multiple roles for the twin arginine leader sequence of dimethyl
TRANSCRIPT
![Page 1: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/1.jpg)
Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl Sulfoxide
Reductase of Escherichia coli
Damaraju Sambasivarao, Raymond J. Turner1, Joanne L. Simala-Grant2, Gillian
Shaw, Jing Hu, and Joel H. Weiner #
MRC Group in Molecular Biology of Membrane Proteins, Department of
Biochemistry, University of Alberta, Edmonton, Alberta, Canada T6G 2H7
1Present address: Structural Biology Group, Department of Biological Sciences,
University of Calgary, Calgary, Alberta, Canada, T2N 1N4
2 Present address: Dept. of Medical Microbiology and Immunology, University of
Alberta, Edmonton, Alberta, Canada T6G 2H7
Running Title: Twin Arginine Leader of DMSO Reductase
# Author to whom correspondence should be addressed
Phone: 780-492-2761; Fax: 780-492-0886
email: [email protected]
Copyright 2000 by The American Society for Biochemistry and Molecular Biology, Inc.
JBC Papers in Press. Published on May 8, 2000 as Manuscript M909289199 by guest on February 11, 2018
http://ww
w.jbc.org/
Dow
nloaded from
![Page 2: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/2.jpg)
2
Summary
Dimethyl Sulfoxide (DMSO) Reductase of Escherichia coli is a terminal electron
transport chain enzyme that is expressed under anaerobic growth conditions and
is required for anaerobic growth with DMSO as the terminal electron acceptor.
The trimeric enzyme is composed of a membrane extrinsic catalytic dimer
(DmsAB), and a membrane intrinsic anchor (DmsC). The amino terminus of
DmsA has a leader sequence with a twin arginine motif that targets DmsAB to
the membrane via a novel Sec-independent mechanism termed MTT for
Membrane Targeting and Translocation. We demonstrate that the Met1 present
upstream of the twin arginine motif serves as the correct translational start site.
The leader is essential for the expression of DmsA, stability of the DmsAB dimer
as well as membrane targeting of the reductase holoenzyme. Mutation of
arginine17 to aspartate abolished membrane targeting. The reductase was labile
in the leader sequence mutants. These mutants failed to support growth on
glycerol-DMSO minimal medium. Replacing the DmsA leader with the TorA
leader of trimethylamine N-oxide reductase produced a membrane-bound
DmsABC with greatly reduced enzyme activity and inefficient anaerobic
respiration indicating that the twin arginine leaders may play specific roles in the
assembly of redox enzymes.
Introduction
Recently, we and others have reported the discovery of a novel system which
targets and translocates folded, cofactor-containing proteins to and across the
cytoplasmic membrane of bacteria (1-4). A similar system was previously
identified in chloroplasts and some mitochondria (5). This system, named MTT
(for Membrane Targeting and Translocation) or TAT (for Twin Arginine
Translocation) recognizes an amino-terminal leader sequence that is distinct from
the one recognized by the well-characterized Sec system (1-4). The MTT leader
sequence is typically 30-60 amino acids long, contains a conserved twin arginine
motif (S/T R R X F X/L K), and has been found to be associated with a large
number of periplasmic redox proteins(6,7). Although the role of this signal
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 3: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/3.jpg)
3
sequence in protein export was originally proposed for the periplasmic
hydrogenase of Desulfovibrio vulgaris (8), understanding of this unique leader had
to await the discovery of the MTT genes.
One of the twin Arg leader proteins identified in a database search was the
catalytic subunit of DMSO reductase(6). This enzyme is a heterotrimer,
composed of a molybdenum molybdopterin guanine dinucleotide containing
catalytic subunit (DmsA, 85.8 kD), an iron sulfur subunit (DmsB, 23.1 kD) and a
membrane intrinsic subunit (DmsC, 30.8 kD) (9,10). The DmsAB subunits
function as a catalytic dimer while DmsC is the membrane anchor subunit and
binds menaquinone (11). It was argued by Berks that DmsA together with DmsB
could be targeted for export via the MTT export pathway (6). However, extensive
biochemical, immunological, electron microscopic and electron paramagnetic
resonance studies have been carried out on the topological organization of the
DMSO reductase (12,13). The two membrane extrinsic subunits, DmsAB were
shown to face the cytoplasmic side of the membrane, contrary to the periplasmic
localization of most other twin Arg leader containing proteins.
The twin Arg motif of DmsA was not recognized in the initial cloning and
sequencing of the dms operon (9). N-terminal analysis of the purified DmsA
subunit, revealed that the mature, purified protein began with the sequence Val-
Asp-Ser… (Fig. 1) and the first upstream Met (16 residues upstream, M30 in Fig.
1) was proposed as the initiating Met (9). However, it now appears that DmsA
may actually initiate at a Met, 46 residues upstream of the V46 (Fig. 1). This 45
amino acid leader encodes a twin Arg motif and has Ala-His-Ala immediately
upstream of the cleavage site, in accord with other proteins containing this type
of leader (6,14).
The electron transfer properties of the DMSO reductase in E. coli are well
documented (15,16). However, very little is known about the role of the leader
peptide. In the present study, we confirm that DmsA does indeed initiate at the
more upstream Met (which we have now designated as M1, Fig. 1) We also
examined the influence of the DmsA leader sequence on the assembly and
stability of the enzyme, together with the membrane targeting functions.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 4: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/4.jpg)
4
Experimental Procedures
Materials. Oligonucleotides were purchased from the DNA core facility,
Department of Biochemistry, University of Alberta, Edmonton, Canada or
GIBCO BRL, Canada. All molecular biology reagents were purchased from Life
Technologies Inc. The Sculptor in vitro mutagenesis kit was obtained from
Amersham Corp. ECL western blotting detection reagents were purchased from
Amersham Life Sciences. All other reagents were of analytical grade.
