the weekly post 11/26/15

RURAL BOXHOLDERLOCAL P.O. BOXHOLDER

****************ECRWSS*****

PRSRT. STD.U.S. POSTAGE PAIDElmwood, IllinoisPermit No. 13

Carrier Route PresortThursdayNov. 26, 2015Vol. 3, No. 38

The Weekly Post“We Cover The News of West-Central Illinois With A Passion”

Serving the fine communities of Brimfield, Dahinda, Duncan, Edwards, Elmwood, Farmington, Kickapoo, Laura, Monica, Oak Hill, Princeville, Williamsfield and Yates City

Farm Bureau sets transmission line meeting

FREE!Compliments of

Our Fine Advertisers!

Hot news tip? Want to advertise?Call (309) 741-9790

By BILL KNIGHTFor The Weekly Post

BRIMFIELD – The Peoria CountyFarm Bureau has scheduled a meet-ing for 1 p.m. Dec. 2 at the BrimfieldAmerican Legion hall to explain theeminent domain process and howlandowners along the route of theSpoon River Transmission Line cannegotiate a better easement with landagents, according to Peoria CountyFarm Bureau manager Patrick Kirch-hofer.

Laura Harmon from the IllinoisFarm Bureau’s General Counsel’s of-fice will make the presentation. Har-mon, who in July spoke at a meetinghosted by the Knox and PeoriaCounty Farm Bureaus, plans to ex-plain eminent domain and how to in-corporate landowner priorities intoan easement.

Area landowners in the path of theproposed 345,000-volt transmissionline recently received an Ag Impact

Mitigation Agreement (AIMA) fromthe Illinois Department of Agricul-ture.

The letter is the agreement be-tween Ameren Transmission LineCompany of Illinois (ATXI) and theIllinois Department of Agriculture,which established standards and poli-cies that ATXI will follow as itbuilds the power line across agricul-tural land to connect the Sandburg


ELMWOOD – The Board of Education onMonday approved a 7-cent increase in its taxlevy, but the 1.38-percent hike from 5.2804per $100 assessed valuation last year to5.3537 is still below the rate of inflation.

The U.S. Bureau of Labor Statistics thisweek reported that the 12-month percentagechange in the Consumer Price Index for allurban consumers for “all items less food andenergy” is 1.9 percent.

“We’ll be helped by the increasing Equal-ized Assessed Valua-tion,” saidSuperintendent ChadWagner.Raising the tax levyfrom $5.28 per $100equalized assessed val-uation to $5.35 wouldcost the owner of a$120,000 home about$2,118 or some $28

more than last year.Uncertainty with state funding has led to

greater reliance on property taxes, whichnow make up more than half of all revenues,and there’s widespread concern about thestate freezing property taxes. But for now,the District’s financial situation is solid, ac-cording to a recent independent audit.

The Board unanimously OK’d a $4.2 mil-lion tax levy request, with Board SecretaryBill Frietsch absent.

Breaking down the levy request by funds,the largest increases are in the Education andTort immunity funds, both of which wouldgo up about $60,000, and in Operations &maintenance, which increases $10,000.

The dollar totals are about $2.4 million inEducation; $400,000 in Operations & main-

Elmwood upsschool tax levy 1.38 percent


OREGON – It was 105 years ago thisSunday when Elmwood native LoradoTaft supervised the delicate pouring ofmassive amounts of concrete into the48-foot mold of his ambitious concretestatue, “The Eternal Indian.” The sculp-tor and crew of assistants and laborerswere nervous because such a projecthadn’t been tried, and temperatures wereplummeting.

Today, the effects of a century’sweather – plus a few repairs that inad-vertently caused problems – have madethe imposing figure better known as theBlack Hawk statue the subject of an-other ambitious project: its restoration.

Overlooking the Rock River 125 feetbelow a wooded bluff, the project stalledthat day, when weather turned frigid.

Taft “had this idea of building a mon-ument to the Native Americans who hadpreceded him,” said Dale Hoppe, direc-tor of the Lorado Taft Field Campuscomplex yards from the statue. “Taft’screws started pouring in November andthe concrete froze. So they went downto the Schiller Piano Factory, which is

Black HawkRestored

Iconic Taft statuegetting facelift

Continued on Page 8

Continued on Page 2

LORADO TAFT SCULPTURE

InsideBrimfield’s SchoolBoard approved afour-cent tax hikeand is ponderingraising schoollunch rates. See2.

Happy Thanksgiving!The Weekly Post office will beclosed Thursday and Friday

(Nov. 26-27) as we cel-ebrate Thanksgiving.

Ad deadline for the Dec.3 issue will be Monday (Nov. 30) at noon.

“The Eternal Indian” is barely visible last week, shrouded by scaffold-ing and planks. A piece of tarp blown from the protective covering byhigh winds this month is tangled in a tree. Photo by Bill Knight.

Continued on Page 2

www.wklypost.comTHE WEEKLY POST • Thursday, November 26, 2015

We Cover The News of West-Central Illinois With A Passion

ELMWOOD: School logo unveiled

Substation near Galesburg and theFargo Substation in Kickapoo Town-ship.

However, while the AIMA providesprotection to land, it may not addressspecific concerns that landowners mayhave. Individual concerns must be ad-dressed in a specific easement contractto accomplish a landowner’s specificgoals.

The Illinois Commerce Commissionapproved Ameren’s Spoon RiverTransmission line but didn’t grant emi-nent domain authority to Ameren.

Affected landowners should soon re-ceive landowner packets from Amerento begin the easement negotiation

process, Kirchhofer said.If Ameren is unable to obtain volun-

tary easements with each landownerafter good-faith negotiations, then thecompany must seek and obtain eminentdomain authority from the ICC beforeit initiates condemnation proceedingsin state court.

The transmission line is planned touse single-shaft steel poles. There willbe a 150-foot easement under the lines,and it’s scheduled to be in operation by2018.

No reservations are necessary to at-tend the meeting, Kirchhofer said.

For more information, call the PeoriaCounty Farm Bureau at 686-7070.

tenance; $40,000 in Bond & interest$160,000 in Transportation; $80,000 inMunicipal retirement; $40,000 inWorking cash; $275,000 in Tort immu-nity; $40,000 in safety, security, etc.;$40,000 in Leasing levy; $240,000 inSpecial education; and $125,000 in So-cial Security/Medicare.

In other business, the Boardapproved a proposal for theJunior High Technology Labto equip the room with 40Chromebooks and 8 cameras,and the District will use CDW-G for the computers and onlinevendors for the cameras.

In other news:• Counselor Janelle Meyer reported

that high school senior Deanna Cantu isthe first local student in about 50 yearsto advance in the V.F.W.’s “Voice of

Democracy” audio-essay contest, anannual competition in which tens ofthousands of high schoolers nationwidecompete for scholarships.

She’ll go on to compete in Spring-field in February;

• the Junior High construction projectremains on schedule, Wagner said; and

• local graphic artist Tanya Endres’entry in the community effort to

update Elmwood’s mascot logowas picked (left), and it’ll be usedon official materials, from sta-

tionery to the web site. However, the change may not

be uniform, according to Wagner, whosaid, “Individual sports have the choiceof using the new mascots or continuingwith what they have always used. Iconducted a poll of other area schools,and allowing variations of the theme inregards to mascots is pretty typical.”

Continued from Page 1

LINE: Landowner packets going outContinued from Page 1

www.wklypost.com


THE WEEKLY POST • Thursday, November 26, 2015

THE WEEK AHEAD

This Week’s Eventss Free Bread – Free bread at Elm-

wood Methodist Church Friday (Nov.27) at 10 a.m.

s Career Help – Career Link and theIllinois workNet Center organized aRapid ResponseWorkshop for laid offCaterpillar employeesDec. 1 at ICC NorthCampus in ArborHall, Rm 111. at 10a.m. Reserve seatingat (309) 999-4592.

Future Eventss Choral Performance – Williamsfield

High School Choir will perform at theOrpheum Theater in Galesburg Dec. 5 at7:30 p.m. Call (309) 639-2219.

s Craft Show – Laura’s 28th annualholiday craft show is Dec. 5 from 9 a.m.to 3 p.m. at the Milbrook TownshipCenter.

s Open House – Brimfield Fire De-partment will hold at open house at itsnew facility on Dec. 5 from 4-7 p.m.Free soup and sandwiches.

s Holiday Homecoming – Princeville’sHoliday Homecoming is Dec. 5 from 4-

7 p.m. Wide variety ofevents and shops open.Visit www.princeville.org.

s Christmas Walk –Elmwood’s ChristmasWalk is 1-4 p.m., with treelighting at 4:30 p.m.,Santa at Morrison andMary Wiley and family

fun from 5-7 p.m. at Elmwood Town-ship Community Center.

s Christmas Walk – Brimfield Christ-mas Walk located in Downtown Brim-field is Dec. 5 for 5-7 p.m.

s Family Bingo – Family bingo heldDec. 10 at 6 p.m. at Morrison and MaryWiley Library in Elmwood. To register,call (309) 742-2431.

Publicize Your EventCall us at (309) 741-9790

or email information aboutyour upcoming event [email protected].

HOT PICKS This Week!s Live Music – Talkin’ Turkey for St. Jude is Nov.

25 at Elmwood Middle Tap. Firehouse five plays at7:30 p.m. Smart TV raffle, 50/50 and more.

s Park Lighting – Williamsfield’s “lighting of thepark” is scheduled for 5 p.m. on Saturday (Nov. 28),followed by a tour of homes from 5:30-8 p.m..

s Small Business Saturday – Shoppers are urged tovisit local businesses Saturday (Nov. 28) where shopshave a variety of promotions organized. BrimfieldPublic Library will also have several vendors in itsPublic Room from 9 a.m. to 2 p.m.

