Microsoft 2010-07-2

Thu Sep 03 17:53Open Twitter Page http://twitter.com I just enter 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 324/475

Mon May 17 09:2Open Twitter Page http://twitter.com Microsoft 2010-07-27200 Tue Jun 22 18:30:Open Twitter Page http://twitter.com Microsoft 2010-07-2

-10800 Fri Mar 13 17:47:Open Twitter Page http://twitter.com Veja imag 2010-07-228800 Tue Aug 18 13:52Open Twitter Page http://twitter.com Yeay! Final 2010-07-2

7200 Mon Jun 14 16:0 Open Twitter Page http://twitter.com RT @alleyi 2010-07-2Open Twitter Page http://twitter.com #microsoft 2010-07-2

-18000 Fri Jul 24 19:15:5Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Sat Jul 04 15:33:0Open Twitter Page http://twitter.com @Der_Gali 2010-07-27200 Sat Feb 09 15:33:Open Twitter Page http://twitter.com @vigants J 2010-07-2

10800 Thu Jun 18 22:10:Open Twitter Page http://twitter.com

Турнирпо Halo 3на WCG2010: 

GameMAG.ruсовместно скомпаниейMicrosoftиhttp://url4.eu/6PIO3 2010-07-2

0 Mon Jun 04 15:2 Open Twitter Page http://twitter.com #Microsoft 2010-07-2

3600 Wed Jul 08 19:50:Open Twitter Page http://twitter.com www.impr 2010-07-2-18000 Mon May 04 18:3Open Twitter Page http://twitter.com Microsoft, 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 325/475

3600 Thu Mar 22 00:4 Open Twitter Page http://twitter.com dear #micr 2010-07-2Open Twitter Page http://twitter.com Yah aku ki 2010-07-2

Fri Jul 23 18:37:1Open Twitter Page http://twitter.com PDC10: No2010-07-2Fri Jul 23 18:33:4Open Twitter Page http://twitter.com PDC10: No2010-07-2Fri Jul 23 18:29:2Open Twitter Page http://twitter.com PDC10: No2010-07-2Fri Jul 23 18:46:2Open Twitter Page http://twitter.com PDC10: No2010-07-2

Fri May 28 03:42:Open Twitter Page http://twitter.com Customize 2010-07-2Sat Jul 03 06:00:3Open Twitter Page http://twitter.com HP, Micro 2010-07-2-18000 Sat Apr 17 14:33:Open Twitter Page http://twitter.com This day in 2010-07-221600 Tue Sep 22 06:59:Open Twitter Page http://twitter.com Мне понр 2010-07-2

0 Mon Mar 29 11:2Open Twitter Page http://twitter.com Microsoft 2010-07-236000 Sat Jun 12 20:11: Open Twitter Page http://twitter.com Рекордны 2010-07-219800 Fri Apr 17 10:30: Open Twitter Page http://twitter.com Building R 2010-07-2

-10800 Sat Sep 05 08:38:Open Twitter Page http://twitter.com @vente pr 2010-07-20 Sat Nov 29 15:38:Open Twitter Page http://twitter.com New blog 2010-07-2

-18000 Wed May 09 01:1Open Twitter Page http://twitter.com I am enter 2010-07-2-14400 Wed Mar 26 12:0Open Twitter Page http://twitter.com Microsoft 2010-07-2-18000 Sat May 02 05:12Open Twitter Page http://twitter.com RT @Scott 2010-07-2

0 Wed Feb 04 20:2 Open Twitter Page http://twitter.com I just enter 2010-07-2-10800 Fri Apr 03 14:48: Open Twitter Page http://twitter.com Microsoft 2010-07-2

Sun Jul 25 09:42: Open Twitter Page http://twitter.com Steve Jobs 2010-07-2Fri Jun 25 05:12:5Open Twitter Page http://twitter.com ☛☛☛ El 2010-07-2

7200 Tue May 12 11:0 Open Twitter Page http://twitter.com New Micr 2010-07-2

3600 Fri Mar 06 14:27:Open Twitter Page http://twitter.com Microsoft 2010-07-20 Wed Aug 26 19:3Open Twitter Page http://twitter.com Citrix and 2010-07-2

-18000 Mon Mar 30 12:2Open Twitter Page http://twitter.com Microsoft 2010-07-27200 Tue Sep 15 08:08:Open Twitter Page http://twitter.com Microsoft 2010-07-2

-14400 Tue May 26 10:4 Open Twitter Page http://twitter.com RT: @ricar 2010-07-219800 Mon Jul 26 07:06:Open Twitter Page http://twitter.com Bill Gates, 2010-07-2

Sat Jul 03 14:20:2Open Twitter Page h ttp://twitter.com Microsoft I 2010-07-225200 Fri Mar 05 09:32:Open Twitter Page http://twitter.com hadoohhh. 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 326/475

-10800 Tue Apr 27 12:56:Open Twitter Page http://twitter.com RT @giova 2010-07-2

-10800 Wed Sep 30 20:4 Open Twitter Page http://twitter.com

#Microsof t -Mitarbeiter will

#AppleStorebetreten.An derTürmeintaber derSicherheitsbeamte:"Ey!! Dukommshier netrein!" 2010-07-2

0 Wed May 14 10:5Open Twitter Page http://twitter.com Microsoft' 2010-07-2-18000 Fri Jul 10 11:54:2Open Twitter Page http://twitter.com Chicago: Vi 2010-07-2

0 Fri Mar 13 14:17:Open Twitter Page http://twitter.com @Slayed0 2010-07-2

-18000 Tue Dec 30 15:08Open Twitter Page http://twitter.com LMAOOO 2010-07-232400 Mon Jun 15 03:1 Open Twitter Page http://twitter.com 2010-07-2

-21600 Sun Jul 18 23:49: Open Twitter Page http://twitter.com RT @alleyi 2010-07-2g and Collaboration. AFri Jul 23 09:03:0Open Twitter Page http://twitter.com Microsoft 2010-07-2

Sun Jul 18 07:47: Open Twitter Page http://twitter.com

http://forum.sandierrot.fr/profile.php?id=5992 #Microsof t #11eagerplace#fatburningfurnacescam 2010-07-2

Mon Apr 05 12:1 Open Twitter Page http://twitter.com Все сотру 2010-07-2-10800 Wed Feb 03 12:0 Open Twitter Page http://twitter.com Será se em 2010-07-2

Fri Jun 18 18:04:3Open Twitter Page http://twitter.com Microsoft 2010-07-2Wed Mar 10 15:2 Open Twitter Page http://twitter.com Polycom G 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 327/475

-10800 Sat Mar 20 17:17:Open Twitter Page http://twitter.com RT @Mira 2010-07-225200 Sat Aug 15 10:11:Open Twitter Page http://twitter.com @WilsonK 2010-07-2

7200 Tue Jul 08 10:50: Open Twitter Page http://twitter.com Alright Alri 2010-07-2

-18000 Thu Sep 04 11:33Open Twitter Page http://twitter.com

I hopemicrosoft

wins so idon'thave tostopusingGoogle,as"TechGiantsVie toSell U.S.CloudMail"http://bit.ly/9rStaI 2010-07-2

3600 Thu Jul 02 20:41:Open Twitter Page http://twitter.com Fun is over 2010-07-2nd industry outsider. I Sun Jun 27 22:45:Open Twitter Page http://twitter.com Financial F 2010-07-2

Fri Jun 25 23:45:2Open Twitter Page http://twitter.com 4 Reasons 2010-07-2-18000 Thu Feb 26 05:05Open Twitter Page http://twitter.com "Microsoft 2010-07-2

-10800 Sat Dec 19 19:23:Open Twitter Page http://twitter.com

RT@angeldo

minguez:Portalterminológicomultilingüe deMicrosoft:imprescidible paratraducción desoftware/IThttp://bit.ly/9BUtI1#xl8/via@alemanita 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 328/475

-18000 Wed Jun 03 19:4 Open Twitter Page http://twitter.com Try the fre 2010-07-2-28800 Fri Jun 05 04:31:2Open Twitter Page http://twitter.com gw nyebut 2010-07-2

3600 Fri Dec 12 07:45:Open Twitter Page http://twitter.com RT @ad_n 2010-07-218000 Tue Jul 10 23:52: Open Twitter Page http://twitter.com Microsoft' 2010-07-2

Wed Mar 10 02:3 Open Twitter Page http://twitter.com Windows 2010-07-2-36000 Mon Dec 14 05:5 Open Twitter Page http://twitter.com Microsoft I 2010-07-2

36000 Wed May 19 10:5Open Twitter Page http://twitter.com windows v 2010-07-2-18000 Wed Sep 23 20:4 Open Twitter Page http://twitter.com Questions 2010-07-2-10800 Thu Jul 02 17:25:Open Twitter Page http://twitter.com Novas log 2010-07-2-10800 Thu May 07 18:1 Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Tue Dec 15 22:00Open Twitter Page http://twitter.com Record wi 2010-07-2