Bacterial Strains and plasmids. The following bacterial strains were used from our
laboratory collection. TG1 (∆(lac-pro) supE thi hsdD5/F’ traD36 proAB lacIq lacZ
DM15); DSS301 (as TG1; Kmr ∆dmsABC) and K38 (HfrC, λ−). The plasmids
carrying mutations in the DmsA leader sequence were generated using the
Sculptor site directed mutagenesis kit (15). The following primers were used to
construct the plasmids containing the native anaerobic promoter: pDMSM1 Stop
(GTGAGCCATTtaaAAAACGAAAATCC), pDMSR17D (GGTGAGTCGCgaT
GGTT TGGTAAAAAC) pDMSA43N:A 45N (TTAGTCGGATTaatCACaaTGTC
GATAGCG) and pDMSA43N (TTAGTCGGATTaatCACAATGTCGATAGCG).
The mutated residues were indicated in lower case. Plasmid pDMS160 (derived
from pBR322 vector) served as the template DNA. The wild-type and mutant dms
plasmids under the control of the T7 promoter were constructed as described
earlier (17-19). Briefly, the DNA fragments carrying the dms operon (EcoRI/Sal I
digest) from pDMS160, pDMSR17D and pDMSM1 Stop were cloned in to
pTZ18R as EcoRI/Sal I inserts to yield the T7 promoter constructs pDMS223,
pT7R17D and pT7M1 Stop, respectively. E. coli strain K38 carrying the plasmid
pGP1-2 (20) was transformed with the T7 promoter driven dms constructs to
study the expression of Dms polypeptides. Molecular biological procedures such
as restriction enzyme digestion, gel elution of DNA, ligation, filling in the
recessed ends of DNA after restriction digestion and transformation of DNA into
bacterial strains were carried out as described (21).
Plasmid pTDMS10, has a deletion of the dms leader sequence up to and including
the putative cleavage site at position 45 of the leader (Fig 1). This corresponds to
a 133 base pair (bp) deletion (nucleotide 808 to 940 of the dms operon map (9,18)),
and was constructed using the polymerase chain reaction (PCR). Two PCR
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 5: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/5.jpg)
5
products (A, 868bp and B, 640 bp ) were generated using the plasmid pDMS160
as the template and the primer pairs, BR322-R1 (CACGAGGCCCTTTCG) /
TDMS3 (cccggggctagccagctgtctagacatatgccccatggATAATGGCTCACTCAAGC)
for product A and TDMS2 (ccatggggcatatgtctagacagctggctagccccggg
GTCGATAGCGCCATTCC)/ TDMS1 (CGCGTTTCGCCAGGG) for product B,
respectively. The primer pairs TDMS3/TDMS2 encompass a 38 bp
complimentary overhang (shown in lower case) coding for the multicloning site:
NcoI, NdeI, XbaI, PvuII, NheI, SmaI. Except for PvuII, all other sites are unique.
Introduction of the multicloning site codes for the following amino acid sequence
and includes the initiating methionine: MGHMSRQLASPG. Following these 11
engineered amino acids is V46 of the mature protein (Fig 1).
PCR products A and B were gel purified, mixed and subjected to a second round
of PCR using primers BR322-R1 and TDMS1. The resulting composite PCR
product (1471 bp) has the multicloning site replacing the leader sequence. The
DNA fragment was gel purified and subjected to EcoRI and EcoRV restriction
digestion to yield a 1394 bp fragment. This DNA now lacking the entire leader
was used to replace the native DNA sequence between the nucleotide positions 1
and 1491 of the plasmid pDMS160, at the EcoRI and EcoRV restriction sites
respectively, to generate pTDMS10 (Fig 1). Plasmids pDMS160 and pTDMS10
harbor the native anaerobic promoter and the rest of the dms operon.
Construction of plasmids carrying the dms genes under control of the lac promoter.
Plasmid pTDMS10 was digested with NcoI and EcoRI and the fragments were
separated on a 1% agarose gel in a TAE buffer system. The larger fragment (7762
bp) containing the entire dms operon (less the leader) was gel eluted. The smaller
NcoI/EcoRI fragment (805 bp) containing the native anaerobic promoter was
discarded. The 205 bp fragment containing the lac promoter was obtained by a
PCR reaction using the DS-18 (atatgaattcGAATTAATTCTCACTCATTAGG)/DS-
19 (CTAGAAGAAGCTTGGGATC) primer pair and pYZ4 DNA (pBR322 derived
vector) as a template (22). The PCR product was digested with EcoRI and NcoI
and ligated to the gel eluted 7762 bp fragment, to generate pDMS189.