NEW LIST! 310 N MAGNOLIA, ELMWOOD Enjoy this spacious 4BDR, 1.5BA two story home closeto downtown Elmwood & schools! Great eat-in kitchen,oversized 2 car garage & cozy front porch! $124,000

506 W. ASH, ELMWOODImmaculate 2 BDR ranch, att. garage, large living

room, eat in kitchen, all appliances stay plus great backyard all in nice location! $79,900

616 N. MAGNOLIA, ELMWOODCute updates in this 3BDR, 1.5BA home w/ huge 2 cargarage, deck & neat front porch. $79,900

505 N. PINE ST., WILLIAMSFIELDGreat 3-BDR, 3-BA ranch, walkout located on almost 1

acre! $175,000

RESERVE YOUR LOT NOW!New golf course lots and others! $18,000 to $42,500

PENDING496 Hwy. 18, Yates City

110 W. Southgate Dr., Elmwood

407 N. Althea, Elmwood

436 N. Washington, Brimfield

CURRENT PRICES: (NOTE: All Prices Subject to Change Without Notice)• Aluminum cans ...... $0.35 • Shredder material .... $20 per nt• Unprepared Iron ..... $40 per nt, $50 per nt (over 1000 pounds) • Prepared Iron ......... $70 per nt, $80 per nt (over 1000 pounds)

WE BUY SCRAP METAL!

Located on Illinois Route 78, 1.5 miles south of Canton • Hours: Mon-Fri 8 am - 4 p.m. • (309) 668-3217 • hitchcockscrapyard.com

112014-02743AC

Bradly Coyle 5005 American Prairie Dr

Peoria IL309-689-2981

Chris Peterson 12924 W Farmington Rd

Hanna City IL309-565-7313

309-265-8558 cell

Travis Lewis 4718 N Sheridan Rd

Peoria IL309-686-7050

309-922-0905 cell

David Vaughan 114 W Main StElmwood IL

309-742-2411309-712-3575 cell

Insurance can be confusingYou can always trust your COUNTRY Financial representative to answer all your questions in a timely manner with answers you can understand. Call today for a free, no-obligation Insurance and Financial Review.

The old squirrel sometimes finds a nut



The Weekly PostThe Weekly Post is published every Thursday (except the last

weeks of December and June) by Lampe Publications LLC, 115W. Main St., Elmwood, IL 61529. All phone numbers listed are in area code (309).Postmaster - Send address changes to The Weekly Post, P.O.Box 745, Elmwood, IL 61529Phone - 741-9790 Fax - 741-9365Email - [email protected] Hours - Mon-Wed 9-3, Thurs 9-12, Fri 9-3News - Jeff Lampe 231-6040, [email protected] - Shelly Brodine 741-9790 Advertising - 741-9790Subscriptions - Subscriptions $50 for 50 issues. Deadlines - News due Tuesdays by noon. Retail ads and classi-fieds due Mondays by noon. Quotable – “The most exciting breakthroughs of the 21st centurywill not occur because of technology but because of an expanding

concept of what it means to be human” – John NaisbittIllinois Press Association Member

Adele singing ‘Hello’ triggers tough memoriesHave you heard Adele’s new

song “Hello?” It is available oniTunes and you can watch the videofor free onYouTube.

Whether youlike the song ornot, I was ab-solutely stunnedby it. In it she at-tempts to contacta formerboyfriend/loveror whatever toapologize for what she did to him –how she mistreated him.

If you have read my pieces in thepast, you probably know I’m a re-covering alcoholic – 32 years sober.But I have not mentioned that I wasmarried during much of what I callmy “drinking career,” and, aftermore than six years of marriage myfirst wife divorced me because Iwas an awful drunk.

That took courage and to this dayI admire her for it – she did whatshe had to do in light of an unten-able situation. What happened ex-actly I’ll keep between the two ofus, but suffice it to say that our part-ing was entirely my fault and she

got herself away from a loser.Not a day goes by that I don’t

think about her and my first mar-riage, my drunkenness and onceagain regret my actions during thatterrible period. I don’t think I’llever stop thinking about it, and oc-casionally talking to others abouthundreds of regrets I have from thatperiod.

The Alcoholics Anonymous pro-gram mandates (at least I considerit a mandate) that you go throughthe misdeeds of your past and try to“make amends” to those you

Some people are under the mis-taken impression that I am out to getThe Mayor of Oak Hill. Oh howwrong they are.

It was withhappiness that Iheard the old-timer had shot abig 12-point buckon Saturday. Ac-tually, the way Ifirst heard thestory, TheMayor’s grand-son shot the buck.That seemed more believable,though less column-worthy.

But no, it was The Mayor whobraved last Saturday’s snowstormand walked a mile into his PeoriaCounty hunting spot. All his huntingpartners backed out, scared off by

the snow and cold. Many others didthe same thing on opening weekend.

Not The Mayor. He set up on theground under a deadfall with a ther-mos of coffee and his old Reming-ton 870 Express shotgun.

“I was hunting on five acres withno scope. No guide. No outfitter. Noheater. No shed,” he cackled. “And Ididn’t have any Ozonics.”

(For those who don’t know, Ozon-ics are a scent-eliminating suit beingmarketed to deer hunters willing tospend lots of money, which rulesThe Mayor out.)

That anti-technology rhetoric issomething I enjoy about the Mayorand other old guys like him. Theystill get the idea that hunting is moreabout the hunt than the gear – orabout posing for a camera.

Anyway, around 8 a.m. as Hiz-

zoner sat in the snow eating a LittleDebbie snack cake, he heard a soundand saw a big buck walking straightat him, nose to the ground.

At 25 yards he fired.“Nothing runs like a deer, but a

Remington will put one down,” saidThe Mayor, always quick with aquip. “And I didn’t whisper aftershooting him. Because I had nobodyto talk to.”

Unlike those hushed hosts of TVshows who spend time praisingproducts and preening, The Mayorwouldn’t even share a picture.

“I’ve been out in worse weatherthan that,” he shrugged, beforeswitching topics to homemade wineand his wedding anniversary.

What’s not to like about that?Contact Jeff Lampe at 231-6040 or

[email protected]

JeffLAMPE

RandyFRITZ

Brimfield Mini Storage8’ x10’ and 10’ x 24’size units available24/7 Access - Secure

309-303-8703309-446-3565

brimfieldministorage.com

Mike CecilFinancial Advisor3430 W Willow Knolls Dr.Peoria, IL 61614Office 309-693-3019Cell 309-357-1001

[email protected] www.edwardjones.com

Brimfield Fire Department

Soup & Sandwich DinnerOPEN HOUSE

December 5th4-7 pm

Free

Continued on Page 7

Fair warning: This is a history les-son. Don’t say you weren’t warned.I just hope you’re entertained.

We know a lot about history, andpivotal momentsin history seem tostand out. Mydad’s generationcould tell you ex-actly where theywere when theyheard Pearl Har-bor had beenbombed. My gen-eration knowswhere they were when Kennedy wasshot or when the Space Shuttle ex-ploded. My older kids remember theOklahoma City bombing or the 9/11attacks.

But what if you were right there,right on the cusp of history, right be-side something that would changethe world, and you were so closeyou could touch it? Maybe youcould even have done something tochange the outcome.

Imagine that you and your fiancéehave received an invitation to go seea play. You’re not really one to ap-preciate live theater, but it’s the lastday the play is in town. You alsofind out that you’re not the firstchoice of the host. Several othercouples have been asked as guestsbefore you, so you understand thatdeclining the invitation won’t dam-

age your career too badly. You’re 28 years old with a bright

future ahead of you, and the host,well, he’s sort of your boss in an in-direct way.

Your step-sister Clara gets wind ofthe invitation and since the hostneeds an answer quickly, you accept.You and your step-sister dress inyour finest, she in a lovely eveninggown and you in your dress bluessince you’re a major in the Army.

Your name is Major Henry Rath-bone. Your step-sister, who is alsoyour fiancée, is Clara Harris. Yourhosts are Abraham and Mary Lin-coln. The date is April 14, 1865, andyou’re going to see “Our AmericanCousin” at Ford’s Theater in Wash-ington, D.C.

We all know what happened fromhere. John Wilkes Booth, a famousactor of the day, snuck into the pri-vate box that was occupied by Lin-coln, his wife and his guests,Rathbone and Harris, and shot the16th President.

We know that Mary Lincoln wasinstitutionalized because of the se-vere depression she suffered, havinglost three sons and a husband in ashort time span. Between the institu-tions and living with relatives, sheeventually died in 1882.

But whatever happened to Rath-bone and Harris? Why didn’t he tryto stop Booth? Very little is ever said

about him or his fiancée.Rathbone did try to stop Booth.

However, the assassin struck so un-expectedly, he could do nothing tostop the actor from firing the gun,which took Lincoln’s life. Rathboneleaped to his feet and wrestled withBooth after the shot, but Booth wasprepared for a fight and stabbedRathbone in the arm with a longdagger.

This allowed Booth to escape overthe railing of the private box, ontothe stage, and out through the wingsbackstage. Rathbone managed tograb Booth’s coat as he vaulted therailing, and most experts think thatthis is why Booth landed awk-wardly, which resulted in a brokenleg.

Rathbone was the one who tendedto Mary Lincoln, despite his own in-juries. Thought to be minor, thewound actually was deeper and sev-ered an artery in Rathbone’s arm. After helping Mrs. Lincoln to thehouse across the street where herhusband had been taken, Rathbonecollapsed due to the amount of bloodthat he’d lost.

Rathbone would recover from thewound, but he spent several yearsblaming himself for not being ableto do more to prevent the assassina-tion. He married Clara two yearslater and they had three children. His

www.wklypost.com THE WEEKLY POST • Thursday, November 26, 2015

GUEST VOICES


A story of Rathbone and Mr. Abe Lincoln

JonGALLAGHER

Continued on Page 6

(309) 678-9010

[email protected]

LEHMAN PLUMBING, INC.Residential • Small Commercial • Service

Bonded & Insured

FREE ESTIMATES

Randy Lehman

Licensed Plumber

Cell: 309-303-5799Office: 309-685-0883

or 309-446-3496Fax: 309-446-9401

FRED’S SHOE REPAIR, INC.The Fine Art of Shoe RepairEXPERT REPAIR OF ALL KINDSZippers • Luggage • Ball GlovesOrthopedic Work • Shoe Dyeing

Pool/Boat Covers • Shoe StretchingLeather Goods • Shoe Care SuppliesWhile You Wait - M-F 8-5:30, Sat 8-4

www.fredsshoerepair.com3033 N. University, Peoria, IL • (309) 686-4115

150 Main StreetCanton, IL 61520

cantonharvesterinn.com309-357-5820 Fax 309-357-5821

Jean L. StoneOperations Manager

B&K Repair, Inc.Bob & Karen Settles, Owners

309-245-4005200 S. Main St.