3600 Thu Nov 12 12:16Open Twitter Page http://twitter.com ARM meg 2010-07-2) and Finance(Phd), Ch Sat Feb 13 10:22:Open Twitter Page http://twitter.com Even With 2010-07-2

3600 Sun Jan 24 15:15:Open Twitter Page http://twitter.com

RT@angeldo

minguez:Portalterminológicomultilingüe deMicrosofthttp://bit.ly/9BUtI1#xl8(vía@alemanita) 2010-07-2

-21600 Tue Jan 05 14:48:Open Twitter Page http://twitter.com Tribridge i 2010-07-20 Mon Jun 02 21:5 Open Twitter Page http://twitter.com recovered 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 329/475

-10800 Sun Aug 02 06:30Open Twitter Page http://twitter.com

Left 4Dead 2

[PC] [Fulliso] [1Link] (0puntos):Requerimientos:Mínimos:SistemaOperativo:MicrosoftWindowsX...http://bit.ly/ajugfY 2010-07-2

25200 Mon Jun 14 09:2 Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 330/475

19800 Sun Mar 22 06:10Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

28800 Fri Sep 21 04:36: Open Twitter Page http://twitter.com

#Tech -Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveax...http://bit.ly/dzdLiM 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 331/475

-28800 Sun Jun 28 07:21:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

Sun Jul 04 20:53: Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alive

with newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 332/475

Sat Jun 12 21:18: Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

Sat Jul 03 21:31:2Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith new

gear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 333/475

Tue Jun 08 02:08:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

-25200 Sun May 16 15:2 Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith new

gear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 334/475

Mon Jun 07 01:3 Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

Fri Jul 02 02:30:2Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith new

gear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 335/475

Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed...http://tinyurl.com/35wegdv 2010-07-2

Thu Jul 01 09:58:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alive

with newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 336/475

Sat Jun 26 20:39: Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsFlightSimulatorfran... 2010-07-2

Sun Mar 01 20:30Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alive

with newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 337/475

0 Thu Jan 28 09:59:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

p in the rankings, we Tue Jun 08 16:17:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 338/475

Tue Mar 30 08:28Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-10800 Sat Mar 28 01:31:Open Twitter Page http://twitter.com

RT@SegInfo:[Notícia]Microsoftmuda

políticadedivulgação devulnerabilidadeshttp://tiny.cc/tqtha 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 339/475

Sun Jun 06 02:05:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-18000 Fri Dec 18 15:25:Open Twitter Page http://twitter.com Earn your 2010-07-2-21600 Wed Apr 16 21:2 Open Twitter Page http://twitter.com @laterz R 2010-07-2-21600 Tue May 05 17:2 Open Twitter Page http://twitter.com IndustryTo 2010-07-2

Sun Mar 28 16:33Open Twitter Page http://twitter.com

Saitek

keepsflightsimulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 340/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 341/475

-21600 Sat Mar 13 01:13:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-28800 Tue Feb 02 08:26:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 342/475

Tue Jan 12 11:46:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

32400 Mon Sep 21 12:4 Open Twitter Page http://twitter.com

EG Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed it...http://bit.ly/a0xaXX2010-07-2

14400 Wed Mar 17 16:2 Open Twitter Page http://twitter.com 100% FRE 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 343/475

-18000 Wed Jul 22 00:58:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

-18000 Mon Mar 16 15:2Open Twitter Page http://twitter.com Deploying 2010-07-2

3600 Sun Jul 19 15:10: Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/c2HCFt 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 344/475

-32400 Fri Mar 13 16:23:Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/918gJy 2010-07-2

36000 Tue Nov 24 08:14Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 345/475

-28800 Sun Oct 25 01:17:Open Twitter Page http://twitter.com

Engadget- Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftma...http://tinyurl.com/35wegdv 2010-07-2

Sat Aug 15 01:40:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith new

gear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/90tAnQ 2010-07-2

10800 Sat Jul 24 11:09:0Open Twitter Page http://twitter.com В разделе 2010-07-2-32400 Mon Feb 08 18:3 Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 346/475

0 Tue Apr 21 20:07:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay have...http://bit.ly/aqJTJ9#geekstuf f 2010-07-2

28800 Thu Mar 19 12:2 Open Twitter Page http://twitter.com BLAKH YO2010-07-2

-28800 Wed Feb 11 18:5 Open Twitter Page http://twitter.com

Engadget:Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay have...http://bit.ly/a0YebD 2010-07-2

Open Twitter Page http://twitter.com Оригинал 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 347/475

32400 Thu Apr 01 06:26:Open Twitter Page http://twitter.com "Microsoft2010-07-2

Thu Jul 15 16:52:Open Twitter Page http://twitter.com Microsoft 2010-07-2Mon Jun 14 00:0 Open Twitter Page http://twitter.com Microsoft 2010-07-2Mon Jul 26 03:48:Open Twitter Page http://twitter.com iphone: Mi 2010-07-2

-14400 Thu Apr 10 01:52:Open Twitter Page http://twitter.com depois de 2010-07-2-10800 Fri Feb 13 16:44: Open Twitter Page http://twitter.com RT @MrJe 2010-07-2

0 Mon Feb 22 11:1 Open Twitter Page http://twitter.com #jobs #sql 2010-07-2Mon Jul 26 06:58:Open Twitter Page http://twitter.com MSR Micr 2010-07-2

3600 Sun Oct 11 15:14:Open Twitter Page http://twitter.com Office 201 2010-07-2Tue Jul 20 21:49: Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Sun Jul 04 09:41: Open Twitter Page http://twitter.com Fatturato, 2010-07-27200 Thu Apr 16 07:45:Open Twitter Page http://twitter.com http://url4 2010-07-2

Sat May 01 11:54Open Twitter Page http://twitter.com New post: 2010-07-2-21600 Wed Nov 26 16:0Open Twitter Page http://twitter.com RT @enga 2010-07-2

3600 Mon Apr 20 08:0 Open Twitter Page http://twitter.com actweb: M 2010-07-2Sat Apr 10 02:00:Open Twitter Page http://twitter.com Microsoft 2010-07-2

32400 Tue Jun 15 00:43:Open Twitter Page http://twitter.com Microsoft 2010-07-2Open Twitter Page http://twitter.com ms crm se 2010-07-2

-18000 Tue Sep 16 14:41:Open Twitter Page http://twitter.com to those th 2010-07-2-10800 Tue Jul 20 21:59: Open Twitter Page http://twitter.com RT @Mira 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 348/475

-18000 Mon Sep 21 21:3 Open Twitter Page http://twitter.com Reconocim 2010-07-236000 Wed Feb 25 09:4 Open Twitter Page http://twitter.com I am now 2010-07-2

3600 Mon Apr 20 12:5 Open Twitter Page http://twitter.com Convertid 2010-07-2-18000 Fri Jul 09 13:36:1Open Twitter Page http://twitter.com Microsoft, 2010-07-2-16200 Wed Apr 21 02:1 Open Twitter Page http://twitter.com #Microsoft 2010-07-2

0 Mon Apr 06 20:2 Open Twitter Page http://twitter.com UPDATE: 2010-07-2

32400 Sat Apr 04 14:40:Open Twitter Page http://twitter.com 2010-07-2

28800 Thu May 20 12:4 Open Twitter Page http://twitter.com Microsoft i 2010-07-2-10800 Mon Sep 01 11:5 Open Twitter Page http://twitter.com ils sont sy 2010-07-2-18000 Sat Dec 20 00:58:Open Twitter Page http://twitter.com Engineerin 2010-07-2-36000 Wed Jan 06 10:3 Open Twitter Page http://twitter.com [9 to 5 Ma 2010-07-2-25200 Thu Apr 02 20:01:Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 349/475

3600 Mon Jul 06 14:51:Open Twitter Page http://twitter.com

ITConsultant im

Client-Service:MünchenIhrAufgabenschwerpunktBeratungundImplementierungvonMicrosoft-Lösung...http://bit.ly/cqyE27 2010-07-2

Fri Jun 04 09:58:4Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Thu Feb 26 08:43Open Twitter Page http://twitter.com

Newsloganfor

Microsoft: "Bewhat'snext."hmmmmm hoabout:Foreveriscomposed ofnows.~EmilyDickinson 2010-07-2

0 Wed Mar 18 14:4 Open Twitter Page http://twitter.com After so m 2010-07-2-18000 Tue Jul 14 00:07: Open Twitter Page http://twitter.com How the R 2010-07-2-36000 Fri Apr 03 17:32: Open Twitter Page http://twitter.com Microsoft 2010-07-2

Wed Apr 28 12:4 Open Twitter Page http://twitter.com Microsoft 2010-07-2-18000 Sat May 16 20:26Open Twitter Page http://twitter.com How the R 2010-07-2

Open Twitter Page http://twitter.com RT @pock 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 350/475

-18000 Mon Apr 06 01:3 Open Twitter Page http://twitter.com RT @digita 2010-07-2s dem Ressort Digital Mon Mar 08 14:5Open Twitter Page http://twitter.com Software - 2010-07-2