Plasmid pDMS190 and pDMS191 were derived from pDMS189 and harbor the
DmsA and TorA leader sequences, respectively, upstream of mature DmsA. The
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 6: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/6.jpg)
6
DNA sequence for the dms and torA leaders were obtained by PCR, using the
primers DS-11 (atatccatggtgAAAACGAAAATCCCTGATG)/DS-12(atggatcca
gctgGACAGCGTGCGCAATCCG) and SL-S2 (atatccatggtgAACAATAACG
ATCTCTTTC)/SL-A2(atggatcccagctgCGAGATGACAGCGTCAGT),
respectively. The plasmid pDMS160 served as a template DNA for DS-11/DS-12
PCR reaction and chromosomal DNA was used as a template for amplifying the
torA leader. The PCR DNA products have NcoI/PvuII flanking ends and were
cloned in to NcoI/SmaI cut pDMS189 to generate plasmids pDMS190 and
pDMS191.
All constructs were verified by restriction digestion analysis of the mini DNA
preparations and DNA sequencing reactions to confirm the mutations or
deletions in the dms operon.
Media and Growth Conditions. Aerobic overnight bacterial cultures were grown at
370C unless indicated otherwise, in Luria-Bertani (LB) medium supplemented
with the required antibiotics (11). A 1% innoculum was used from these
overnight cultures for all experiments, unless indicated otherwise. Anaerobic
growth experiments in glycerol minimal media were carried out in 160 ml screw
capped conical flasks with a Klett tube attachment (Klett flasks) for direct
monitoring of the bacterial growth as a function of time. The minimal medium
was supplemented with casamino acids, vitamin B1, terminal electron acceptor,
ammonium molybdate and antibiotics, as described (11). DMSO served as the
terminal electron acceptor for the growth experiments in Klett flasks.
For the measurement of DMSO reductase activity, the cells were grown
anaerobically in 1000 ml conical flasks at 370C for 48 hours on glycerol-fumarate
minimal medium (G-F medium); for 24 hours in peptone–fumarate medium or
for 8 hours in Terrific broth (TB) medium (21). DMSO reductase was expressed
constitutively under the above anaerobic growth conditions. Cells were
harvested and treated as described earlier for the preparation of the membrane
and supernatant (periplasm plus cytoplasm) fractions (11).
Gel electrophoresis and western blotting. Proteins were fractionated on a
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 7: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/7.jpg)
7
7.5 % or a 12% resolving polyacrylamide gel using a Bio-Rad mini slab gel
apparatus with sodium dodecyl sulfate (SDS) buffer system (23). Proteins from
SDS-PAGE gels were transferred to nitro-cellulose filters and probed with the
anti-DmsA and anti-DmsB antibodies as described (11). Western blot analysis of
whole cells was performed essentially as above, except the cell pellets were
directly lysed in the SDS-solubilization buffer and heated in a boiling water bath
for 2 minutes before loading on SDS-PAGE gels.
T7 expression studies. Strain K38/pGP1-2 carrying pDMS223 encoding dmsABC or
various mutants was grown overnight in LB medium at 300C. A 5% innoculum of
this culture was transferred into fresh LB medium (6.0 ml), grown for 2 hours,
and a 1.0 ml aliquot was drawn for the zero time sample. To the remaining 5.0 ml
of bacterial culture, was added fresh LB medium (5.0 ml) at 540C, to facilitate
rapid temperature equilibration of the culture to 420C. The incubation was
continued for another 15 minutes in a water bath set at 420C to induce T7 RNA
polymerase. Rifampicin (at 250 µg/ml of culture) an inhibitor of chromosomally
encoded RNA polymerase, was added and the incubation was continued at 420C
for 15 min. All subsequent incubations were at 370C (20). Aliquots (1.0 ml) were
drawn at various time points, spun in an Eppendorf centrifuge, and the bacterial
pellets resuspended in 50 µL of the SDS-solubilization buffer. The solubilized
pellets were heated in a boiling water bath for 2 minutes; spun to separate the
insoluble material and a 5 µL aliquot of the clear supernatant was loaded per
lane on a SDS-PAGE gel.
Enzyme Assays. DmsAB dimer enzyme assays were carried out by following the
substrate (TMAO) dependent oxidation of reduced benzyl viologen (BV) (11,24).
DmsABC holoenzyme assays were carried out by monitoring the oxidation of the
menaquinol analogue, lapachol as described earlier (25).
Analytical Techniques. DNA sequencing was carried out using an Applied
Biosystems model 373A DNA sequencer at the DNA core facility in the
Department of Biochemistry, University of Alberta, Edmonton, Canada.
All the data reported here are the result of at least two independent experiments
and the results from a representative experiment is presented.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 8: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/8.jpg)
8
Results
Investigation of the translational start site of the DmsA leader sequence and its role on
the expression of the DmsAB polypeptides. When the dmsABC sequence was
reported (9,10), we proposed that DmsA initiated at a Met, 16 residues upstream
of a Val, the first amino acid of the purified DmsA subunit (M30 in Fig. 1).
Subsequent bioinformatic analysis of the dms sequence by Berks (6) suggested
that DmsA actually initiated at a Met which is 45 residues upstream of the Val
(M1, Fig. 1) and contained a consensus twin Arginine motif. To determine if M1
was the initiating Met, we mutated this start codon to the stop codon TAA, and
expressed the construct (pT7M1 Stop) using a T7 promoter system. Following
expression, the proteins were probed by western blotting with anti-DmsA and
anti-DmsB antibodies. As shown in Fig 2, vector pTZ18R did not express
DmsAB, whereas pDMS223 (wild-type dmsABC) showed good expression of the
DmsAB subunits. The DmsAB polypeptides were observed as early as 30 min
and peaked at 2 hours. The expression from the pT7M1 Stop plasmid showed
that the intensity of the DmsA polypeptide was drastically reduced with limited
expression at 30 and 60 min followed by rapid degradation. Expression of the
DmsB polypeptide was relatively unaffected, even up to 21 hours. These results
indicated that DmsA had a long 45 amino acid leader which contained a
consensus twin Arginine motif, and that an internal Met30 could not serve as an
efficient initiating Met (Fig. 1). Under these experimental conditions, DmsB could
not protect the truncated form of DmsA originating at the putative second
initiating Met30 in the pT7M1 Stop (Fig 1) from degradation.