Farmington, IL 61531

Monday-Friday 8 am-5 p.m.Saturday 8 am-Noon

Be thankful for the right to do somethingJohn Kennedy said, “Ask not what

your country can do for you; askwhat you can do for your country.”

Many peopleliving today donot rememberPresidentKennedy or werenot even bornwhen he saidthat.

Some of us re-member himmaking thatstatement, and some remember theunfortunate day he was assassinated!

Many people in America todayhave been convinced that their coun-try (their government) can do every-thing for them including providingincome, providing insurance, and

providing security. This simply willnot and is not working. Americansas a whole, not as selective groups,need to realize that nothing is free.We must all work collectively forAmerica rather than asking whatAmerica can do for me.

In a recent article in an AARPpublication, the movie producer,Ron Howard, had an article entitled“Lessons I Learned from JohnWayne and Henry Fonda.” The les-son he learned from John Waynewas the value of hard work.

Without respect for ourselves andall Americans, and without individ-ual hard work, I fear for the future ofAmerica.

As a grade school student, whilestudying the difference between im-migration and emigration, I learned

that America was a melting pot ofdifferent people from different coun-tries.

I read the words “melting pot” in arecent editorial in the Journal Star. Ihad not read that term for manyyears.

The people who originally cameto America came in order to becomeAmericans, not hyphenated Ameri-cans. They expected to live by theU.S. Constitution!

Unfortunately, many people inAmerica today want to see whatAmerica can do for them rather thanwhat they can do for America. Wehave the opportunity to do some-thing in 2016. Vote to change the di-rection of America.

GeneVAUGHAN

GIVETHANKS

HappyThanksgiving!



PALACE THEATREElmwood, IL • 309-742-4211

In Digital Cinema!Tickets $5

Matinee$4

PG

The Good DinosaurFri - 2:30 & 7:15 pmSat - 2:30 & 7:15 pmSun - 2:30 & 7:15 pmMon-Thurs - 7:15 p.m.

On Tuesdays, bring a container forFREE POPCORN with a ticket !

NOTE: Charges are merely an accusa-tion. All suspects are presumed innocentuntil proven guilty in a court of law.

Elmwood juvenilearrested for online threat

ELMWOOD – A 15-year-oldElmwood boy on Nov. 14 was ar-rested on charges of making a ter-rorist threat after multiple peoplereported inflammatory Facebookposts referring to Columbine andother deadly incidents.

After Elmwood police appre-hended him, he was interviewed atthe Peoria County Sheriff’s Officeand then transported to PeoriaCounty’s Juvenile Detention Cen-ter.

On Nov. 16, Elmwood Superin-tendent Chad Wagner and princi-pals Stan Matheny and Tony Frostdistributed a letter to parents ofElmwood students discussing thesituation. They wrote:

“Over the weekend, there was athreat issued via a Facebook post-ing that alluded to the possibilityof a threatening and unsafe situa-tion in our District. Through ourstaff’s continuous educationregarding the identification andnotification of these potentiallydangerous postings and actions,the administration and authoritieswere made aware of the issue andable to address the circumstances.

The letter continued, “In the cur-rent world we live in, all threats,

words and activities that are saidor put out via social media rnust betaken with a high degree of seri-ousness, and severe actions need tobe taken. The administration ofElmwood asks for you to discussthis level of seriousness with yourchildren and to talk to them aboutthe appropriate use of these inter-net sites. Talk to your kids aboutthe importance of hitting ‘Send’before actually doing it. Oncesomething is out on the Web, thereis a very good chance that some-one will see it, and that it willeventually find its way into thepossession of authorities.”Dunlap women injuredin rollover accident

RADNOR – A Dunlap womanwas injured about 10:30 a.m. Nov.16 when the 2007 Ford Focus shewas driving southbound on Ill.Route 91 drifted onto the shoulder,after which she apparently over-corrected, a witness told police.The car then crossed both lanesand rolled over on the east side ofthe highway, according to reports.

Kathy Tankersley, 65, wasthrown about 35 feet from thewreck, police said.

AMT transported her to OSF St.Francis Medical Center.Phone hacker angersOak Run man

DAHINDA – Knox County

Sheriff’s deputies were called tothe scene in Oak Run, where 33-year-old Eric Rose was visiblyupset about his cell phone and asocial-media account beinghacked, and about alleged surveil-lance by neighbors, according toreports.

Rose, who destroyed his cellphone in the presence of respond-ing officers, police said, suspects aSt. Augustine man of involvement.

Nearby residents claimed theywere concerned with Rose suppos-edly using firearms in the area.

Rose told police that neighborswere videotaping him.Police Reports

• Joseph Wolf, 27, of Brimfieldon Nov. 17 was arrested for disor-derly conduct and transported to thePeoria County Jail.

• Timothy Colgan, 51, ofPrinceville on Nov. 22 was arrestedfor theft of items worth less than$300 and transported to the PeoriaCounty Jail.Deer Accidents

• Nov. 4: Marc Brown ofDahinda in rural Sparta Township.

• Nov. 18: Chad Anderson ofElmwood on Stone School Roadnear Smithville Road in LoganTownship.

• Nov. 19: Heather Franklin ofHanna City on Illinois Route 8near Heinz Lane in KickapooTownship.

PUBLIC RECORD

GALLAGHER: Witnessing history can be costlymental health deteriorated with eachpassing day. Every year on the an-niversary of Lincoln’s death, Rath-bone was contacted by journalistswho wanted to interview him, re-newing his torment.

Five years after Lincoln’s death,Rathbone would leave the Army, buthis mental health continued to dete-riorate. He became delusional, alco-holic and unfaithful to his wife. Heoften accused her of having affairsand was extremely jealous of anyman who paid attention to her.

President Chester Arthur finally

named Rathbone as U.S. Consul tothe Province of Hanover in Ger-many, where Rathbone and his fam-ily relocated.

Just before Christmas in 1883,Rathbone attacked his children, ages13, 12 and 11 during one of his delu-sional states. When Clara stepped into protect them, he shot her. He thenattempted suicide by stabbing him-self numerous times, but noneproved fatal.

Rathbone was charged with themurder of his wife, but he was de-clared insane. His children were senthome to the United States to live

with relatives while he was commit-ted to an insane asylum in Germany,where he died in 1911.

He was buried beside Clara inGermany, but in 1952, the cemeterydetermined that the graves had notbeen visited in some time, nor wasthe family interested in maintainingthem, so their bodies were disin-terred and the graves re-used.

As a side note, the blood-staineddress that Clara wore the night of theassassination was kept for manyyears before the eldest son had it de-stroyed, claiming that it had cursedthe family.


TLC Childcare in Elmwood

Owned and operated bySusan Mock with 19 years experience. DCFS licensed.

(309) 742-CHILD(4453)

New hours6am-5:30pm

Openings available for 6 weeks-4years oldDaily lessons

Traders Unlimited

3622 N. Knoxville Ave.Peoria, IL 61603

Each office independently owned and operated.

WE BRING BUYERS AND SELLERS TOGETHER

UnlimitedTrn

653-5462294-786

REKORByllyEmiKKi

66RB

PPa

ieciffffohcaE

1

fidastibatadbadadalsiabgnilieclardehtacdnaecalperifdedislaudrgninidlamrrmofa:gnirutaefemohsihtfonepoehTellivecnirP,truoCnetuA8151

ELLELIILVVIECCENIINRPPR

Unlimited

3

sredaTr30616LI,airoeP

.evAellivxonK.N2263

.

275-6964294-786

IRG,REKORlhaahttaSSttaatPPa

R

detarepodnadenwoyltnednepedn

EHTEGO TSRELLE SDN ASREYU BNGIR BEW

allfflhTaaiidlaftsafkaerb,yrrytnapegralhtiwnehctik;ghtiwmoortaerg;gniliecyarthtiwmoonoisnapxeehtotuoysemoclewreyofn

!sdeeNetatsElaeRruoYYollAroFsUtcatnoC

kceddereit-2suoicapsylluffurednow,fooruo-klawhtiwemohelytshcnarkcirBlla052revOpalnuD,slliHradeC.W0231

PALLANNLUUND.009,402$.egarotsartxednasyotruoyakcedaserutaefferoiretxeehT.ecapsgniruoygnitiawasitnemesabehT.mooryrdnastenibackaoserutaefnehctiK.aeragnituoyalmoordebtilpshtiwdengisedesuoHgnilieclardehtachtiwmoortaergserutaatefolhcnargninnutSnikeP,dleiffikraP8081

.000,913$.setunim02serca42.1noemohgninnutssihtrofytinksabetarapesdnaegaragrac2,tnemesabunob,moornusagnidulcniserutaeffesuocni,ngisedmoordebretsamtilpsafostsisfnidna;stenibactnadnubadnaandnalsi,raarb

kcabdedoowetavirpagnikoolrevO.krednuselcihev3roffoecaps,tnemesabtsihtniecapsgnivilylimaffo.tfft.qs00

follarofegarag’22x’02lanoitiddadn-vilruoydnapxeotsehcuotgnihsinifr-nualroolfniaM.gniroolffldoowdraarhdn-tisgnidulcnietiusmoordebretsaM.tu.eltnamdoowdiloshtiwecalperifdnagemohsihT.setatsEdleiFreeDnidetaco

ylnO.ellivecnirP–slliHyawkcorBni-utropporuoyssimt’noD.truocllabtekdehsinif,yrdnualroolfniam,moorsu-remunsahesuoH.smoordeb3gnidulc-nocnalproolfflehT.aeragninidlamrof