3600 Fri Nov 07 10:20:Open Twitter Page http://twitter.com @mrsimo 2010-07-23600 Tue May 13 11:5 Open Twitter Page http://twitter.com RT @alleyi 2010-07-23600 Sat Sep 12 09:20:Open Twitter Page http://twitter.com Anja Kruse 2010-07-2

-10800 Wed Jul 30 11:38:Open Twitter Page http://twitter.com Handelsbl 2010-07-2

-18000 Sun Jun 07 13:49:Open Twitter Page http://twitter.com I just enter 2010-07-2sumption Thu Jul 22 00:25: Open Twitter Page http://twitter.com Anja Kruse 2010-07-2-10800 Sun May 17 01:3 Open Twitter Page http://twitter.com RT @javah 2010-07-2

3600 Mon Feb 15 17:4 Open Twitter Page http://twitter.com #heise #te 2010-07-2

32400 Fri Mar 12 04:22:Open Twitter Page http://twitter.com

DylinPrestly:Microsoft.NET vsJavaTrailerhttp://dai.ly/duoJGg on@dailymotion

#devkr 2010-07-2

0 Sat Mar 07 20:49:Open Twitter Page http://twitter.com I wish I wo 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 351/475

Mon Jul 26 12:15:Open Twitter Page http://twitter.com

This isGameWatch,

This isthe placewhereyouwouldfind infoaboutmicrosoft,apple,nintendoandmanyupcominggamesconsoles+computer 2010-07-2

-36000 Tue Dec 08 15:46Open Twitter Page http://twitter.com HP y Micro 2010-07-2-21600 Tue Jun 02 04:00:Open Twitter Page http://twitter.com Bada Bing, 2010-07-2-18000 Mon Jan 04 03:0 Open Twitter Page http://twitter.com I'm at Micr 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 352/475

32400 Tue Jun 05 04:04:Open Twitter Page http://twitter.com 2010-07-2

3600 Mon Aug 03 11:5Open Twitter Page http://twitter.com Ganz inter 2010-07-2Sun May 09 19:4 Open Twitter Page http://twitter.com <![CDATA[ 2010-07-2

19800 Mon Mar 22 07:5Open Twitter Page http://twitter.com Windows I 2010-07-20 Mon Mar 19 15:3Open Twitter Page http://twitter.com T&C's #FAI 2010-07-2

3600 Mon Feb 02 21:1 Open Twitter Page http://twitter.com @drbuk « 2010-07-225200 Wed May 13 05:4Open Twitter Page http://twitter.com RT @kafaa 2010-07-2

-18000 Mon Aug 18 19:0Open Twitter Page http://twitter.com Microsoft 2010-07-2 icles Fri Jul 16 17:12:5Open Twitter Page http://twitter.com SAI: Micro 2010-07-2

per. Noisenik. Sun May 23 10:3 Open Twitter Page http://twitter.com With a Ma 2010-07-2 ious while working an Fri Jun 18 11:25:2Open Twitter Page http://twitter.com Are you tir 2010-07-2

0 Tue Nov 10 17:35Open Twitter Page http://twitter.com If it actuall 2010-07-23600 Thu Jul 16 06:49:Open Twitter Page http://twitter.com Lese jedes 2010-07-2

Wed Apr 28 12:1 Open Twitter Page http://twitter.com *Fix+ Error2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 353/475

36000 Mon Jan 04 12:3 Open Twitter Page http://twitter.com

Guest islookingatMicrosoftWindows

Server2008Standard -OEM.[AU Melbourne]♪♪♪ http://bit.ly/8X3g5Q 2010-07-2

0 Mon Jul 13 18:44:Open Twitter Page http://twitter.com @Muse, L 2010-07-23600 Sun Jul 25 20:19: Open Twitter Page http://twitter.com Allibereu-v 2010-07-2

-36000 Thu Oct 01 12:17:Open Twitter Page http://twitter.com

Saitekkeepsflightsimulation alivewith newgear, no

word onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/aWnE2Y 2010-07-2

Tue Nov 17 10:54Open Twitter Page http://twitter.com RT @Dave 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 354/475

-21600 Sun Mar 16 02:34Open Twitter Page http://twitter.com

engadgetSaitekkeepsflightsimulatio

n alivewith newgear, noword onrobot airhostesses:Microsoftmay havea...http://bit.ly/aWnE2Y 2010-07-2

0 Sun Dec 13 21:53Open Twitter Page http://twitter.com Dan on Fil 2010-07-2-10800 Sun May 24 14:0 Open Twitter Page http://twitter.com Microsoft 2010-07-2-18000 Thu Jul 30 02:40:Open Twitter Page http://twitter.com 2010-07-228800 Thu Apr 01 11:59:Open Twitter Page http://twitter.com @SaraVoV 2010-07-2

3600 Tue Apr 28 19:24:Open Twitter Page http://twitter.com #Microsoft 2010-07-23600 Thu Apr 01 22:19:Open Twitter Page http://twitter.com New post: 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 355/475

32400 Sun Mar 21 05:45Open Twitter Page http://twitter.com #Microsoft 2010-07-2

10800 Sun Jul 04 13:49: Open Twitter Page http://twitter.com Michael Ja 2010-07-219800 Wed Feb 10 22:0 Open Twitter Page http://twitter.com Microsoft 2010-07-232400 Sat Aug 18 20:32:Open Twitter Page http://twitter.com RT @u_aki 2010-07-2

-18000 Tue Feb 23 09:38:Open Twitter Page http://twitter.com Оригинал 2010-07-219800 Mon Aug 31 07:4Open Twitter Page http://twitter.com Microsoft I 2010-07-2

-36000 Tue Jun 29 11:13:Open Twitter Page http://twitter.com RT @geek 2010-07-236000 Fri Jul 09 16:07:5Open Twitter Page http://twitter.com RT @digita 2010-07-2

ou don't hate. Sun Jul 04 18:02: Open Twitter Page http://twitter.com New posti 2010-07-2-18000 Fri Feb 19 00:02: Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Fri Jun 19 18:44:2Open Twitter Page http://twitter.com RT @Mira 2010-07-2

3600 Mon Mar 23 06:4Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Mon Aug 10 12:4Open Twitter Page http://twitter.com Downloadi 2010-07-2

-10800 Tue Oct 13 09:48:Open Twitter Page http://twitter.com Reading: " 2010-07-2Mon Jul 26 12:14:Open Twitter Page http://twitter.com http://ww 2010-07-2

3600 Sat May 16 09:56Open Twitter Page http://twitter.com Microsoft 2010-07-228800 Tue Apr 07 17:48:Open Twitter Page http://twitter.com Microsoft i 2010-07-2

Sun Jun 06 17:38:Open Twitter Page http://twitter.com Game Ne 2010-07-2Mon Jul 26 11:33:Open Twitter Page http://twitter.com ola eu fui 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 356/475

-18000 Thu Apr 03 12:47:Open Twitter Page http://twitter.com RT @alleyi 2010-07-2-10800 Thu Jun 11 16:34:Open Twitter Page http://twitter.com Microsoft j 2010-07-2го бизнеса для профе Mon Jun 28 07:2 Open Twitter Page http://twitter.com Microsoft 2010-07-2

19800 Wed Jul 29 12:56:Open Twitter Page http://twitter.com How to Re 2010-07-2Sat Jul 24 06:33:2Open Twitter Page http://twitter.com fatburning 2010-07-2

-18000 Tue May 19 12:2 Open Twitter Page http://twitter.com Microsoft: 2010-07-2

-10800 Mon Mar 16 17:4Open Twitter Page http://twitter.com [#News] M 2010-07-219800 Sun Feb 03 09:32:Open Twitter Page http://twitter.com How to Re 2010-07-236000 Wed Mar 25 12:1 Open Twitter Page http://twitter.com How to Re 2010-07-236000 Mon Apr 13 00:3 Open Twitter Page http://twitter.com How to Re 2010-07-219800 Tue Nov 24 02:38Open Twitter Page http://twitter.com RT @vikra 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 357/475

-18000 Wed Dec 30 16:5 Open Twitter Page http://twitter.com

Saitekkeepsflight

simulation alivewith newgear, noword onrobot airhostesses:Microsoftmay haveaxed itsF...http://bit.ly/dzdLiM 2010-07-2

3600 Sat Oct 10 19:52:Open Twitter Page http://twitter.com Svi bi Micr 2010-07-2

Mon May 11 01:4Open Twitter Page http://twitter.com

[Engadget] Saitekkeeps

flightsimulation alivewith newgear, noword onrobot airhostesses-Microsoft...http://tinyurl.com/33r3626 2010-07-2

-18000 Wed Jan 06 23:5 Open Twitter Page http://twitter.com Thinking a 2010-07-232400 Fri Sep 14 06:45: Open Twitter Page http://twitter.com Computer 2010-07-232400 Wed Aug 05 12:5Open Twitter Page http://twitter.com 2010-07-2