Role of the conserved arginine in the DmsA leader sequence. The two arginines of the
twin Arg consensus sequence has been shown to be highly conserved within the
family of polypeptides exhibiting the motif (Fig. 1, R16 and R17). These residues
have been shown to be important for the expression and or the function of the
polypeptides that rely on the MTT system for protein targeting and transport
(14,26,27). We mutated Arg17 in the DmsA leader to an Asp (R17D) and
examined the effect on the expression and stability of DmsA in the T7 system as
described above (Fig. 2). Western blot analysis revealed that DmsAB were
expressed to levels comparable to the wild-type and the amount of DmsA was
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 9: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/9.jpg)
9
only slightly reduced at 21 hrs. compared to the wild-type (Fig 2; pT7R17D).
These results indicate that the R17D mutation has no adverse affects on the
expression or stability of the DmsAB polypeptides under the conditions of the T7
expression and analysis of the whole cell lysates by western blotting. The
expression of the DmsC polypeptide could not be analysed in these experiments
due to the lack of the corresponding antibody (12).
The DmsA leader sequence is essential for anaerobic growth on DMSO. Anaerobic
growth with glycerol as carbon and energy source and DMSO as the terminal
electron acceptor (G-D medium) provides a simple means of monitoring the
physiological function of DmsABC (11). E. coli DSS301, deleted for the
chromosomal dms operon is unable to support growth on G-D medium (11). The
wild-type plasmid, pDMS160 carrying the entire dms operon restored the
anaerobic growth of this strain (Fig. 3A). As expected, pDMSM1 Stop could not
complement growth. Similarly, the construct lacking the entire leader
(pTDMS10) could not complement growth. Although pDMSR17D produced the
DmsAB (Fig. 2, and presumably the DmsC) polypeptides, this construct was
unable to complement growth of DSS301. A mutant at the putative cleavage site
in which alanine 43 was changed to aspargine (pDMSA43N) and a double
mutant in which both the alanines at 43 and 45 were changed to aspargine
(pDMSA43N:A45N) showed normal growth profiles (Fig. 1 and Fig. 3A).
We investigated replacement of the dms leader with the TorA leader of inducible
TMAO reductase. We used lac promoter constructs, pDMS189, pDMS190 and
pDMS191 to facilitate the interpretation of the leader substitution (or deletions)
while keeping the promoter background constant. The TorA leader has a twin
Arg motif and translocation of TMAO reductase to the periplasm is dependent
on the MTT system (2,3). Plasmid, pDMS191 with a torA leader in place of the
dmsA leader showed poor growth (Fig. 3B). These studies indicate that an intact
dmsA leader was essential for the production of functional enzyme. Examination
of the control lac promoter constructs (Fig. 3B) indicated that pDMS189, lacking a
dmsA leader, could not support growth, similar to its parent pTDMS10 (Fig. 3A).
The wild-type lac promoter-dmsA leader construct (pDMS190) supported good
growth even in the absence of added inducer.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 10: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/10.jpg)
10
The role of the DmsA leader on the targeting, assembly and the activity of DMSO
reductase. To probe the enzymatic activity of the leader mutants described above
we measured the DMSO-dependent oxidation of benzyl viologen (BV) as a
measure of DmsAB function and lapachol catalyzed reduction of DMSO as a
measure of the DmsABC in the membrane and soluble fractions from E. coli
DSS301 cells grown on minimal glycerol-fumarate medium (Table 1). DMSO
reductase activity was localized predominantly to the membrane fraction in cells
harboring pDMS160, pDMS190, and the cleavage site mutants pDMSA43N and
pDMSA43N:A45N. The activity data correlated well with the anaerobic growth
experiments (Fig. 3).
Membrane vesicles from E. coli strain DSS301/pDMSM1 Stop, expressed very
low levels of BV and lapachol activities. The BV activity observed was
predominantly in the soluble fraction (Table 1), in agreement with the growth
measurements. Similarly, there was no detectable BV or lapachol enzyme activity
when the leader was deleted (pTDMS10). In this mutant, the leader was replaced
with a multicloning site that encodes 11 amino acids, including an initiating Met
at the N-terminus of DmsA unrelated to the DmsA leader (Fig. 1). These studies
indicate that the leader sequence is an absolute requirement to sustain the
anaerobic growth, enzyme activity, stability and localization of the DMSO
reductase holoenzyme (Fig. 3 and Table 1).
Strain DSS301/pDMSR17D with a mutation in the second Arg of the twin Arg
motif expressed DmsA (Fig. 4B, below) but this enzyme did not associate with
the membrane and only very minimal levels of enzyme activity were detected in
the soluble fraction. Although nearly normal levels of DmsA appear to
accumulate following T7 expression (Fig. 2), we have found that under the
standard growth conditions, (peptone-fumarate medium for 24 hours or on
glycerol-fumarate medium for 48 hours (data not shown), the precursor form of
DmsA is degraded. As will be shown below (Fig. 4B) mutant precursor enzyme
from pDMSR17D was poorly processed to the mature form.