98$.hcnebkrowroffomoordnasllawdetal

xeehT.cittadetalusnidnadetalitnevllewdraydecnefycavirp,yrdnualroolfniamhctiknitaenastropsemohsihT.egaragrdeb3etuCairoeP,notlimaH.N3216

.005,321$ylnoroffollA.dewolprifehtybtis;nwalehtswomenoemosadna,stesolcegarotsfollawahtiwmoord/moorgnivillamrof;rabtewdna,ecalpfoegalliVerihskrrkoYYoniesuohnwot.tfft.qsnatesolcni-klaw,etiusretsamegralhtiwb3luffurednoWairoeP,elcriCyhtaC8044

AIIAROEPPE.009,991$.tnalpellivssoMTAATC

mdna,tcirtsiDloohcSpalnuDnidnuorgnedraargderucinamylluffuituaebdnadray

.009,9

-usnidnadehsinifhtiwegaragpeedartx,0102foorweN.oitaatpderevochtiwd,moorgnivilegraarl,secnailppahtiwnedehcattahtiwhcnarhtab2/1-1,moor

gniebsiyawevirdruoyelihwecalperelihwloopehtybxaleR.egaragrac2aylimaamflevelrewoldn2,obmocgninid-eriffihtiwmoorylimafroolfniamsreffff0002revosihT.htabretsamdetadpudesuohnwothtab2/1-2,lluffu2,moordeb

dnatnemniatretne,gnippohsotsetunimfoercananoeromdnasihtllA.saera

Between Black Friday and CyberMonday sits Small Business Saturday‐a day dedicated to helping small businesses in your community.We are proud to take part in SmallBusiness Saturday this year and wewant to encourage you to ShopSmall with us on November 28th.Consultants from Tastefully Simple, Norwex,

Thirty- One, Pampered Chef, Stella & Dot, Jamberry, Scensty, and

Country Chic Embellishments will be on hand to help you with all

of your holiday needs.Thank You for Supporting Small Businesses

SMALL BUSINESS SATURDAY

November 28th

9:00am-2:00pmBrimfield Public Library

Community Room

www.wklypost.com



Butler Repair LLCREPAIRS ON ALL AUTOS AND DIESELS


Hours: Monday thru Friday8:00 am - 4:30 pm.

24015 W. Farmington Rd (Rt. 116)309-245-2525 for appointment

Now acceptingmajor credit ordebit cards

We are a fair shop, with fair prices and honest repairs.



Now acceptingmajor credit or

debit cards


Call and ask about our LawnMower Specials

Push Mower: Oil, spark plugs, blades sharpened $25.00

Riding Mower: oil, oil -lter, sparkplug, blades sharpened $32.00

2 Cylinder Riding Mower: oil, oil -lter,spark plugs, blades sharpened $50.00

Time to winterizeyour car and getthose tires on before the winterweather is here.

5 QT. OIL CHANGE

$30.00(not synthetic oil)





We are a fair shop, with fair prices

and honest repairs.

Remember Free Tire Rotation with

Every Oil Change

Fluids also checked

APRIL SPECIAL

5 QT. OIL CHANGE$30.00

(not synthetic oil)

Free Tire Rotation

with Every Oil ChangeFluids also

checked






Hot weather is coming, makesure your car’s air conditioningworks!

Now acceptingmajor credit or

debit cards


We Sell New & Used Tires

for Auto & ImplementCheck Out Our

GREAT PRICES!

5 QT. OIL CHANGE

$30.00(not synthetic oil)

FFrreeee TTiirree RRoottaattiioonn wwiitthh EEvveerryy OOiill CChhaannggeeFFlluuiiddss AAllssoo CChheecckkeedd!!

Hot SandwichesPork Chop Sandwich $3.49Tenderloin Sandwich $2.49BBQ Pork Sandwich $2.49Pizza Burger $2.49BLT $2.99Grilled Cheese $1.29Grilled Turkey & Cheese $2.29Grilled Ham & Cheese $2.29

Hot FoodChili on Tue & Thur. $2.99/bowlChili dogs Tue & Thurs. $1.9912” Gino’s Pizza cooked to order$6.00 or $7.00 specialty pizza.Agatucci’s 12” pizzas for $8.99Mushrooms (10pc.) $2.99Chicken Strips (4 strips) $2.99(Hotn’spicy, peppered, or original)

Gizzards $1.59Buffalo Hot Wings $2.99Fries or Onions Rings $1.50Corn dogs (6 corn dogs) $3.09Alaskan Walleye (Wed & Fri) Call in order $0.79/pc or $3.99 dinner (roll & side of cole slaw or potato salad)

Cold SandwichesFresh Made to Order

Chicken Salad SandwichEgg Salad SandwichHam Salad Sandwich(Weighed to your taste).10 etra for each: lettuce, tomato,onion, & pickle

Chicken by the pieceBreast: $1.99Thigh: $1.39Leg: $1.09Wing: $1.09

Bucket of Chicken4 pc $5.398 pc. $8.7912 pc. $13.1916 pc. $17.5920 pc. $21.9924 pc. $26.3932 pc. $35.19Chicken Dinners (Includes roll &choice of potato salad or cole slaw)2 piece chicken dinner (1 dark, 1 white) $4.194 piece chicken dinner (2 dark, 2 white) $7.39We also offer a variety of deli salads& desserts served by the pound.

Fresh Coffee Daily

Call in your order 309-446-3401

Jim’s Shurfine131 W. Knoxville BrimfieldStore Hours: M-Sat 7am-9pm & Sunday 9am-6pm

JJIIMM’’SS SSHHUURRFFIINNEEDDEELLII MMEENNUU

27th Annual Spring Fling Gift & Craft ShowMarch 28th • 9am to 3pm

Millbrook Township Center • Laura, IL

For space info call Renee Britt 309-264-1681Karen Megan 309-446-3619

28th Annual

Holiday Craft & Gift ShowDecember 5th • 9am to 3pm

Millbrook Township Center • Laura, IL(4 ½ mi. North of I-74 on Rte. 78 - Exit 71 on I-74)

For information callRenee Britt 309-264-1681• Karen Megan 309-446-3619

Items include:Homemade candy & cookies,Christmas crafts, sweatshirts, hand painted wood

items, Christmas florals, wreaths, baskets, jewelry, crocheted items, scrubbies, blankets,

homemade rugs, greeting cards, yard ornaments,Pampered Chef, Pink Zebra, Thirty-One,Scentsy, Usborne childrens books, Perfectly

Posh, and much, much, more!Breakfast and Lunch Served by

the Laura Winners 4-H Club

Something for everyone!

Free Admission Door Prizes

FRITZ: Regret greater when unable to correctharmed (Steps 8 and 9 ifyou’re keeping track).

There is an importantcodicil there: you do notmake any amend thatwould harm another orwould intrude on theother person’s preferences(like the desire not to bebothered by you). I mademany amends and triedwith my former wife, butto no avail. She made itclear, through her ab-solute silence, she wantsno part of me.

Fair enough. I respectthat. After trying a fewtimes I gave up the ef-fort – long ago. It stillhaunts me though: That aperson who had the sameSocial Security number asme acted in those ways;ways that are so foreign tome now.

I no longer understandhow he lived his life,what he thought or howhe rationalized his exis-tence. Try as I might, Iabsolutely cannot put my-self in his shoes. Whatcould I have been think-ing? I have no idea. Butmore than that, I inflictedmyself on others, espe-cially my first wife, inways that were uncon-scionable.

I hope, since my firstday of sobriety, that Ihave lived a successfullife; that I have and willcontinue to make a contri-bution to humanity. Mostimportant, I think, is mytime teaching, which willend this May. For that jobI am grateful, as I am forthe past 32 years-plus of alife based on the philoso-phy of AA. Teaching stu-dents would not havebeen possible without so-briety. It is, far and away,the most important thing Ihave ever done.

Occasionally, otherscongratulate me for mysobriety. I wish theywouldn’t. What I havedone is attempted to livemy life the way all “ordi-nary” people do – nothingmore. In some ways I’mglad I went through a pe-riod in my life where I

had to critically examinethe failures of my pastand try to change the wayI lived. Successful peopledo that naturally. I had tohave it presented to me inminiscule steps.

But I’m certainly notgrateful for the way Itreated that youngwoman. She deservednone of what she got andwas put-upon by someonewho was nothing morethan a bully.

Adele reminded me ofthat regret and pain stillhover above me and willfor the rest of my life. Ideserve that regret andpain, and my greatesthope is that nobody elsehas to go through it.

Adele’s situation in“Hello” is that the personin her past continues tospurn her; that as much asshe’d like to talk aboutthe past, he wants none ofit. While she regrets her

inability to “right earlierwrongs,” he wants thepast left alone.

That inspires in her aneven greater sense of re-gret. I understand thatfeeling, and her new songhas focused me on my un-flattering past as I haven’tfor a long time.

To that woman (likeme, no longer young) Isay once more “I’msorry,” and I hope sheknows I mean it.


Answers on Page 14

. www.wklypost.comTHE WEEKLY POST • Thursday, November 26, 2015


BLACK HAWK: In need of ‘full conservation’now Conover Square, and bor-rowed a steam engine. Taftwrapped the entire thing in pipingand muslin and burlap in order toinsulate it, and started pouringagain.”

The pouring would resume onDec. 20 and continued with 28men working 12-hour shifts for 10days in sub-zero temperatures tocomplete the pour.

Now surrounded by scaffoldingand mostly wrapped in a plastictarp to shield it from the elementsand further damage, the statue isgetting attention from experts andhelp from volunteers.

“Despite several repairs andpatches over the decades, the now-104-year-old statue is in desperateneed of full conservation,” saidLandmarks Illinois earlier thisyear. “Its concrete body in someplaces is so deteriorated that if notaddressed immediately, there is arisk that the damage will quicklyaccelerate and the majority of itsoriginal details will be lost.”

The Black Hawk statue’s originis traced to the Eagle’s Nest, an artcolony created on what’s nowLowden State Park outside Ore-gon, about 100 miles west ofChicago.