3600 Wed Jan 13 18:3 Open Twitter Page http://twitter.com ARM meg 2010-07-2-28800 Mon Dec 01 17:0 Open Twitter Page http://twitter.com I just enter 2010-07-2-18000 Sun Oct 18 15:23:Open Twitter Page http://twitter.com RT @Gran 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 358/475

32400 Mon Jul 21 08:47:Open Twitter Page http://twitter.com 2010-07-2-18000 Tue Apr 06 02:44:Open Twitter Page http://twitter.com Windows 2010-07-2-14400 Thu Jul 22 23:05:Open Twitter Page http://twitter.com RT @Mira 2010-07-2

Fri May 21 06:32:Open Twitter Page http://twitter.com Anja Kruse 2010-07-2Mon May 24 13:1Open Twitter Page http://twitter.com Anja Kruse 2010-07-2

25200 Wed Sep 17 15:2 Open Twitter Page http://twitter.com

ສົງໄສກ່ຽວກັ ບ Microsoft:Microsoft Office2003

ເປັ ນເວີ

ັ ນທີ 11

Microsoft Office2007

ເປັ ນເວີ

ັ ນທີ 12

ມາດ

ຮອດ

ປັດຈຸ ບັນ...http://bit.ly/axvzwf 2010-07-2

-21600 Sun Mar 07 03:41Open Twitter Page http://twitter.com Microsoft 2010-07-2-36000 Mon Jan 04 12:5 Open Twitter Page http://twitter.com @PBloveJ 2010-07-20 Tue Mar 03 15:49Open Twitter Page http://twitter.com @Caseyo4 2010-07-2

3600 Thu Feb 25 14:43Open Twitter Page http://twitter.com #Job #IT M 2010-07-2Thu Jun 17 20:35:Open Twitter Page http://twitter.com #jobs #tec 2010-07-2

0 Thu Jun 14 23:13:Open Twitter Page http://twitter.com RT @eden 2010-07-2Sun Jul 25 14:46: Open Twitter Page http://twitter.com software 2010-07-2

0 Wed Apr 02 12:4 Open Twitter Page http://twitter.com Here you 2010-07-2-14400 Thu Jul 02 23:23:Open Twitter Page http://twitter.com Video: HT 2010-07-2-25200 Wed Nov 11 21:2Open Twitter Page http://twitter.com Microsoft 2010-07-2

Sun Jul 04 08:23: Open Twitter Page http://twitter.com Microsoft 2010-07-2Mon Jun 22 10:1 Open Twitter Page http://twitter.com Barron's A 2010-07-2

-21600 Thu Feb 26 10:35Open Twitter Page http://twitter.com #nerd Mic 2010-07-20 Fri Apr 17 23:50: Open Twitter Page http://twitter.com i am now f 2010-07-2

25200 Thu May 28 13:3 Open Twitter Page http://twitter.com : How To F 2010-07-2-10800 Fri Nov 14 09:58:Open Twitter Page http://twitter.com Kütyü Ingy 2010-07-2

Fri Jul 23 12:55:5Open Twitter Page http://twitter.com Microsoft 2010-07-2Open Twitter Page http://twitter.com New blog 2010-07-2

3600 Sat Feb 07 22:04:Open Twitter Page http://twitter.com RT @imjus 2010-07-2-18000 Thu Mar 04 21:0 Open Twitter Page http://twitter.com #jobs #itjo 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 359/475

mor Sat Aug 08 07:54:Open Twitter Page http://twitter.com @Richard 2010-07-2-21600 Tue Oct 07 12:32:Open Twitter Page http://twitter.com Microsoft, 2010-07-2-10800 Mon Jun 14 12:0 Open Twitter Page http://twitter.com Os 10 pro 2010-07-2-10800 Tue Aug 11 13:21Open Twitter Page http://twitter.com Analista T 2010-07-2

hnologie Sat Dec 19 12:57:Open Twitter Page http://twitter.com Microsoft i 2010-07-2

3600 Thu Dec 10 08:22Open Twitter Page http://twitter.com Informatio 2010-07-2-36000 Sat Jun 05 22:52: Open Twitter Page http://twitter.com Photo: Mi 2010-07-2

3600 Mon Mar 15 07:0Open Twitter Page http://twitter.com Microsoft i 2010-07-2-10800 Thu Jul 15 08:16:Open Twitter Page http://twitter.com Microsoft 2010-07-2

Sat Dec 12 03:01:Open Twitter Page http://twitter.com Microsoft' 2010-07-2Thu Jul 22 09:10:Open Twitter Page http://twitter.com Russian st 2010-07-2Wed Sep 09 09:3 Open Twitter Page http://twitter.com Рекордны 2010-07-2

:2008 approved reselle Wed Jun 02 14:4 Open Twitter Page http://twitter.com In other n 2010-07-2-18000 Sun Sep 27 22:57:Open Twitter Page http://twitter.com Microsoft 2010-07-2

7200 Sat Jul 24 16:54:2Open Twitter Page http://twitter.com Сотрудни 2010-07-2-14400 Sun Nov 16 18:18Open Twitter Page http://twitter.com Enterprise 2010-07-2

3600 Wed Jul 08 10:50:Open Twitter Page http://twitter.com http://nl.ill 2010-07-2-32400 Thu Sep 25 19:12Open Twitter Page http://twitter.com New Micr 2010-07-2-21600 Wed Jun 10 17:2 Open Twitter Page http://twitter.com New Micr 2010-07-2

3600 Tue Dec 04 15:05Open Twitter Page http://twitter.com Microsoft 2010-07-20 Fri Jan 26 15:30:2Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Wed May 06 11:3Open Twitter Page http://twitter.com Microsoft 2010-07-228800 Thu Apr 16 03:37:Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 360/475

Mon Jul 19 11:32:Open Twitter Page http://twitter.com

#microsof t Brilliantshortpost

#digg#besthttp://www.robertearlkeen.com/forum/index.php?action=profile;u=26885 2010-07-2

-21600 Tue Apr 28 17:50:Open Twitter Page http://twitter.com RT @sengi 2010-07-2-28800 Thu Dec 17 02:33Open Twitter Page http://twitter.com emang dis 2010-07-2

19800 Sat Sep 12 12:29:Open Twitter Page http://twitter.com

Microsoft:CollaboratingSystems,Informati

on andPeoplewith MSDynamicsAX 2009AIFFrameworkhttp://chilp.it/e86978 #infosys#infyblogs 2010-07-2

0 Fri Dec 15 07:33:Open Twitter Page http://twitter.com @Richard 2010-07-20 Sat Apr 11 19:14:Open Twitter Page http://twitter.com Microsoft 2010-07-2

Open Twitter Page http://twitter.com microsoft 2010-07-2Sun Mar 28 12:59Open Twitter Page http://twitter.com @taiichi84 2010-07-2

3600 Fri Jul 24 12:37:0Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Wed Dec 30 15:5 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-28800 Thu Dec 10 10:53Open Twitter Page http://twitter.com RT @EhTa 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 361/475

-28800 Tue Sep 08 13:14:Open Twitter Page http://twitter.com RT @netm 2010-07-2-32400 Wed Feb 11 14:3 Open Twitter Page http://twitter.com @TheZann 2010-07-2

3600 Mon Jan 25 13:1 Open Twitter Page http://twitter.com RT @KevD 2010-07-2-18000 Mon Sep 21 20:2 Open Twitter Page http://twitter.com Well done 2010-07-2

3600 Wed Feb 27 14:4 Open Twitter Page http://twitter.com #Microsoft 2010-07-23600 Wed Nov 19 11:2Open Twitter Page http://twitter.com Anja Kruse 2010-07-2

-18000 Tue May 26 15:4 Open Twitter Page http://twitter.com Does anyo 2010-07-23600 Sat Jan 24 19:50: Open Twitter Page http://twitter.com Big Money2010-07-219800 Fri Jan 09 15:24:0Open Twitter Page http://twitter.com The Micro 2010-07-2

-25200 Mon May 24 19:3Open Twitter Page http://twitter.com Write som 2010-07-23600 Sat May 16 18:45Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Wed Jul 30 12:52:Open Twitter Page http://twitter.com I just cons 2010-07-2

0 Mon Apr 06 18:5 Open Twitter Page http://twitter.com @theefer 2010-07-219800 Thu Apr 30 18:09:Open Twitter Page http://twitter.com RT @amee 2010-07-2

Wed Jul 21 09:34:Open Twitter Page http://twitter.com 2010-07-2

32400 Thu Apr 01 02:40:Open Twitter Page http://twitter.com 2010-07-2-18000 Mon Jun 14 16:5 Open Twitter Page http://twitter.com Review On 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 362/475

32400 Sat Jan 30 20:40: Open Twitter Page http://twitter.com 2010-07-2-28800 Sat Jan 17 22:21: Open Twitter Page http://twitter.com Nation's T 2010-07-2-10800 Sun Jul 13 00:24: Open Twitter Page http://twitter.com Novo slog 2010-07-2