We have examined the expression of dmsABC using the lac promoter construct
(pDMS190). In minimal medium pDMS190 expressed similar total activity units
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 11: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/11.jpg)
11
in the absence of an inducer (IPTG) compared to pDMS160. The membrane
distribution of the BV and the lapachol activities were also similar to pDMS160
(Table 1). We also compared the activity profiles of the various constructs grown
on rich medium (TB) for 8 hours (Table 2). For the wild-type pDMS190, 97% of
the activity was found in the membrane fraction.
E. coli/pDMS189 lacking a leader had only 6% of the wild-type activity and 76%
of this activity was soluble. DSS301/pDMS191 with a TorA leader in place of
DmsA leader, had about 20% of the wild-type activity and 90% was membrane-
bound, corroborating the slow anaerobic growth seen on glycerol-DMSO
medium. These results indicate the twin arginine leader is required for stability
and for the association of DmsAB with the membrane.
Western blot analysis of the DmsA subunit from the wild-type and signal sequence
mutants. To confirm the role of the leader in membrane targeting and stability of
DmsA we used western blot analysis of membrane and soluble fractions from
cells harboring various plasmids encoding DMSO reductase. The distribution of
DmsA with the wild-type and mutant leaders was examined from cells grown
anaerobically on G-F medium for 48 hours to corroborate the activity
measurements summarized in Table 1. DmsA expressed by DSS301/pDMS160,
pDMS190, pDMSA43N and the double mutant pDMSA43N:A45N was
predominantly in the membrane fraction (Fig. 4A). The distribution of DmsA
reflected the distribution of specific activity (Table 1). Cells harboring plasmids
pDMSM1 Stop (Fig. 4A), pTDMS10 (data not shown) showed no immunoreactive
material in either the membrane or soluble fractions.
Analysis of the DmsA from DSS301/pDMSR17D mutant was carried out from
cells grown on TB medium for 8 hours (Fig 4B). Cells grown on G-F or peptone-
fumarate medium did not show any immunoreactive DmsA presumably due to
degradation (data not shown). However, analysis of the cell fractions derived
from cells grown in rich medium revealed three immunoreactive bands
corresponding to the pre-DmsA (P-form, 90.4 kD), the mature (M-form, 85.8 kD)
and a proteolytically degraded (D-form) in the soluble fraction. The membrane
fraction had only a very small amount of the M-form and D-form. These results
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 12: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/12.jpg)
12
are in agreement with the hypothesis that the DmsA leader is required for the
correct targeting and stability of the holoenzyme.
In Fig. 4B we also analyzed the membrane and soluble fractions for lac promoter-
controlled expression of DmsABC. The DmsA immunoreactive bands were
observed predominantly in the membrane fraction for E. coli DSS301/pDMS190
(wild-type leader) and pDMS191 (TorA leader). A very small amount of the D-
form of DmsA was observed in the soluble fraction of pDMS191. There was no
detectable immunoreactive material in the membrane or the soluble fraction
from the leaderless construct, pDMS189, consistent with the distribution of the
enzyme activity data (Table 2).
Discussion
The MTT system plays an essential role in the translocation of several folded,
cofactor-containing, redox proteins to the periplasm (1-3). These proteins have
long amino-terminal leader sequences with a twin Arg motif and are usually
soluble or bound to the periplasmic side of the membrane. The DmsABC and
FdoGHI enzymes are membrane-bound, multi-subunit proteins and both the
DmsA subunit and the FdoG subunit have similar twin Arg signal peptides.
However, a great deal of experimental evidence has shown that DmsAB and
FdoGH subunits face the cytoplasmic side of the membrane and are not
translocated across the membrane (12,28). We have proposed that the MTT
system is needed to associate the DmsAB subunits with the membrane anchor
subunit, DmsC (1,11).
In this study we provide experimental evidence for the presence of a 45-residue
twin Arg leader on the DmsA subunit. We also show that the leader is essential
for the stability and function of the holoenzyme. This contrasts with the
periplasmic TMAO and DMSO reductases from E. coli and R. sphaeroides (2,29).
In these enzymes, deletion of the twin Arg leader resulted in cytoplasmic
localization of the enzyme, consistent with the predicted role of the leader
peptide (2,3,29), however the leaderless enzymes were stable and incorporated
the molybdopterin cofactor.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 13: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/13.jpg)
13
The DmsA leader has two methionine residues, Met1 and Met30 (Fig. 1). Met30
was found to be a poor initiation site and led to minimal synthesis of the
reductase (Fig. 2). This Met is not conserved in DmsA homologues (6). The
confirmation of a 45-residue leader necessitates re-numbering of amino acid
residues in DmsA. Previous publications have assumed that DmsA initiated at
Met30 based on the original sequence paper (9) and the first residue of the
mature protein, Val46 was previously numbered Val16.
Mutagenesis studies of the conserved Arg, within the twin Arg motif, were
performed on the [Ni-Fe] hydrogenase from Desulfovibrio vulgaris, the nitrous
oxide reductase from the Pseudomonas stutzeri and the glucose-fructose
oxidoreductase from Zymomonas (14,26,30). In all cases the mutant enzymes were
not translocated to the periplasm but were stable. The R17D mutant of DMSO
reductase was highly unstable, was not targeted to the membrane and did not
support anaerobic growth (Table 1 and Fig. 3). These studies suggest that the
twin Arg leader could have two distinct functions: targeting and stability. The
twin Arg motif in DmsA differs from the consensus twin Arg leaders by having a
Leu in place of a Phe in the fourth position however it is unlikely that the
targeting versus translocation role is related to this variation. When we replaced
the DmsA leader with the TorA leader, which has a Phe in place of Leu, DmsA
was still targeted to the membrane. The TorA leader-DmsA construct appeared
to be far less stable than the DmsA leader DmsA construct suggesting that there
are unique interactions between the leader and mature protein.