There – on land then owned byChicago attorney Wallace Heck-man, a friend of Taft’s – the colonywas a summer retreat for Taft anda collection of various artists, ar-chitects, poets and Taft’s studentsfrom the Art Institute of Chicago.One of those students, John G.Prasuhn – a young sculptor withsome experience working withconcrete – became a vital partici-pant in “The Eternal Indian.”

Besides the Piano Factory steamengine (more common than gaso-line engines then), a second steamengine was borrowed from theCase Threshing Company to createan intricate and unusual heatingsystem for both the concrete andpink granite chips being pouredand also the mold receiving thematerial.

After the concrete cured throughthe winter, the statue’s coveringwas removed the following May,when the innovative methodsproved to have worked.

“You think back 100 years agoabout a statue to commemorateNative Americans, and that wasnot universally accepted,” saidFrank Rausa, a Sterling resident at

the forefront of getting the restora-tion done. “It was a work of artand it was an engineering feat,too.”

Now, Amy Lamb Woods ofSimpson, Gumpertz & Heger, aChicago engineering firm that spe-cializes in concrete restorations, iscontracted to do the work.

Woods has worked on other Taftworks, including “Alma Mater” atthe University of Illinois. Also in-volved is Andrzej Dajnowski ofConservation of Sculpture & Ob-jects Studio, Inc. in Forest Park,Ill., the project conservator.

“This time of year, we’re not atthe site,” Woods tells The WeeklyPost. “It’s slow right now. We’reworking behind the scenes, stillworking on the mix design to testfor strength and durability as wellas aesthetics.

“It sounds easy,” she adds,laughing. “It’s not.”

Earlier this year the statue wassteam-cleaned. Then – using laserscanners, 3D modeling, an audioprobe, and core samples for analy-sis – experts determined that partsof the statue in most need of atten-tion are the arms, the vertical foldof the blanket covering the figure,and areas beneath the arms.

Workers removed calcium de-posits and loose material from thestatue’s surface, and are mixingvarieties of cement and lime to in-ject into a few cracks to determinethe best blend.

“It got so bad, you could fit yourfinger into the cracks,” says Rausa.“It was falling apart.

“People ask me how it got sobad so fast, and I say, ‘Two words:polar vortex’,” he continues. “High

winds and severe temperatureshave played havoc. But there’snothing you can do about MotherNature.

“You have to just grin and bearit.”

Indirectly contributing to its de-terioration is state government,which still hasn’t passed a budget,Rausa says.

“We’ve been impacted by thestate budget,” he says. “No checkscan be cut, which set us back andposes other problems. Because ofthe delay we have to pay $75 a dayfor the scaffolding, which willmean another $20,000 or $30,000we didn’t anticipate. It’s frustratingdealing with the state.”

Additional funding is needed tofinish the job, Rausa says. In 2008,an original estimate for the workwas about $400,000, he says.

In the seven years since, materi-als and other costs have gone up somuch that the entire restoration isnow projected to cost $825,000.However, more than $700,000 hasalready been raised through grantsand donations.

Rausa hopes the work will becompleted by the middle of nextyear, noting that July 1 will be the105th anniversary of its originaldedication.

“At one point I thought it’d bedone Nov. 1,” he says. “Now I’mhoping against hope for next sum-mer.”

Woods is more tentative.“We’re anxious to get done,” she

says. “But it’s a slow process. Ifwe work too quickly, we could domore harm than good. But we’reglad for the public interest. Welove the project.”


Engineer Amy Lamb Woods is shown inserting an experimental mixtureinto a crack.

www.wklypost.com




Inspired by BlackHawk, leader of NativeAmericans’ Sauk tribe, thestatue Lorado Taft called“The Eternal Indian” wasbegun in 1908.

What eventually be-came a 48-foot tall monu-ment of sorts – and one ofthe world’s biggest con-crete statues – “The Eter-nal Indian” was madewith 412 barrels of Port-land cement hardened into238 cubic yards of con-crete with more than twotons of steel reinforce-ment.

It started as a Taftsketch, from which theElmwood native made aneight-inch plaster model.A Taft student from theChicago Art Institute,John G. Prasuhn, then cre-ated a 24-inch clay modelfrom which two plastercasts were made. He en-larged that to a 6-foot ren-dition.

On site, a 38-footwooden central tower wasconstructed, and an 8-footsteel reinforcing struc-ture – some eight inchesin diameter – was erectedfrom the base to theshoulder area.

Chicken wire helped

shape its curves, and 200yards of burlap were at-tached to create a surfacethat was then sprayedwith a thin plaster coat tostiffen the exterior, whichin turn was soaked withclay water to help releasethe mold from the con-crete to come.

The entire constructionwas enclosed in canvasand tin, and after frigidtemperatures caused adelay, two steam engineswarmed the mold, whichcontained concrete, graveland about 65,000 gallonsof water.

Concrete and coloredcement were poured intothe mold. Elsewhere, aderrick was built to lift thehead, sculpted separately,to the figure’s shouldersand neck.

The completed statue ishollow, between eight

inches and three feetthick, and is reinforcedwith iron rods.

Hailed as revolutionaryin concrete technology,“The Eternal Indian” wasfeatured in Prasuhn’s1912 story for ScientificAmerican, in which hecalled the original projectan “experiment.”

Over the decades, theartwork has endured po-tentially catastrophicmishaps (two earthquakesand a lightning strike).

It was named to the Na-tional Register of HistoricPlaces in 2009. This April,Landmarks Illinois addedthe Black Hawk statue toa list of the state’s MostEndangered HistoricalPlaces.

The wooded acreage onwhich it stands wasnamed Lowden State Parkin 1945. The statue at-tracts about 400,000 visi-tors a year, according tothe Illinois Department ofNatural Resources.

Black Hawk statue started as tiny model

Generac Automatic Standby GeneratorsGenerator Sales-Service-Installation

309-639-2400

Ingle

Steps during the statue's 1910 construction are shown in this IDNR file photo.



BRIEFS

Spain files petition tosucceed Leitch in House

PEORIA – Peoria CouncilmanRyan Spain announced his candi-dacy for Illinois State Representa-tive on Oct. 9 andon Monday filedhis nominatingpetitions to offi-cially seek theRepublican nomi-nation for the of-fice.

Monday wasthe first officialday for candidates to file their nom-inating petition for state office andSpain filed first thing with morethan 1,200 signatures, more thandouble the legal requirement forballot access in Illinois.

“I am proud to have such agroundswell of grassroots supportover the past six weeks since I an-nounced my candidacy,” Spainsaid. “To have so many more signa-tures than is required is extremelyhumbling and heartfelt. I am hon-ored to have heard from so many insupport of my seeking this office.”

The 73rd District Illinois Houseseat has been held by State Repre-sentative and Deputy RepublicanLeader David Leitch since 1989.Leitch announced his retirement atthe end of his current term in late2016, and officially threw his sup-port behind Spain as his successor.

Joining Leitch in signing and cir-culating Spain’s nominating peti-tions is newly elected RepublicanCongressman Darin LaHood aswell as numerous county, township,and local officials from throughout

the six counties in the 73rd District. Spain and his wife, Ashley, raise

their two-year-old daughter, Vivi-enne, in Peoria where Spain is VicePresident of Government Relationsfor OSF Healthcare System as wellas serving on the Peoria City Coun-cil since 2007.Cantu places first inVFW speech contest

ELMWOOD – Deanna Cantu ofElmwood took first place in theVFW of Illinois Voice of Democ-racy competitionin the 9th District,sponsored locallyby Archie MilesPost 4724.

Cantu’s topicwas “My Visionfor America.”

Cantu was thelocal winner and aCD of her speech was sent to the9th District to be judged along withentries from 26 other posts. Entrieswere judged on a 100-point basis:originality 30 points, content 35,delivery 35.

The CD will be entered in thestate contest.

Deanna will be honored alongwith the other district winners at abanquet in Springfield the secondSunday in February.

Her parents are Dean and Sandy.Mit Beres, who has been in-

volved with the competition for 50years, said this is the first time anentry from Elmwood won.Farmington TownshipOK’s 2015 tax levy

FARMINGTON – The Township

on Nov. 9 approved a 2015 tax levyof $112,500 for the Town Fund and$153,500 for the Road & BridgeFund.

In other business, Highway Com-missioner Paul Balagna reportedincreasing incidents of dumpingalong Township roads, and the Ful-ton County Sheriff’s Officer I mon-itoring the situation.

Also, the Township is continuingto haul cinders from Duck Islandand has already mixed about 75Tons of salt/cinder mix for storagefor this winter to accumulate about175 Tons of the preparation.

The Township has enough to mixan additional 150 Tons when morecinders become available.Radnor conferring witharchitect on building

RADNOR – Township Supervi-sor Phil Cornish and Trustee BobPrice are meeting with the Town-ship’s architect to review plans fora proposed building.

The Township in September ap-proved annexing the Townshipbuilding to the Village of Dunlapwith a zoning classification ofAgriculture.Et cetera

The Elmwood FFA chapter willbe selling fruit and cheese packagesas well as soy candles throughoutthe month of November.

Fruit and cheese will be availablefor pickup on Dec. 4.

All proceeds will be used to off-set both state and national conven-tion expenses.

To order, contact Tara LaFolletteat (309) 231-1713 or via email at|[email protected].

Spain

Cantu


THE WEEKLY POST • Thursday, November 26, 2015www.wklypost.com

By RON DIETERFor The Weekly Post

Most of us, gardeners or not, usethe terms “evergreen” and “conifer”interchangeably when referring totrees such as spruce, pine and fir.While these examples happen to fallinto both categories, not all conifersare evergreens and not all ever-greens are conifers.

The word conifer means “conebearing,” referring to the cone-likestructures that hold seeds for repro-duction. Most conifers are ever-greens, meaning they do not drop alltheir leaves (needles) annually. Twoexceptions are Larch and Cypress,which bear cones but shed all theirneedles in the fall.

Some of the smallest, as well assome of the largest woody plants onearth, are conifers. The oldestwoody plants living on earth areconifers, some more than 6,000years old.