7200 Tue Jun 23 00:08:Open Twitter Page http://twitter.com Microsoft' 2010-07-2

3600 Sat Mar 07 14:52:Open Twitter Page http://twitter.com dowlive.co 2010-07-20 Tue Feb 24 15:36:Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 363/475

Sun Apr 04 13:19:Open Twitter Page http://twitter.com herramien 2010-07-2ews related to Busines Fri Jul 09 08:38:5Open Twitter Page http://twitter.com Microsoft 2010-07-2

-18000 Wed Sep 23 20:3 Open Twitter Page http://twitter.com New Micr 2010-07-20 Thu Jan 31 17:20:Open Twitter Page http://twitter.com New blog 2010-07-2

-18000 Tue Aug 05 15:45Open Twitter Page http://twitter.com New Micr 2010-07-23600 Sat Jan 23 15:15: Open Twitter Page http://twitter.com Microsoft 2010-07-2

-10800 Thu Jan 21 12:48:Open Twitter Page http://twitter.com Novas Log 2010-07-228800 Fri Jan 15 23:53:3Open Twitter Page http://twitter.com Dell - Save 2010-07-2-32400 Sat Nov 07 20:19:Open Twitter Page http://twitter.com New Micr 2010-07-2-18000 Tue Jul 28 17:35: Open Twitter Page http://twitter.com New Micr 2010-07-2-18000 Sun Aug 02 20:15Open Twitter Page http://twitter.com New Micr 2010-07-2

3600 Mon Sep 14 05:4 Open Twitter Page http://twitter.com RT @vleen 2010-07-20 Wed Feb 04 09:1 Open Twitter Page http://twitter.com Microsoft 2010-07-2

-25200 Tue Apr 06 01:04:Open Twitter Page http://twitter.com Ventas de 2010-07-20 Fri Apr 24 11:06: Open Twitter Page http://twitter.com @billieraw 2010-07-2

3600 Thu Jul 23 14:38:Open Twitter Page http://twitter.com Microsoft l 2010-07-2Thu Oct 22 03:02:Open Twitter Page http://twitter.com Windows 2010-07-2

32400 Sun May 09 15:0 Open Twitter Page http://twitter.com [2ch/PC 2010-07-2-18000 Fri Mar 12 13:30:Open Twitter Page http://twitter.com Microsoft, 2010-07-2Thu Jul 15 14:07:Open Twitter Page http://twitter.com RT @diari 2010-07-2

0 Wed Jul 08 14:18:Open Twitter Page http://twitter.com 4 Reasons 2010-07-23600 Sat Apr 03 16:25:Open Twitter Page http://twitter.com Microsoft 2010-07-23600 Mon Mar 29 16:3Open Twitter Page http://twitter.com Office 201 2010-07-23600 Tue Jul 06 11:11: Open Twitter Page http://twitter.com Office 201 2010-07-2

25200 Tue Jun 09 15:33:Open Twitter Page http://twitter.com @netinho 2010-07-23600 Fri Mar 19 18:26:Open Twitter Page http://twitter.com Office 201 2010-07-23600 Wed Jan 06 10:4 Open Twitter Page http://twitter.com Office 201 2010-07-23600 Mon Mar 10 14:1Open Twitter Page http://twitter.com Dutch Cow 2010-07-23600 Sun Mar 22 14:00Open Twitter Page http://twitter.com Office 201 2010-07-2

-28800 Sun May 10 02:5 Open Twitter Page http://twitter.com Microsoft' 2010-07-2-18000 Sat Jan 17 02:15: Open Twitter Page http://twitter.com I wonder h 2010-07-2-10800 Fri Sep 21 11:18: Open Twitter Page http://twitter.com Microsoft 2010-07-2-10800 Wed Apr 29 18:4 Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Tue Jun 16 18:49:Open Twitter Page http://twitter.com Het gaat h 2010-07-2-10800 Sun Feb 01 13:00:Open Twitter Page http://twitter.com RT @Paulo 2010-07-2

3600 Mon Jan 25 19:1 Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 364/475

28800 Mon Jun 01 07:0 Open Twitter Page http://twitter.com Open micr 2010-07-210800 Thu Aug 06 20:10Open Twitter Page http://twitter.com Microsoft 2010-07-232400 Mon May 24 21:3Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Thu Feb 18 10:23Open Twitter Page http://twitter.com @doobiem 2010-07-27200 Fri Jan 08 11:14:0Open Twitter Page http://twitter.com Microsoft 2010-07-2

19800 Fri Jan 01 13:27:1Open Twitter Page http://twitter.com New Micr 2010-07-2Sat Nov 28 02:40:Open Twitter Page http://twitter.com iWorks 2010-07-2

-28800 Sun Nov 29 12:28Open Twitter Page http://twitter.com RT @Tahu 2010-07-2

32400 Sun Apr 12 14:56:Open Twitter Page http://twitter.com PC Watc2010-07-2-18000 Mon May 28 03:3Open Twitter Page http://twitter.com 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 365/475

Mon Jul 19 10:20:Open Twitter Page http://twitter.com

#cremationWonderfu

lsummary#listening#microsof thttp://209.197.121.179/forum/profile.php?id=19279 2010-07-2

Sun Oct 25 10:29:Open Twitter Page http://twitter.com Anja Kruse 2010-07-232400 Thu Mar 26 13:1 Open Twitter Page http://twitter.com Microsoft 2010-07-2

3600 Wed Feb 17 16:2 Open Twitter Page http://twitter.com

BeWhat'sNext':NewMicrosoftslogan(and

branding?)http://blog.seattlepi.com/microsoft/archives/215449.asp 2010-07-2

3600 Sat Jan 17 15:45: Open Twitter Page http://twitter.com RT @gonn 2010-07-2-18000 Sun Apr 19 05:22:Open Twitter Page http://twitter.com MICROSOF2010-07-2-10800 Thu Apr 30 10:35:Open Twitter Page http://twitter.com Street Figh 2010-07-2

Open Twitter Page http://twitter.com Microsoft 2010-07-2-36000 Mon Oct 26 15:2 Open Twitter Page http://twitter.com @alphabe 2010-07-232400 Fri Oct 16 00:32: Open Twitter Page http://twitter.com 2010-07-2

Wed Mar 31 16:4 Open Twitter Page http://twitter.com Качайте б 2010-07-214400 Mon Apr 14 02:3 Open Twitter Page http://twitter.com EmiratesM 2010-07-2

Open Twitter Page http://twitter.com Nice to be 2010-07-23600 Thu Jun 04 11:40:Open Twitter Page http://twitter.com Microsoft i 2010-07-2

-21600 Fri Jul 24 19:05:2Open Twitter Page http://twitter.com Bada Bing, 2010-07-2-18000 Sat Jan 09 21:52: Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 366/475

3600 Thu Dec 31 16:42Open Twitter Page http://twitter.com OFFRE #E 2010-07-20 Wed Dec 02 13:3 Open Twitter Page http://twitter.com Reading: 4 2010-07-2

32400 Thu May 20 09:3 Open Twitter Page http://twitter.com

ws

USB

WebDAV

MicrosoftOffice

http://bit. 2010-07-2herent generosity Tue Jun 29 10:52: Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 367/475

32400 Thu Apr 08 09:33:Open Twitter Page http://twitter.com

[RSS]Microsoft

invitingMacusers to joinOffice2011betatestinggang:Microsoftis doingits bestto temptus...http://bit.ly/aLLIa6 2010-07-2

-28800 Tue Jun 15 02:32:Open Twitter Page http://twitter.com http://ww 2010-07-219800 Sat Oct 03 03:42:Open Twitter Page http://twitter.com Microsoft i 2010-07-2

-36000 Tue Nov 17 22:00Open Twitter Page http://twitter.com [Apple]9to 2010-07-27200 Thu Apr 29 08:31:Open Twitter Page http://twitter.com Microsoft 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 368/475

-18000 Thu Jan 29 05:47:Open Twitter Page http://twitter.com

MicrosoftinvitingMac

users to joinOffice2011betatestinggang:Microsoftis doingits bestto temptusersto...http://bit.ly/90NoaV 2010-07-2

7200 Sat Dec 26 22:14:Open Twitter Page http://twitter.com Sub of the 2010-07-27200 Mon Jun 30 19:4 Open Twitter Page http://twitter.com The Odds 2010-07-2

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 369/475

T11:47:54ZT12:23:00ZT12:22:18Z

T12:14:55ZT12:39:14ZT12:37:41ZT12:40:13ZT12:41:14ZT12:41:22ZT12:41:51ZT12:42:04ZT12:44:46ZT12:38:36ZT12:55:17ZT11:39:55ZT12:55:55ZT12:57:25Z

T13:03:21ZT13:00:10ZT12:59:19ZT13:07:06ZT12:57:37ZT13:13:07ZT12:20:10ZT13:13:21ZT12:50:57ZT11:39:40Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 370/475

T12:44:33ZT11:44:01ZT11:41:37ZT12:06:55ZT11:41:43ZT12:40:07Z

T11:41:43ZT12:06:51Z

T11:43:30ZT12:14:23ZT12:44:49Z

T11:44:12ZT13:09:39Z

T11:50:04Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 371/475

T13:12:30Z

T12:33:29ZT12:00:52ZT13:14:36Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 372/475