The twin Arg leader is cleaved by a peptidase (leader peptidase I?) and we have
examined the processing of DmsA by mutating the conserved amino acids
adjacent to the putative cleavage site. Nearly all of the twin arginine leaders have
a conserved A-X-A motif amino-terminal to the cleavage site and cleavage at this
site was confirmed for a number of enzymes (6,14). The DmsA leader also has the
A-X-A motif (Fig. 1), and the N-terminal analysis of the purified DmsA
polypeptide showed cleavage at this site (9). Both the cleavage site mutants
(pDMSA43N and pDMSA43N:A45N) exhibited enzyme activity, were processed
to the M-form, supported anaerobic growth on G-D medium and had the
expected membrane localization of activity. These mutations were chosen based
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 14: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/14.jpg)
14
on algorithms of von Heijne which suggested that Asn residues were least
preferred by leader peptidase I (31). Data in Figure 4A show that the
DmsA43N:A45N protein migrates as mature DmsA suggesting that cleavage is
catalyzed by a protease which is not inhibited by Asn or a nearby alternate
cleavage site is being utilized. These results lead to a conundrum. If DmsA is not
translocated to the periplasm, when and where is it cleaved? Although in earlier
papers we suggested that cleavage may be an artifact of cell lysis and protein
purification (9,10) it now appears that cleavage is an essential step to maturation
of functional enzyme (Sambasivarao, Dawson, Jing and Weiner, in preparation).
The twin Arg leader is able to export both homologous and heterologous
proteins. Reporter proteins such as dihydrofolate reductase, β-lactamase, alkaline
phosphatase and the 23 kD protein of the plant photosystem II oxygen-evolving
complex were exported and processed to the mature forms when expressed with
a TorA signal peptide (3,14,32,33). We have replaced the DmsA leader with the
TorA leader (pDMS191) and investigated the membrane assembly and function
of the TorA-DMSO reductase holoenzyme (Table 2, Figs 3 and 4). While the
TorA leader behaved similarly to the DmsA leader in its ability to target the
holoenzyme to the membrane, nearly a five-fold decrease in specific activity was
noted for the mutant enzyme, compared to the wild-type enzyme. The mutant
enzyme did not support efficient anaerobic growth on Glycerol DMSO minimal
medium. The incompatibility of the TorA leader supports our contention that the
DmsA leader has important stabilizing properties during maturation of
DmsABC holoenzyme. Interestingly, when the TorA leader was fused to the
soluble DMSO reductase from Rhodobacter sphaeroides the enzyme also failed to
show optimal enzyme activities implying the role of the leader in the overall
folding and function of the enzyme complex (29). These studies show that twin
Arg leaders may play specific roles in the assembly of redox enzymes and may
not be interchangeable.
Acknowledgments- This work was funded by the Medical Research Council of
Canada. We thank Alberta Heritage Foundation for Medical Research for a
summer student fellowship to Jing Hu.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 15: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/15.jpg)
15
References
1. Weiner, J. H., Bilous, P. T., Shaw, G. M., Lubitz, S. P., Frost, L., Thomas, G.
H., Cole, J. A., and Turner, R. J. (1998) Cell 93(1), 93-101.
2. Santini, C. L., Ize, B., Chanal, A., Muller, M., Giordano, G., and Wu, L. F.
(1998) Embo J 17(1), 101-12.
3. Sargent, F., Bogsch, E. G., Stanley, N. R., Wexler, M., Robinson, C., Berks,
B. C., and Palmer, T. (1998) Embo J 17(13), 3640-50.
4. Settles, A. M., Yonetani, A., Baron, A., Bush, D. R., Cline, K., and
Martienssen, R. (1997) Science 278(5342), 1467-70.
5. Bogsch, E. G., Sargent, F., Stanley, N. R., Berks, B. C., Robinson, C., and
Palmer, T. (1998) J Biol Chem 273(29), 18003-6.
6. Berks, B. C. (1996) Mol Microbiol 22(3), 393-404.
7. Fekkes, P., and Driessen, A. J. (1999) Microbiol Mol Biol Rev 63(1), 161-73.
8. Dongen, W. V., Hagen, W., Berg, W. V. D., and Veeger, C. (1988) FEMS
Microbiol. Lett 50, 5-9.
9. Bilous, P. T., Cole, S. T., Anderson, W. F., and Weiner, J. H. (1988) Mol
Microbiol 2(6), 785-95.
10. Bilous, P. T., and Weiner, J. H. (1988) J Bacteriol 170(4), 1511-8.
11. Sambasivarao, D., and Weiner, J. H. (1991) J Bacteriol 173(19), 5935-43.
12. Sambasivarao, D., Scraba, D. G., Trieber, C., and Weiner, J. H. (1990) J
Bacteriol 172(10), 5938-48.
13. Rothery, R. A., and Weiner, J. H. (1993) Biochemistry 32(22), 5855-61.
14. Niviere, V., Wong, S. L., and Voordouw, G. (1992) J Gen Microbiol 138(Pt
10), 2173-83.