Most, but not all, evergreens areconifers. Hollies, rhododendronsand some azaleas, as well as box-wood, are examples of broadleafevergreens that do not bear cones.

There are more than 500 speciesof conifers and thousands of vari-eties and cultivars. Hundreds areuseful as garden and landscapeplantings. Others, though often usedas foundation plants and gardenplants, grow into large-scale treestaking over a front yard or city lot.

Popular evergreens, such as yewsand junipers, are used by homeown-ers as foundation plants even though

they require constant shearing andwill outgrow their allotted space.

A wide selection of gardenconifers would offer a number ofbetter choices easier to care for. Theproblem is most nurseries and gar-den centers offer only yews and ju-nipers. And the slow growth rate ofmany smaller conifers makes themmore costly initially. Over the longrun, however, they earn their keepbecause they require little pruningand don’t outgrow their space.

The American Conifer Society hasdeveloped four categories ofconifers, based on rate of growthand mature size. A “miniature”conifer grows less than 3 inches an-nually and reaches a mature size of2 or 3 feet. A “dwarf” grows up to 6inches per year and tops out at 4 to 6feet. “Intermediate” conifers add 6to 12 inches of growth each year andmature at 6 to 15 feet, while “large”conifers grow at least a foot eachyear and will get at least 15 feet tall.

The current popularity of peren-nial gardens and “low maintenance”landscapes has led to a surging inter-est in garden conifers. As compan-ion plants in the perennial garden,conifers provide tremendous visualimpact, especially in winter whenmost perennial borders need all thehelp they can get.

Like perennials, many conifers gothrough seasonal color changes,sporting bright colors of yellow, redor white in spring and bearingbrightly colored cones later in theseasons. Garden conifers add inter-

est to the winter landscape with vari-ety of textures, colors and forms.Beautiful conifers can be found indramatic tall weeping forms, smallcompact globe shapes, with needlestipped in white or silver, or stripedyellow and green.

Luckily, there are four public col-lections of garden conifers in theMidwest, three of them within easydriving distance.

There’s a small collection at Illi-nois Central College in East Peoriaand another at the Quad City Botan-ical Center in Rock Island.

For a day trip, however, the one tosee is the Heartland Collection ofDwarf and Rare Conifers at Bickel-haupt Arboretum in Clinton, Iowa.There you'll find more than 400specimens displayed in a stunninglybeautiful garden setting.

The best garden conifer collectionin the Midwest, (many say it’s thefinest in the United States) is theHarper Collection at Hidden LakesGardens in Tipton, Mich., about asix- or seven-hour drive from here.

All four gardens were designedand donated by the late Justin“Chub” Harper, former superintend-ent of grounds at John Deere worldheadquarters in Moline. He was agood friend and a dedicated “cone-head.” The Hidden Lakes collectionwas his pride and joy. It will cer-tainly stimulate your interest andmaybe a little conifer or two willfind a way into your garden.

To learn more about conifers,visit conifersociety.org

Consider conifers for home landscapes



24001 W. Farmington Road, Farmington, IL 61531

AAuuttoo HHoommee BBuussiinneessss LLiiffee HHeeaalltthh

YYoouurr PPrrooffeessssiioonnaall IInnddeeppeennddeenntt IInnssuurraannccee AAggeennccyy

PPeegg BBiivveennss,, CCPPCCUUAgency Principal

113311 NN PPuubblliicc SSqquuaarreeKKnnooxxvviillllee

((330099)) 228899--44113377wwwwww..lleeaagg..bbiizz

CCaallll TTooddaayy!!

On Nov. 11, the Dahinda United Methodist Church honored area veterans at its monthly free CommunityTable dinner. Free dinners are held on the second Wednesday of each month. The next dinner is on Dec. 9.Everyone is welcome!

DAHINDA HONORS VETERANS

Brimfield board OK’s four-cent tax hikeBy TERRY BIBOFor The Weekly Post

BRIMFIELD — For the mostpart, thank the state and federalgovernments for a projected four-cent raise in the tax levy for localschools — and a possible increasein lunch prices, as well.

State payments have been slowto come, when they come at all.Yet Gov. Bruce Rauner has sug-gested tax caps which would limitBrimfield Unit School District309’s ability to raise the money itneeds locally.

“We want to make sure we getthe money that’s available to us,”Superintendent Joe Blessman saidat the Nov. 18 meeting.

So Blessman advised the boardto raise the Social Security levy bytwo cents. That’s in addition to atwo-cent increase in the bond levyto pay off the new high school.Those bonds will be paid off in2030.

Without comment, the board

unanimously approved the prelimi-nary tax levy estimate. At $4.78,the tax levy for schools in 2015-16is four cents higher than the cur-rent rate of $4.74. It’s still sevencents lower than the $4.85 in2012-2013, because of rising prop-erty values.

On the federal level, mandatedlunch programs are a big factor inhigher cafeteria costs. Board mem-ber John Moon asked if First LadyMichelle Obama – a proponent offresher foods and new nutritionalrequirements – is the reason thecafeteria budget is in the hole for$2,800. Blessman said the figuresaren’t “quite as devastating” asthey look. The new cafeteria pro-gram has increased costs and rev-enues are down. Efforts are beingmade to keep costs lower, butthat’s not enough.

“There’s probably going to be aconversation in the spring aboutraising the lunch price,” Blessmansaid, adding there was dismay that

in-house bread didn’t meet newfederal standards, “even thougheveryone thought it was fantastic.”

In other business, board mem-bers and teachers have been work-ing on new criteria so studentsdon’t have to take too many finalsin one day. Rather than just apply-ing to seniors, some exemptionsmay be available for other stu-dents. PSAE scores were used as abasis, but that test has been discon-tinued. Now the number of finalsand grades will be assessed in-stead, and parents will be informedin advance.

“We needed a new tool,” ex-plained board member ConstanceJohnson. “This is what we cameup with.”

The board entered executive ses-sion, apparently for ongoing dis-cussion about Blessman’s contract,which expires June 30.

TERRY BIBO can be reached [email protected].

ADVERTISE IN A NEWSPAPER PEOPLE READ!

Call (309) 741-9790


www.wklypost.com THE WEEKLY POST • Thursday, November 26, 2015

From Weekly Post Staff Reports

SPRINGFIELD –Hunters in Illinois har-vested a preliminary totalof 57,968 deer during thefirst weekend of the Illi-nois firearm deer season,Nov. 20-22, according tothe Illinois Departmentof Natural Resources.

That’s an increase fromlast year’s first firearmweekend harvest of51,830 – despite in-clement weather thatdropped as much as 17inches of snow on partsof northern Illinois.

Reports from checkstations in northern Illi-nois and from anecdotalhunter observations indi-cated that Friday’s firstday was particularlybusy.

Locally, hunters inPeoria County shot 735deer, up from 613 in

2014. Of those, 18 werekilled at Jubilee CollegeState Park where one ofthe 11 bucks shot was abig 10-pointer.

Knox County hunterstagged 830 deer (up from769 last year) and FultonCounty was at 1,391 vs.1,296 in 2014.

The second segment ofthe Illinois firearm deerseason is Dec. 3-6.

Other deer hunting op-portunities in the weeksahead include:

• Muzzleloader-Only

Deer Season is Dec. 11-13;

• Late-Winter Antler-less-Only and CWDDeer Seasons (first seg-ment) in select countiesonly on Dec. 31, 2015-Jan. 3, 2016;

• Late-Winter Antler-less-Only and CWDDeer Seasons (secondsegment) in select coun-ties only on Jan. 15-17,2016;

• Archery Deer Seasoncontinues through Jan.17, 2016.

Shotgun deer harvest increases

MERRICK FLOORCOVERING, INC.

Carpet • Vinyl • HardwoodLaminate • Ceramic

116 E. Main St., Elmwood, IL 61529(309) 742-8608JOE MERRICK

PROFESSIONAL INSTALLATION

Tim Linnshot thishuge non-typicalbuck in Jo-DaviessCountyduring thefirst Illinoisfirearmseason.



OBITUARIESHenry Bastian

KICKAPOO – Henry AnthonyBastian, infant son of Alex “A.J.”and Kelsey (Wikoff) Bastian ofEast Peoria and great-grandson ofa Kickapoo couple, died Nov. 13 atUnityPoint Health-Methodist.

He is survived by his parents;maternal grandparents, Joe andShananne Buehler of East Peoria;paternal grandparents Jeff andJoan Bastian of Peoria; great-grandparents, Dick and SharonDwyer of Kickapoo, Jerry andNancy Bastian of Peoria, DonnaWeeks of Peoria, and MargaretWikoff of Peoria; and severalaunts, uncles and cousins.

Private services were planned.Condolences may be left online at

www.deitersfuneralhome.com.Ricky W. Howe

BRIMFIELD – Ricky Howe, 61,of Brimfield, died Nov. 16 at hisresidence.

Survivors include his mother,Evelyn (Baysingar) Howe; brotherRandy Howe (Ken Nowak) of Ot-tawa; aunt Bernadine Miller;cousins Sherry (Eddie) Wall, Ericand Brad Wall; niece Shannon(Curt) Gass; great-niece VictoriaGass; and great-nephews, Curtisand Justin Gass.

Ricky worked in the auto bodyshop at Metz Ford in Farmingtonfor many years. He also enjoyedgardening and drag racing.

Burial was planned for SwanLake Memory Gardens in Peoria.

Condolences may be left online atwww.oakshinesfuneralhome.com.

Cheryl KnussmanPRINCEVILLE – Cheryl A.

Knussman, 61, of Trivoli, sister ofa Princeville woman, died Nov. 17at the OSF Richard L. Owens Hos-pice Home in Peoria.

Survivors include her husband,Gary Knussman; daughter Anna

(Scott) Butler of Oceanside, Calif.;sister Pam (Matt) Price ofPrinceville, brothers John(Christina) Schoon of Midland,Texas, and James (Susan) Schoonof Tucson, Ariz.; and parents Johnand Ann Schoon of Glasford.