T12:34:43Z

T12:34:44ZT12:17:05ZT12:17:07ZT12:17:08ZT12:17:00ZT12:40:12ZT11:50:20ZT11:50:24Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 373/475

T11:54:02ZT12:10:55ZT11:51:23ZT12:19:52ZT11:52:02ZT12:53:30Z

T11:39:55Z

T13:12:34ZT12:30:54Z

T11:52:23ZT11:57:16ZT11:40:53ZT11:52:56Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 374/475

T11:55:23Z

T11:55:33ZT12:22:17ZT11:54:55ZT11:55:41ZT11:52:19ZT11:55:54ZT11:57:11ZT13:05:07ZT11:58:11ZT12:57:56ZT12:59:20ZT11:59:04ZT11:59:16ZT12:45:09ZT13:11:51Z

T11:59:46ZT11:59:49ZT12:00:08ZT12:03:05ZT11:46:17ZT12:15:13ZT12:01:31ZT13:00:45ZT12:28:50ZT11:59:00ZT12:20:16ZT12:03:05ZT12:03:08ZT12:03:35ZT12:57:50ZT12:04:00ZT12:02:25ZT12:03:18ZT11:44:59ZT12:04:04Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 375/475

T12:04:38ZT11:54:27ZT12:04:40ZT12:04:42Z

T12:12:23ZT13:01:22ZT12:40:30ZT12:43:44Z

T12:06:00ZT11:54:23ZT12:06:05ZT12:01:20ZT11:41:05ZT12:06:30ZT12:02:01ZT12:06:41ZT12:04:31Z

T12:07:34ZT12:08:18ZT13:04:57ZT12:09:07ZT11:40:12Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 376/475

T12:09:08ZT12:09:41ZT12:10:52ZT12:27:00ZT12:11:31ZT12:11:47ZT12:11:55ZT12:10:47ZT12:12:00Z

T12:12:01ZT12:34:40ZT12:22:39ZT13:14:08ZT12:12:09ZT12:12:24ZT11:45:53ZT11:55:16ZT12:43:17Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 377/475

T12:33:26ZT12:38:41ZT12:01:59Z

T12:34:55Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 378/475

T12:12:44ZT12:13:04ZT12:13:25ZT11:41:37ZT12:56:12ZT12:14:40ZT12:14:57Z

T12:07:01ZT12:15:08ZT13:00:10ZT12:17:46ZT12:17:48Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 379/475

T12:15:46ZT13:06:31ZT12:17:10ZT12:41:50ZT12:17:11ZT11:48:54Z

T13:01:32Z

T12:35:37Z

T12:19:18ZT11:41:28ZT12:11:55ZT12:19:39ZT12:58:46ZT12:04:01ZT12:19:46ZT12:15:29ZT12:21:17ZT12:47:15ZT12:21:57ZT12:22:19ZT12:25:59ZT11:57:57ZT12:22:32ZT11:39:43ZT12:49:43ZT12:22:50Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 380/475

T11:43:10ZT12:22:33ZT12:22:59ZT12:40:07ZT12:24:53ZT13:08:15ZT12:25:14ZT12:25:45ZT12:26:02ZT11:46:15Z

T12:26:04ZT12:26:06ZT12:26:27ZT11:51:13ZT12:11:30ZT12:21:31ZT12:26:33ZT12:50:04ZT11:43:25ZT11:45:49ZT12:26:37ZT13:10:17ZT12:26:37ZT12:34:39Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 381/475

T12:22:27ZT12:27:04ZT12:27:12ZT12:57:35Z

T12:27:14ZT13:10:56ZT12:40:46ZT12:27:15ZT12:27:17ZT12:27:25ZT12:27:25Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 382/475

T12:27:45ZT12:41:26ZT12:43:38ZT11:49:14ZT12:05:02ZT12:29:00ZT12:29:11ZT12:29:21ZT12:57:34ZT12:40:02Z

T12:29:52ZT12:23:42ZT12:30:21ZT12:03:36Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 383/475

T11:40:21ZT12:17:14ZT11:42:56ZT12:30:53ZT12:10:33ZT12:30:58ZT12:50:56ZT12:31:00Z

T12:26:13ZT12:18:50ZT12:42:14ZT12:31:00ZT12:23:43ZT12:22:34ZT12:31:08ZT12:31:10ZT12:31:15ZT12:26:02ZT12:06:39ZT12:31:20ZT11:49:42ZT11:43:46Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 384/475

T12:22:31ZT11:43:25ZT12:31:34ZT13:13:45ZT12:31:46ZT12:11:53ZT12:53:32ZT12:53:29ZT12:31:51Z

T12:32:31ZT12:54:48ZT11:49:55Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 385/475

T12:33:33Z

T12:33:34ZT11:47:58Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 386/475

T12:33:06ZT12:33:44ZT12:33:49ZT12:33:58Z

T12:34:19ZT12:34:26ZT11:50:58ZT12:34:31ZT12:14:57ZT11:51:22Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 387/475

T12:34:34ZT11:47:49ZT13:05:37ZT11:57:17Z

T12:34:45ZT12:59:36ZT11:46:01ZT12:35:06ZT12:35:11Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 388/475

T12:15:16Z

T12:35:30ZT11:40:20Z

T12:35:39Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 389/475

T12:33:43ZT12:35:41ZT12:58:50ZT12:35:42ZT12:55:44ZT12:47:52ZT11:54:09ZT12:35:42Z

T12:47:14ZT11:42:05ZT11:52:06ZT12:01:58Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 390/475

T12:34:31Z

T12:39:13ZT11:51:39ZT12:42:00ZT12:42:01ZT13:01:51ZT12:53:45ZT12:02:21ZT12:17:12Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 391/475

T12:02:01ZT13:10:29ZT12:30:49Z

T12:35:46Z

T12:34:36Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 392/475

T12:35:00ZT12:36:03Z

T12:34:30ZT13:03:07ZT12:36:03ZT12:36:03ZT13:08:52ZT12:36:36ZT12:36:37Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 393/475

T12:37:09ZT12:19:22ZT12:37:31ZT11:55:20ZT13:08:50Z

T12:37:44ZT12:29:36ZT12:37:51ZT12:37:54ZT12:41:07ZT12:38:12ZT12:38:19ZT12:38:24ZT12:38:45Z

T12:51:11Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 394/475

T12:38:46ZT12:39:04Z

T12:39:36ZT11:41:16Z

T11:40:19ZT12:40:02ZT12:40:07ZT12:27:14ZT11:58:38Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 395/475

T12:40:17ZT12:25:19ZT12:41:42ZT12:42:09ZT12:42:25ZT12:42:40Z

T12:40:03ZT12:42:41ZT12:42:51ZT12:53:53ZT12:42:56ZT12:43:11ZT12:31:52ZT11:51:07ZT12:40:24ZT12:43:41ZT12:44:19Z

T12:37:49ZT12:44:20Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 396/475

T12:22:39ZT12:18:23ZT13:07:14ZT12:56:55ZT11:59:28Z

T12:37:24Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 397/475

T12:49:34ZT11:48:52ZT12:35:59ZT12:44:40ZT12:45:00ZT12:45:02ZT12:45:07ZT12:24:05ZT12:45:23ZT12:46:10ZT12:46:12Z

T11:45:16ZT12:27:55ZT12:40:44ZT12:46:26ZT12:28:27ZT12:33:48ZT12:46:35ZT11:59:37ZT12:28:52ZT12:46:44ZT12:47:31ZT12:47:39ZT12:42:00ZT13:03:50ZT13:03:10Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 398/475

T12:48:14ZT11:55:58ZT13:11:31ZT12:47:42ZT12:47:43ZT12:12:08Z

T12:35:54Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 399/475

T12:34:33ZT12:48:05ZT13:05:53ZT12:56:20ZT12:48:15ZT12:48:24ZT12:49:09Z

T13:03:09ZT13:13:57ZT13:13:58ZT12:54:34ZT12:35:10ZT12:38:47ZT11:55:39ZT12:57:34ZT12:05:29ZT12:49:34Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 400/475

T12:49:33ZT12:34:25Z

T12:33:48ZT13:12:13ZT12:24:16ZT11:46:01Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 401/475

T12:15:10Z

T12:31:46ZT12:49:35ZT12:20:16ZT12:53:57ZT12:49:44Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 402/475

T13:11:18Z

T13:08:05ZT12:14:21ZT11:45:52ZT11:45:51ZT11:45:50ZT12:49:49ZT11:45:54Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 403/475

T12:03:28ZT12:52:07ZT13:00:26ZT12:49:53ZT12:47:58ZT12:49:10Z

T12:48:35ZT12:50:50ZT12:50:24ZT12:50:02ZT12:50:19Z

T12:33:57ZT12:50:44ZT12:50:26ZT12:52:04Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 404/475