15. Rothery, R. A., and Weiner, J. H. (1991) Biochemistry 30(34), 8296-305.
16. Weiner, J. H., Rothery, R. A., Sambasivarao, D., and Trieber, C. A. (1992)
Biochim Biophys Acta 1102(1), 1-18.
17. Trieber, C. A., Rothery, R. A., and Weiner, J. H. (1996) J Biol Chem 271(9),
4620-6.
18. Rothery, R. A., and Weiner, J. H. (1996) Biochemistry 35(10), 3247-57.
19. Tabor, S., and Richardson, C. C. (1985) Proc Natl Acad Sci U S A 82(4),
1074-1078.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 16: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/16.jpg)
16
20. Latour, D. J., and Weiner, J. H. (1989) Biochem Cell Biol 67(6), 251-9.
21. Sambrook, J., Fritsch, E. R., and Maniatis, T. (1989) Molecular Cloning. A
Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor,
NY.
22. Zhang, Y. B., and Broome-Smith, J. K. (1990) Gene 96(1), 51-7.
23. Laemmli, U. K. (1970) Nature 227(259), 680-5.
24. Sambasivarao, D., and Weiner, J. H. (1991) Curr Microbiol 23, 105-110.
25. Rothery, R. A., Chatterjee, I., Kiema, G., McDermott, M. T., and Weiner, J.
H. (1998) Biochem J 332(Pt 1), 35-41.
26. Halbig, D., Hou, B., Freudl, R., Sprenger, G. A., and Klosgen, R. B. (1999)
FEBS Lett 447(1), 95-8.
27. Brink, S., Bogsch, E. G., Edwards, W. R., Hynds, P. J., and Robinson, C.
(1998) FEBS Lett 434(3), 425-30.
28. Benoit, S., Abaibou, H., and Mandrand-Berthelot, M. A. (1998) J Bacteriol
180(24), 6625-34.
29. Hilton, J. C., Temple, C. A., and Rajagopalan, K. V. (1999) J Biol Chem
274(13), 8428-36.
30. Dreusch, A., Burgisser, D. M., Heizmann, C. W., and Zumft, W. G. (1997)
Biochim Biophys Acta 1319(2-3), 311-8.
31. Nielsen, H., Engelbrecht, J., Brunak, S., and von Heijne, G. (1997) Int J
Neural Syst 8(5-6), 581-99.
32. Hynds, P. J., Robinson, D., and Robinson, C. (1998) J Biol Chem 273(52),
34868-74.
33. Rodrigue, A., Chanal, A., Beck, K., Muller, M., and Wu, L. F. (1999) J Biol
Chem 274(19), 13223-8.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 17: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/17.jpg)
17
Figure Legends
Figure 1. Signal sequence of the DmsA subunit. The wild-type DmsA signal
sequence is shown for plasmid pDMS160 and for the mutants listed in
experimental procedures. The twin Arg motif is boxed and the consensus
sequence is shown at the bottom. Amino acid changes, or additions resulting
from the cloning manipulations, are shown in lower case. Gaps in the leader
sequences are introduced to facilitate alignment of the constructs. The start of
mature DmsA at position 46 is shown by an arrow. The AXA motif which is
conserved among the twin arginine leader sequences and may be the recognition
site for the protease involved in the processing of the signal sequence is
underlined. Amino acids deleted following the M1 in pTDMS10 and pDMS189
are represented by - -. The stop codon in pDMSM1 Stop is shown by the symbol
(*). The lac promoter construct pDMS190 carries the entire dms operon, similar to
pDMS160, except for the amino acids introduced as a result of engineering the
restriction sites. The TorA leader replaces the Dms leader in pDMS191 and
contains several amino acids derived from the mature TorA identified by italics.
Construction of the plasmids is described in the experimental procedures.
Figure 2. The twin arginine signal sequence is essential for expression and
stability of DmsA. The expression studies were carried out in the T7-promoter
vector pTZ18R, wild-type (pDMS223) and the mutant DmsA leader sequences
(pT7M1 Stop and pT7R17D) are described in the experimental procedures. The
DmsA and DmsB subunits are indicated.
Figure 3. The twin arginine signal sequence of DmsA is essential for
anaerobic growth of E. coli on G-D medium. Bacterial growth measured as Klett
units are plotted as a function of time (hours). The recombinant plasmids in E.
coli DSS301 were tested for growth with either the native anaerobic promoter (A)
or the lac promoter (B). The plasmids are identified in the figure. Individual data
points for the experiments using the plasmids pTDMS10, pDMSR17D, pDMSM1
Stop and DSS301 are omitted for clarity as these plasmids did not show any
growth over 36 hours. Individual growth profiles for the mutants pDMSA43N
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 18: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/18.jpg)
18
and pDMSA43N: A45N were identical and representative data for pDMSA43N:
A45N is shown.
Figure 4. Western blot analysis of the DmsA subunit from strains expressing
the wild-type and mutant enzymes. Recombinant plasmids in E. coli DSS301 are
identified above each lane. See Materials and Methods for full description of the
plasmids. The membrane (m) and soluble (s) fractions were separated on 7.5%
SDS-PAGE gels, transferred to nitrocellulose and blotted for the DmsA subunit.