Cheryl worked and later volun-teered at Christ Lutheran School inPeoria, and farmed with her hus-band. She attended Trivoli UnitedMethodist Church in Trivoli.Cheryl was a Bible study teacherand loved to study God’s word.

Services were Nov. 21 at TrivoliUnited Methodist Church in Triv-oli, with burial at Trivoli Ceme-tery.

Condolences may be left online atwww.sedgwickfuneralhomes.com.

Jane LewisPRINCEVILLE – Jane Ann

Lewis, 86, of Princeville died Nov.16 at Heritage Manor NursingHome in Chillicothe.

Jane was born May 29, 1929, inMonica, the daughter of Otto andHattie Sears Kneer. She marriedWayne Lewis on June 9, 1948, inPeoria. He died Nov. 19, 1983, in

Peoria.She also was preceded in death byone son, David Lewis; three broth-ers, Sandford “Sandy” Kneer,Willis Kneer and Carl Kneer; andone sister, Genevieve Powers.

Survivors include sons Gary(Sandra) Lewis and Brian (Shelly)Lewis, both of Princeville; twodaughters, Suzanne (Tom) Smithof Peoria and Lori (Troy) Birch-field of Omaha, Ark.; seven grand-children; three great-grandchildren;and one brother, Tom Kneer ofLubbock, Texas.

Jane was a homemaker. She de-voted her life to her family andwas a loving wife, mother, grand-mother and friend.

Cremation was accorded and amemorial service held Nov. 22 atHaskell-Hott Funeral Homes inPrinceville, with burial of ashes atPrinceville Cemetery.

Condolences may be left online atwww.haskellhott.com.

Marvin MasonELMWOOD – Marvin G.

Mason, 88, of East Moline, fatherof an Elmwood man, died Nov. 15at the home of his daughter in Mo-line.

Dora Mason, his wife of 67years, died Sept. 30, and a memo-rial service for Marvin and Dorawas Nov. 21 at Brimfield Evangel-ical Free Church in Brimfield.

Survivors include son WilliamLee (Janet) Mason of Elmwood;daughter Cynthia (Tom) Mahr ofMoline; grandchildren Eric Masonof Pekin, Jeremy (Erin) Mason ofRock Island and Jenna Mahr ofRock Island; great-grandchildWhitney Flaugh of Rock Island;brother George (Marilyn) Masonof Pekin; and sister Evelyn Mc-Clintick of Chillicothe.

Condolences may be left online atsullivanellisltd.com.

This Week’s Obituaries• Henry Bastian, infant, Kick-apoo• Ricky W. Morse, 61, Brimfield• Cheryl Knussman, 61, Trivoli• Jane Lewis, 86, Princeville• Marvin Mason, 88, Elmwood• M. Betty Pulliam, 82, Farming-ton• Merle Ritthaler, 89, Edwards• Marilyn Roth, 86, Edwards• Stuart A. Schrodt, 76, Dahinda• LaVerne Turner, 92, Brimfield

We print basic obituaries forfree. Longer obituaries cost $1per column inch;$5 per picture.Call (309) 741-9790.

Donna Brewer, Local Representative (309) 742-4661

Mon-Fri 9-4; Sat 9 to noon

PUZZLE ANSWERS

Spencer Curtale, OwnerServing All of Central Illinois

Residential • Commercial • FarmFree Estimates!

309-691-0276 office 309-222-1152 cell

www.wklypost.com



OBITUARIESM. Betty Pulliam

FARMINGTON – Martha E.“Betty” Pulliam 82, of Meadows,formerly of Farmington, died Nov.8 at Meadows Mennonite Retire-ment Community in Meadows.

Survivors include her husbandCharles R. Pulliam; children Paula(Frank) Frangella of Oak Forest,Curtis (Joni) Pulliam of Utica,N.Y., and George (Pam) Pulliam ofCumming, Ga.; and four grand-children.

Betty was a graduate of FloraHigh School and was employed asa bank teller in Flora; Hanna Cityand Canton for many years. Shewas an active member of theAmerican Baptist Church.

Cremation rites have been ac-corded. A memorial service will beheld at 11 a.m. on Friday (Nov. 27)at the Meadows Mennonite Retire-ment Community Chapel in Mead-ows, with Pastor Jane Roeschleyofficiating.

Visitation will be one hour priorto the service, also at the chapel inMeadows.

Condolences may be left online atwww.duffypilsmemorialhome.com.

Merle RitthalerEDWARDS – Merle K. Rit-

thaler, 89, of Morton, grandfatherof an Edwards woman, died Nov.17 at The Villas of Holly Brook inMorton.

Survivors include his wife of 67years, Myrtle Martin; daughterJeanne (Tony) Rogers of Morton;son Marc (Lorelei) Ritthaler ofTyler, Texas; grandchildren Kim(John) McCormick of Edwards,Brian (Michelle) Rogers of Mor-ton, Cory (Lindsay) Ritthaler ofDallas, Texas, Justin (Danielle)Ritthaler of Baltimore, Md., Mindi

(Jeremy) Dunckel of Houston,Texas, and Marc Tyler Ritthaler ofTyler, Texas; 10 great-grandchil-dren; and two brothers, Robert Rit-thaler of Live Oak, Fla., andArthur Ritthaler of Morton.

A funeral service was Nov. 23 atGrace Church in Morton, with bur-ial at Roberts Cemetery in Morton,with military rites.

Condolences may be left online atvisit www.knappjohnson.com.

Marilyn RothEDWARDS – Marilyn R. Roth,

86, of Roanoke, sister of an Ed-wards woman, died Nov. 19 at theRoanoke Apostolic ChristianHome.

Survivors include sister Dorothy“Dot” (John) Hoerr of Edwards;children Steve (Jill) Roth, Dan(Patty) Roth, Shirley (Ty) Gille-spie, Sherry Roth, Charlene (Jerry)Sander and Todd (Jill) Roth, all ofArizona.

She was preceded in death byher parents, two brothers, Melvinand Donald “Doc.”

Marilyn worked at Ulrich’sManufacturing in Roanoke and atPeople's State Bank in Roanoke.After retirement her wish was toopen a tea room and she openedIsch’s Tea Room in Metamora.

Funeral services were Nov. 23 atRoanoke Apostolic ChristianChurch, with burial at the churchcemetery.

Condolences may be left online atknappjohnsonharris.com.

Stuart A. SchrodtDAHINDA – Stuart A. Schrodt,

76, of Abingdon, stepfather of aDahinda man, died Nov. 20 at OSFSt. Francis Medical Center in Peo-ria.

Survivors include his wife Mari-

lyn and stepsons Dan Gordon ofDahinda and Donald Gordon andDavid Gordon, both of Abingdon.

He graduated from AbingdonHigh School. He worked at thePool Hall as a teenager. He laterworked at Eagles and Kroger gro-cery stores. He managed the for-mer Citgo gas station in Abingdon.He became a ham radio operatorfor many years. He enjoyed oldcars and also raced motorcycles atCordova in his early adult years.

Graveside services were Nov. 23at the Abingdon Cemetery.

Online condolences may bemade at www.h-p-w.com.

LaVerne TurnerBRIMFIELD – LaVerne A.

Turner, 92, of Peoria, mother of aBrimfield man, died Nov. 20 atManor Court in Peoria.

She married Merle F. Turner Sr.on Aug. 27, 1949, in Peoria. Hepreceded her in death on Feb. 1,1999. She was also preceded indeath by twin infant daughters,Barbara K. and Peggy Jo in 1953;one great-granddaughter, MorganDaisy Peterson; and one brother,Oliver J. Loeb Jr.

Survivors include sons Merle F.(Vicky) Turner Jr. of Brimfield andStephen M. (Mary Pat) Turner Sr.of Dunlap and daughter Denise(Stephen) Fuller of Peoria; sevengrandchildren; eight great-grand-children; and one great-grand-daughter on the way in February.

A funeral Mass was Nov. 25 atSt. Mary Catholic Church in Kick-apoo. Entombment will be in Res-urrection Mausoleum.

Condolences may be left online atwww.wrightandsalmon.com.

BRIMFIELDSt. Joseph

Catholic ChurchFather John Verrier314 W. Clay, Brimfield(309) 446-3275

www.stjosephbrimfield.orgSat. Confession: 3:30-4:45 pm

Sat. Mass: 5 pmSun. Mass: 10:30 am

Daily Mass: Tues.-Fri. 8 am

St. Paul’s Lutheran Church

The Lutheran Church - Missouri Synod

“Preaching Christ Crucified”“Liturgical & Reverential”Pastor Michael Liese

204 W. Clay St., Brimfield(309) 446-3233

Sun. Divine Service: 10 am

Brimfield E-Free ChurchPastor Donald Blasing11724 Maher Road

Brimfield, IL 61517(309) 446-3571

www.brimfieldefree.orgWorship: 10:30 am

Sunday School: 9:30 amAWANA - Wed. 6:15 pm, for

ages 3-12

Brimfield UnitedMethodist Church

Pastor Leonard Thomas135 S. Galena St., Brimfield

(309) 446-9310Sun. Worship: 9 amSun. School: 9 am

Thurs. Bible Study: 7 pm

Union Church at BrimfieldUnited Church of ChristPastor Stephen Barch

105 W. Clay Street, Brimfield(309) 446-3811

Sunday Worship: 9 amTuesday Bible Study: 6:30 pmFirst Sunday each month isCommunion Sunday (gluten

free communion offered)EDWARDS

Bethany Baptist Church7422 N. Heinz Ln., Edwards

(309) 692-1755www.bethanycentral.org

Sat. Evening Worship: 6 pmSun. Worship 8:15 & 11 amWednesday Awana: 6:15 pm

Christ Alive! Community ChurchPastor Lance Zaerr

9320 W US Hwy 150, Edwards(309) 231-8272

www.christalivecc.comSun. School: 9:15 amWorship: 10:30 am

ELMWOODCrossroads Assembly of God

Pastor Tim Cavallo615 E. Ash St., Elmwood

(309) 830-4259www.crossroadselmwood.org

Wed. Worship: 7 pm

Sun. Worship: 10:30 am

Elmwood Baptist ChurchPastor Dennis Fitzgerald

701 W. Dearborn St., Elmwood(309) 742-7631, 742-7911 Sun. School: 9:30 am

Sun Worship: 10:30 am, 6 pmWed. Prayer Meeting: 7 pm

First Presbyterian Churchof Elmwood

Reverend Marla B. Bauler201 W. Evergreen, Elmwood

(309) 742-2631firstpresbyterianofelmwood.orgSun. Worship: 10:30 amSun. School: 9:30 am

St. Patrick’sCatholic ChurchFather Paul Stiene

802 W. Main St., Elmwood(309) 742-4921

Sat. Confession: 3:45 p.m.Sat. Mass: 4:30 p.m.