T13:12:51ZT12:38:14ZT12:43:03ZT12:38:58ZT12:51:14ZT12:51:15ZT12:51:31ZT12:44:47ZT12:51:47ZT12:51:51ZT12:51:51ZT12:53:19ZT12:53:31ZT12:48:01Z

T12:53:46ZT12:53:51ZT13:08:41ZT12:35:26ZT12:50:09ZT12:18:04ZT12:18:16ZT12:52:02ZT12:18:08Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 405/475

T12:33:59ZT13:06:38ZT11:59:26ZT13:14:53Z

T11:45:18ZT12:31:54ZT12:55:03Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 406/475

T12:56:45ZT12:06:47ZT12:56:45Z

T12:55:05Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 407/475

T12:51:40ZT11:45:57ZT12:55:19ZT12:55:31Z

T11:41:08ZT12:56:21ZT12:56:35ZT12:57:00ZT12:48:32ZT12:57:07ZT12:57:23ZT12:58:01ZT12:58:36Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 408/475

T12:35:51ZT11:48:17ZT13:12:40ZT12:59:05ZT11:49:40ZT12:59:31ZT12:19:34ZT12:15:14Z

T12:52:14ZT11:50:34ZT11:49:07ZT12:59:37ZT13:00:04ZT13:12:05ZT13:10:04Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 409/475

T13:12:51ZT11:41:37ZT13:00:06ZT12:38:27ZT13:00:13ZT11:56:14Z

T13:00:21ZT13:13:11Z

T12:44:57ZT13:00:23ZT12:16:42ZT13:13:38ZT13:00:36ZT13:00:41ZT12:39:21ZT11:45:35ZT12:55:18ZT12:41:41ZT13:00:50ZT12:42:51ZT13:01:43ZT13:01:51ZT12:35:44ZT13:01:50ZT13:01:52ZT13:10:04ZT13:02:09ZT13:14:15Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 410/475

T13:02:25ZT13:02:32ZT12:34:14ZT13:08:49ZT13:02:37Z

T13:13:04ZT13:02:42ZT13:13:04ZT13:02:03ZT13:02:34ZT13:02:57ZT13:03:28Z

T12:48:58ZT11:44:05ZT13:03:51ZT13:04:10ZT13:05:09ZT13:05:11ZT12:45:01ZT13:05:21ZT13:05:35Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 411/475

T12:18:48ZT12:31:24ZT13:05:37Z

T13:10:48ZT13:05:52ZT13:05:55ZT13:06:26ZT11:45:39ZT13:06:07Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 412/475

T12:13:47ZT13:06:18ZT13:06:29ZT13:14:49ZT12:40:34ZT13:06:40Z

T13:07:29ZT13:07:35ZT13:07:49ZT13:00:36ZT12:34:25ZT13:08:13ZT13:08:32ZT13:08:55ZT13:09:06ZT13:09:12ZT13:09:15ZT13:09:21ZT13:10:04ZT13:10:04ZT13:10:04ZT13:10:04ZT13:10:04ZT13:10:04ZT13:10:16Z

T13:10:25ZT13:10:22ZT12:41:04ZT13:09:37ZT13:11:04ZT13:11:27ZT13:11:31ZT13:11:29ZT13:11:31ZT13:02:20ZT13:11:51Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 413/475

T13:12:15ZT13:10:00ZT13:12:16ZT12:20:44ZT13:12:51ZT13:11:09Z

T12:31:10ZT13:13:11ZT13:13:11ZT13:13:04ZT12:17:10ZT13:13:32ZT13:13:42Z

T13:08:17Z

T13:14:17Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 414/475

T13:14:27ZT12:54:45ZT13:14:29ZT13:14:42Z

T13:14:04Z

T13:13:54ZT13:13:51ZT13:13:49ZT13:13:37ZT13:13:36ZT13:13:29ZT13:13:28ZT13:13:24ZT13:13:20ZT13:12:34ZT13:12:29ZT13:12:10ZT13:11:58ZT13:11:58Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 415/475

T13:11:55ZT13:11:52ZT13:11:51ZT13:11:49ZT13:11:39ZT13:11:32ZT13:11:24Z

T13:11:14ZT13:11:10ZT13:11:07Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 416/475

T13:11:01ZT13:11:01ZT13:10:36ZT13:10:35ZT13:10:31ZT13:10:24ZT13:10:14Z

T13:10:09ZT13:10:08Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 417/475

T13:10:05ZT13:10:03ZT13:10:01ZT13:09:54ZT13:09:54ZT13:09:53ZT13:09:52ZT13:09:50ZT13:09:38ZT13:08:55ZT13:08:54ZT13:08:46ZT13:08:41ZT13:08:37Z

T13:08:29ZT13:08:24ZT13:08:17ZT13:08:17ZT13:08:08ZT13:08:08ZT13:08:07ZT13:08:03ZT13:07:51ZT13:07:45ZT13:07:29ZT13:07:01ZT13:06:40ZT13:06:31ZT13:05:54ZT13:05:54ZT13:05:52ZT13:05:51ZT13:05:51ZT13:05:49Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 418/475

T13:05:48ZT13:05:47ZT13:05:47ZT13:05:34ZT13:05:19ZT13:05:14Z

T13:05:08ZT13:05:04ZT13:04:57ZT13:04:18ZT13:03:58ZT13:03:55ZT13:03:52ZT13:03:51ZT13:03:41Z

T13:03:36Z

T13:03:23Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 419/475

T13:03:15ZT13:03:10Z

T13:02:52ZT13:02:16ZT13:02:14ZT13:02:13ZT13:02:09ZT13:02:05ZT13:01:58ZT13:01:58ZT13:01:49ZT13:01:34ZT13:00:59ZT13:00:58ZT13:00:38ZT13:00:37ZT13:00:25Z

T13:00:21ZT12:59:57ZT12:59:56Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 420/475

T12:59:53ZT12:59:51ZT12:59:51Z

T12:59:45ZT12:59:42ZT12:59:39ZT12:59:39ZT12:59:38ZT12:59:35ZT12:59:33ZT12:59:32ZT12:59:30ZT12:59:28ZT12:59:24ZT12:58:45ZT12:58:26Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 421/475

T12:58:14ZT12:58:04ZT12:57:56ZT12:57:51ZT12:57:50ZT12:57:50ZT12:57:45ZT12:57:41ZT12:57:38ZT12:57:38ZT12:57:21ZT12:57:15ZT12:56:59ZT12:56:57ZT12:56:50ZT12:56:31ZT12:56:27ZT12:56:26ZT12:56:04ZT12:56:02ZT12:55:35Z

T12:55:28ZT12:55:08Z

T12:55:07ZT12:55:03ZT12:55:01ZT12:54:59ZT12:54:41ZT12:54:37Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 422/475

T12:54:34ZT12:54:33ZT12:54:29ZT12:54:27ZT12:54:24ZT12:54:23Z

T12:53:53ZT12:53:49ZT12:53:41ZT12:53:40ZT12:53:28ZT12:52:54Z

T12:52:54ZT12:52:53ZT12:52:44ZT12:52:28ZT12:52:27ZT12:52:04ZT12:52:00ZT12:51:50ZT12:51:35Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 423/475

T12:51:13ZT12:51:01ZT12:50:58ZT12:50:53ZT12:50:40ZT12:50:37Z

T12:50:08ZT12:50:04ZT12:50:02ZT12:50:00Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 424/475

T12:49:54ZT12:49:53ZT12:49:52ZT12:49:39ZT12:49:34ZT12:49:09Z

T12:49:01ZT12:48:57ZT12:48:56Z

T12:48:44Z

T12:48:39Z

T12:48:36ZT12:48:34Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 425/475

T12:48:32ZT12:48:00ZT12:47:46ZT12:47:45ZT12:47:45ZT12:47:44Z

T12:47:25ZT12:47:24ZT12:47:23ZT12:47:15ZT12:47:15ZT12:47:09ZT12:47:05ZT12:46:28ZT12:46:10ZT12:45:45ZT12:45:43ZT12:45:40ZT12:45:33ZT12:45:33ZT12:45:10ZT12:44:57ZT12:44:50Z

T12:44:50ZT12:44:39ZT12:44:22ZT12:44:21ZT12:43:38ZT12:43:37ZT12:43:37ZT12:43:11Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 426/475

T12:43:05Z

T12:43:04ZT12:42:52ZT12:42:42ZT12:42:35Z

T12:41:56ZT12:41:19Z

T12:41:09ZT12:41:03Z

T12:40:51ZT12:40:48ZT12:40:42ZT12:40:35ZT12:40:31Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 427/475

T12:40:13ZT12:40:10ZT12:40:09Z

T12:39:50ZT12:39:48ZT12:39:01ZT12:38:52ZT12:38:49Z

T12:38:46Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 428/475

T12:38:37ZT12:38:36ZT12:38:30ZT12:38:28ZT12:38:06ZT12:37:55Z

T12:37:27ZT12:37:20ZT12:37:07ZT12:36:57ZT12:36:56Z

T12:36:43ZT12:36:34Z

T12:36:30ZT12:36:18ZT12:36:08Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 429/475