The precursor (P), mature (M) and the degraded (D) forms of the DmsA subunit
are identified. DMSO STD is purified DMSO reductase. Data shown in A are
from the cells grown on glycerol-fumarate medium for 48 hours. Data shown in
B are from the cells grown on TB medium for 8 hours.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 19: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/19.jpg)
19
Table Legends
Table 1: Comparison of the DMSO reductase activity from E. coli DSS301 carrying
wild-type and mutant DmsA leader sequences. Bacterial cultures (1L) were
grown anaerobically in glycerol-fumarate minimal medium for 48 hours at 370C.
Enzyme activities were measured using either reduced benzyl viologen (A) or
lapachol (B) as the electron donor and TMAO as the electron acceptor. The total
units of activity (µ moles of benzyl viologen or lapachol oxidized/min) and the
specific activity (expressed as units/mg of protein) in the membrane and soluble
fractions are indicated. The % distribution of activity in the membrane and
soluble fractions is shown in parenthesis. N.D: not detected.
Table 2: Comparison of DMSO reductase activity under control of Lac promoter.
E. coli DSS301 carrying the various recombinant plasmids was grown
anaerobically in TB medium for 8 hours at 370C. Assay of the reductase activity,
calculation of the total units, specific activity and distribution of the activity in
membrane and soluble fractions were as described in Table 1.
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 20: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/20.jpg)
Plasmid Sequence
pDMS160 M KTKIPDAVLAAEVSRRGLVKTTAIGGLAMASSALTLPFSRIAHA VDS
pTDMS10 orpDMS189
VDSM ghmsrqlaspg---------------------------------
pDMS190 MvKTKIPDAVLAAEVSRRGLVKTTAIGGLAMASSALTLPFSRIAHAvlg VDS
pDMSM1 Stop VDS* KTKIPDAVLAAEVSRRGLVKTTAIGGLAMASSALTLPFSRIAHA
pDMSA43N M KTKIPDAVLAAEVSRRGLVKTTAIGGLAMASSALTLPFSRInHA VDS
pDMSR17D M KTKIPDAVLAAEVSRdGLVKTTAIGGLAMASSALTLPFSRIAHA VDS
1 17 30 45 46
pDMS191 MvNNNDLFQA SRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQAATDAVISig VDS
Twin arginine consensus sequence T/SRRXFXK
pDMSA43N:A45N M KTKIPDAVLAAEVSRRGLVKTTAIGGLAMASSALTLPFSRInHn VDS
Sambasivarao et al, Fig. 1
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 22: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/22.jpg)
pTZ18R pDMS223 pT7R17-D
DmsA
DmsB
0.0
1.0
0.5
21.0
2.0
0.0
1.0
0.5
21.0
2.0
0.0
1.0
0.5
21.0
2.0
0.0
1.0
0.5
21.0
2.0
Time(h)
pT7M-1Stop
Sambasivarao etal, Figure 2
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 23: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/23.jpg)
0 50
100
150
010
2030
4050
pDM
S190
pDM
S189
pDM
S191
0 50
100
150
Klett Units
010
2030
40
pDM
SA
43N:A
45N
pDM
S160
DS
S301
pTD
MS
10pD
MS
R17D
pDM
SM
1 Stop
AB
Tim
e (hours)T
ime (hours)
Sam
basivarao
etal, Figure 3
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 24: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/24.jpg)
DMSO STD
pDMS189
pDMS190
pDMS191
M
D
DmsA
m s m ms s
B
m s
pDMSR17D
P
DMSO STD
pDMS160
pDMS190
pDMS43N
pDMS43N:45N
pDMSM1Stop
DmsA
M
Dm s m m m ms s s s
A
Sambasivarao etal, Figure 4
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 25: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/25.jpg)
20
Table 1
DMSO Reductase Specific Activity
A. Benzyl viologen assay B. Lapachol assay
Plasmid Total Units Membrane(%) Soluble(%) Total Units Membrane(%)
pDMS160 593 25.0 (93) 0.49 (7) 27.0 1.25 (91)
pDMS190 520 19.0 (94) 0.43 (6) 26.0 1.02 (80)
pDMSA43N:A45N 630 27.0 (92) 0.6 (8) 34.0 1.62 (94)
pDMSA43N 778 27.0 (94) 0.66 (6) 39.0 1.44 (96)
pDMSR17D 43 0.20 (13) 0.5 (87) N.D
pDMSM1 Stop 5 0.2 (100) N.D N.D
pTDMS10 N.D N.D N.D N.D
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 26: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/26.jpg)
21
Table 2
DMSO Reductase Specific Activity
Plasmid Total Units Membrane (%) Soluble(%)
pDMS189 35 0.20 (24) 0.20 (76)
pDMS190 519 11.0 (97) 0.10 (3)
pDMS191 111 2.10 (90) 0.13 (10)
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from
![Page 27: Multiple Roles for the Twin Arginine Leader Sequence of Dimethyl](https://reader034.vdocuments.net/reader034/viewer/2022051711/5868ded91a28ab27408c2d70/html5/thumbnails/27.jpg)
and Joel H WeinerDamaraju Sambasivarao, Raymond J Turner, Joanne L Simala-Grant, Gillian Shaw, Jing Hu
Reductase of Escherichia coliMultiple Roles for the Twin Arginine Leader Sequence of Dimethyl Sulfoxide
published online May 8, 2000J. Biol. Chem.
10.1074/jbc.M909289199Access the most updated version of this article at doi:
Alerts:
When a correction for this article is posted•
When this article is cited•
to choose from all of JBC's e-mail alertsClick here
by guest on February 11, 2018http://w
ww
.jbc.org/D
ownloaded from