T12:36:07Z

T12:35:58Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 430/475

T12:35:57Z

T12:35:51Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 431/475

T12:35:50Z

T12:35:49Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 432/475

T12:35:49Z

T12:35:49Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 433/475

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 434/475

T12:35:49Z

T12:35:48Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 435/475

T12:35:47Z

T12:35:47Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 436/475

T12:35:47Z

T12:35:44Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 437/475

T12:35:42Z

T12:35:42Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 438/475

T12:35:41Z

T12:35:41Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 439/475

T12:35:39ZT12:35:30ZT12:35:26ZT12:35:20Z

T12:35:09Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 440/475

T12:35:08Z

T12:35:06Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 441/475

T12:34:59Z

T12:34:50Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 442/475

T12:34:42Z

T12:34:41ZT12:34:39Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 443/475

T12:34:36ZT12:34:34Z

T12:34:26Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 444/475

T12:34:26Z

T12:34:19Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 445/475

T12:34:08Z

T12:34:02ZT12:34:00ZT12:33:55Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 446/475

T12:33:55ZT12:33:39Z

T12:33:36ZT12:33:32Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 447/475

T12:33:23Z

T12:32:59ZT12:32:56ZT12:32:51ZT12:32:48ZT12:32:38ZT12:31:58ZT12:31:57ZT12:31:52ZT12:31:50ZT12:31:45ZT12:31:43ZT12:31:33ZT12:31:33ZT12:31:13ZT12:31:08ZT12:31:04ZT12:30:57ZT12:30:54ZT12:30:43Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 448/475

T12:30:29ZT12:30:10ZT12:29:57ZT12:29:42ZT12:29:37ZT12:29:23Z

T12:29:22Z

T12:28:42ZT12:28:41ZT12:28:34ZT12:28:23ZT12:28:19Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 449/475

T12:28:19ZT12:28:13Z

T12:28:01ZT12:27:58ZT12:27:19ZT12:27:19ZT12:27:16ZT12:27:14ZT12:27:08Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 450/475

T12:27:08ZT12:26:42ZT12:26:39ZT12:26:28ZT12:26:27ZT12:26:15Z

T12:26:07ZT12:25:46ZT12:25:38ZT12:25:37Z

T12:25:33Z

T12:25:32Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 451/475

T12:25:23ZT12:25:07ZT12:24:58ZT12:24:57Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 452/475

T12:24:43Z

T12:24:38ZT12:24:35ZT12:24:34ZT12:24:24ZT12:24:15ZT12:24:13ZT12:24:03ZT12:24:01ZT12:23:59ZT12:23:53ZT12:23:42ZT12:23:27ZT12:23:24Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 453/475

T12:23:10ZT12:23:08ZT12:22:36Z

T12:22:36Z

T12:22:31Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 454/475

T12:22:27ZT12:21:59ZT12:21:54ZT12:21:21ZT12:21:21ZT12:20:44ZT12:20:28Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 455/475

T12:20:02Z

T12:19:33ZT12:19:32ZT12:19:31ZT12:19:29ZT12:19:23ZT12:19:02ZT12:18:50ZT12:18:33ZT12:17:46ZT12:17:45ZT12:17:41ZT12:17:36ZT12:17:21ZT12:17:15ZT12:17:01ZT12:16:40ZT12:16:21ZT12:16:16Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 456/475

T12:16:08ZT12:16:08ZT12:16:03ZT12:15:59ZT12:15:58Z

T12:15:57Z

T12:15:42ZT12:15:30ZT12:15:29ZT12:15:28ZT12:15:09Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 457/475

T12:14:39ZT12:14:08Z

T12:14:04ZT12:13:59ZT12:13:56ZT12:13:46ZT12:13:05ZT12:12:31ZT12:12:25Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 458/475

T12:12:14ZT12:12:13ZT12:12:08ZT12:12:08ZT12:12:07Z

T12:11:51Z

T12:11:14ZT12:11:02ZT12:11:00ZT12:10:57ZT12:09:05ZT12:09:01ZT12:08:50ZT12:08:42ZT12:08:40ZT12:08:29ZT12:08:28ZT12:08:16ZT12:07:11ZT12:06:56ZT12:06:40ZT12:06:38ZT12:06:28ZT12:06:23ZT12:06:08ZT12:05:23Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 459/475

T12:05:06ZT12:05:02ZT12:05:01ZT12:04:28ZT12:04:15Z

T12:04:13ZT12:03:50Z

T12:03:44ZT12:03:43ZT12:03:30ZT12:03:20ZT12:03:13ZT12:02:40ZT12:02:33ZT12:02:26ZT12:02:25ZT12:02:19ZT12:02:00ZT12:02:00ZT12:01:28ZT12:00:51ZT12:00:51ZT12:00:25Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 460/475

T12:00:07ZT11:59:58ZT11:59:58Z

T11:59:01ZT11:58:34ZT11:57:11ZT11:57:08ZT11:57:08ZT11:57:06ZT11:56:59ZT11:56:29Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 461/475

T11:55:40ZT11:55:16ZT11:55:05ZT11:55:03ZT11:54:58ZT11:54:46Z

T11:54:38ZT11:54:26ZT11:54:10ZT11:54:03ZT11:54:02ZT11:53:48ZT11:53:34ZT11:53:24ZT11:53:24Z

T11:53:05ZT11:52:56Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 462/475

T11:52:51ZT11:52:51ZT11:52:50Z

T11:52:45Z

T11:52:37ZT11:52:09Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 463/475

T11:52:09ZT11:52:08ZT11:51:57ZT11:51:31ZT11:51:30ZT11:51:18Z

T11:51:16ZT11:51:04ZT11:50:58ZT11:50:52ZT11:50:51Z

T11:50:39ZT11:50:32ZT11:50:27ZT11:50:25ZT11:50:22ZT11:50:13Z

T11:50:08ZT11:49:51ZT11:49:47ZT11:49:05ZT11:49:03ZT11:48:59ZT11:48:58ZT11:48:56ZT11:48:55ZT11:48:54ZT11:48:53ZT11:48:52ZT11:48:48ZT11:48:33ZT11:48:13ZT11:48:01ZT11:47:52ZT11:47:36ZT11:47:30Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 464/475

T11:47:07ZT11:46:38ZT11:46:37ZT11:46:10ZT11:46:02ZT11:46:00ZT11:45:43ZT11:45:36Z

T11:45:34ZT11:45:09Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 465/475

T11:45:08ZT11:44:25ZT11:44:19Z

T11:44:17ZT11:44:03ZT11:43:43ZT11:43:33ZT11:43:25ZT11:43:10ZT11:42:52ZT11:42:42ZT11:42:40ZT11:42:27ZT11:42:15ZT11:42:03ZT11:41:40Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 466/475

T11:41:38ZT11:41:18Z

T11:41:13ZT11:40:56Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 467/475

T11:40:50ZT11:40:35ZT11:40:24ZT11:40:22ZT11:40:19Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 468/475

T11:40:19ZT11:40:05ZT11:40:03Z

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 469/475

Cluster Vertex Color Vertex Shape

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 470/475

Cluster Vertex

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 471/475

Metric Value

Minimum Degree Not AvailableMaximum Degree Not AvailableAverage Degree Not AvailableMedian Degree Not Available

0

0.5

1

F r e q u e n c y

Degree

0

0.5

1

F r e q u e n c y

In-Degree

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 472/475

Minimum In-Degree Not AvailableMaximum In-Degree Not AvailableAverage In-Degree Not AvailableMedian In-Degree Not Available

Minimum Out-Degree Not AvailableMaximum Out-Degree Not AvailableAverage Out-Degree Not AvailableMedian Out-Degree Not Available

Minimum Betweenness Centrality Not AvailableMaximum Betweenness Centrality Not AvailableAverage Betweenness Centrality Not AvailableMedian Betweenness Centrality Not Available

Minimum Closeness Centrality Not AvailableMaximum Closeness Centrality Not AvailableAverage Closeness Centrality Not AvailableMedian Closeness Centrality Not Available

0

0.5

1

F r e q u e n c y

Out-Degree

0

0.5

1

F r e q u e n c y

Betweenness Centrality

0

0.5

1

F r e

q u e n c y

Closeness Centrality

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 473/475

Minimum Eigenvector Centrality Not AvailableMaximum Eigenvector Centrality Not AvailableAverage Eigenvector Centrality Not AvailableMedian Eigenvector Centrality Not Available

Minimum PageRank Not AvailableMaximum PageRank Not AvailableAverage PageRank Not AvailableMedian PageRank Not Available

Minimum Clustering Coefficient Not AvailableMaximum Clustering Coefficient Not AvailableAverage Clustering Coefficient Not AvailableMedian Clustering Coefficient Not Available

0

0.5

1

F r e q u e n c y

Eigenvector Centrality

0

0.5

1

F r e q u e n c y

Clustering Coefficient

0

0.5

1

F r e q u e n c y

PageRank

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 474/475

Comments

8/13/2019 Collection - Twitter - Microsoft

http://slidepdf.com/reader/full/collection-twitter-microsoft 475/475