Sun. Mass: 10 amTues. Rosary: 8:15 am

United Methodist Church of Elmwood

Pastor Bradley F. Watkins II821 W. Main St., Elmwood

(309) 742-7221www.elmwoodumc.org

Sun. Worship: 9 am, 10:30 amYouth Sun. School: 9 amAdult Sun. School: 8 am

FARMINGTONFirst Presbyterian Church

of FarmingtonReverend Dr. Linda Philabaun83 N. Cone Street, Farmington

(309) 245-2914www.firstpresfarmington.comSunday School: 9:30 amFellowship: 10:30 amWorship: 11:00 am

New Hope FellowshipAssembly of GodPastor Tom Wright

1102 N. Illinois Route 78Farmington

(309) 245-2957Sun. Worship: 10 amWed. Worship: 7 pm

PRINCEVILLEPrinceville UnitedMethodist ChurchPastor Ken Dees

420 E. Woertz, Princeville(309) 385-4487

[email protected]. Worship: 9 am

Sunday School: 10:15 am

YATES CITYFaith United

Presbyterian ChurchReverend Marla B. Bauler

107 W. Bishop St., Yates City(309) 358-1170Worship: 9 am

Sun. School: 10:15 amThurs. Choir: 7 pm

AREA CHURCHES

Newell’s Auction & Farm Realty(309) 358-1218

NEW LISTING: 7305 Twp Rd 625E, Toulon is a 3 BR, 1.5Bath Ranch on 5+ Acres! Full walkout basement, sunroom,whole house generator, geo-thermal heat/AC, and 50’x30’ shed!½ mile south of Stark Co. High School. Must see!

Priced at . . . $182,500REDUCED: 511 Happy Hollow Dr., Dahinda is a 2 BR, 2Bath Ranch with full walkout basement located in small pri-vate lake community. Newer kitchen and baths. Appliancesincluded. NEW Price ... $69,000

Color Photos at www.williamsfield.org

Debbie Newell, Broker/Sales Ron Newell, Broker/Auctioneer

Call (309) 741-9790 for a Prize!

The family of Dale Broadfield Sr.Would like to thank everyone for the

love and support shown to us during theloss of our beloved husband , father and

grandfather. Your sympathy andthoughtfulness is deeply appreciated.

Elizabeth BroadfieldMike, Denise, Allison & Kyle Slater, Dale Broadfield Jr.

•Floral Arrangements •Quilts Braided Rugs •Snowmen •Towels

Door Prizes!((330099)) 669966--00668822

Urish’sOpen House517 S. Apple St. Farmington

December 2, 3, & 410am – 5pm



CLASSIFIED AND LEGAL ADS - Call (309) 741-9790FOR SALE

• HOME GYM: Nautilus

NS200 Home Gym. Excellent

condition, used very little.

Originally $1500 asking $500.

Cash only-you pick up. Seri-

ous inquires only. (309) 222-

1850.

• WOODEN TABLE: Antique

wooden drop-leaf table. Good

shape. $50 OBO. (309) 231-

3350.

• PODIUM: Wooden podium

with light. Bargain. Make an

offer. (309) 231-6040.

• EGGS: Edwards fresh cage-

free brown eggs. $3 per

dozen, delivered to Elmwood

Community Center on Mon-

days at 11:30 am. Must call

ahead to reserve. (309) 251-

9814.

• DUCK BOAT: Otter Stealth2000 duck boat, 12 feet longby 44 inches wide, 1-piecepolyethylene construction,stable, $650. (309) 741-9790.

HELP WANTED• PHONE SALESPERSON:Part-time advertising sales po-sition. Good phone skills amust. Previous sales experi-ence a plus. Flexible hours.Call (309) 231-6040.

• AD SALESMAN: Part-timeadvertising salesman needed.Flexible hours. This will not bean in-office job, but will in-stead involve face-to-facesales calls. Call (309) 741-9790.

WANTED• HUNTING LAND: Seeking

land to lease for waterfowl,

turkey or deer hunting. (309)

231-6040.

LEGAL NOTICEIN THE CIRCUIT COURT OF THE TENTH JUDICIAL CIRCUIT

OF ILLINOIS PEORIA COUNTY

FARMERS STATE BANK, an Illinois )Banking Corporation, )

Plaintiff, )

vs. ) CASE NO.: 15-CH-143

REYNOLDS THEATRES )ENTERTAINMENT, INC., VERNON )O. REYNOLDS, CITY OF ELMWOOD, )ILLINOIS, UNKNOWN OWNERS and )NONRECORD CLAIMANTS, )

Defendants. )

REAL ESTATE FOR SALEPUBLIC NOTICE is hereby given that pursuant to a Judgment of Foreclo-sure entered in the above entitled cause on October 26, 2015, the Sheriff ofPeoria County, Illinois, will on December 9, 2015, sell to the highest bidderfor cash, the following described mortgaged real estate:

Property 1:A part of Lots Numbered Two (2) and Three (3), in Block Lettered“R”, in the Town (now City) of Elmwood as laid out by William J.Phelps, described as commencing at the Northwest corner of saidLot Numbered Two (2); running thence East Fifty (50) feet; thenceSouth Eighty (80) feet; thence West Fifty (50) feet; thence NorthEighty (80) feet to the place of beginning; situated in the County ofPeoria and State of Illinois;

Commonly known as 122 West Main Street, Elmwood, Illinois61529

P.I.N.: 11-07-435-001

Property 2:Twenty-five (25) feet off the South side of Lot Fifteen (15) andSeven (7) feet off the North side of Lot Eighteen (18), both inJONES FIRST ADDITION to the City of Canton; ALSO

One hundred (100) fee Two and one-half (2 ½) inches off the Westend of the following: a part of Lot Fifteen (15) in JONES FIRST AD-DITION to Canton, described as follows: commencing Twenty-five(25) feet North of the Southeast corner of said lot, running thenceWest to the West line of said lot, thence North Twenty-three feet two(2) inches, thence East to the East line of said lot to a point Twenty-three (23) feet two (2) inches North of the Place of Beginning,

thence South to the Place of Beginning, including the right andeasement to use and enjoy jointly with the owners of the propertiesadjoining said premises on the North and South the party walls onthe North and South line of said premises and subject to the use ofsaid party walls by said adjoining owners; and including also theright and easement to use and enjoy, as a party wall, jointly with theowners of the East Eighty-one (81) feet three and one-half (3 ½)inches of the North Twenty-three (23) feet two (2) inches of theSouth Forty-eight (48) feet two (2) inches of said Lot Fifteen (15)the brick wall running North and South along the East end of saidOne hundred (100) feet two and one-half (2 ½) inches, half ofwhich said brick wall is included in said One hundred (100) feet twoand one-half (2 ½) inches, together with the right to extend saidwall vertically, said wall and any vertical extension thereof to bemaintained at the expense of the owners of said West One hundred(100) feet two and one-half (2 ½) inches; reserving, however, to theowners of the East Eighty-one (81) feet three and one-half (3 ½)inches of the North Twenty-three (23) feet Two inches of the SouthForty-eight (48) feet two (2) inches of said Lot Fifteen (15) a right-of-way Four feet in width, clear of walls and other permanent ob-structions, across the North side of said West One hundred (100)feet two and one-half (2 ½) inches, and running from the alleyalong the West side of said Lot Fifteen (15) to the building locatedon the East Eighty-one (81) feet three and one-half (3 ½) inches ofthe North Twenty-three (23) feet two (2) inches of the South Forty-eight (48) feet two (2) inches of said Lot Fifteen (15), said right-of-way to be used and enjoyed in perpetuity jointly by the owners ofboth of said properties, and in such manner as not to interfere withthe use and enjoyment of either of said owners, and shall be keptpaved with concrete at the expense of the owners of said West Onehundred (100) feet Two and one-half (2 ½) inches, situated in theCounty of Fulton and State of Illinois;

Commonly known as 62 North Main Street, Canton, Illinois 61520

P.I.N.s: 09-08-27-412-007 and 09-08-27-412-009

The improvements on the properties consist of a commercial building oneach property.

Sale terms: 10 percent down on the day of the sale by certified funds, bal-ance within 24 hours by certified funds. No refunds.

The property will NOT be open for inspection.

For information call Plaintiff’s attorney, Jennie C. Boswell, 129 North Wal-nut Street, P.O. Box 445, Princeville, Illinois 61559; Phone: 309.385.4616.

Dated: November 26, 2015

LEGAL NOTICEIN THE CIRCUIT COURT OF THE TENTH JUDICIAL CIRCUIT

OF ILLINOIS PEORIA COUNTY

FARMERS STATE BANK, an Illinois )Banking Corporation, )

Plaintiff, )

vs. ) CASE NO.: 15-CH-143

REYNOLDS THEATRES )ENTERTAINMENT, INC., VERNON )O. REYNOLDS, CITY OF ELMWOOD, )ILLINOIS, UNKNOWN OWNERS and )NONRECORD CLAIMANTS, )

Defendants. )

NOTICE OF FORECLOSURE SALEPUBLIC NOTICE is hereby given that pursuant to a Judgment of Foreclo-sure entered in the above entitled cause on October 26, 2015, the Sheriff ofPeoria County, Illinois, will on December 9, 2015, at the hour of 1:00 o’-clock P.M. in Room 203, Peoria County Courthouse, Peoria, Illinois, sell tothe highest bidder for cash, the following described mortgaged real estate:

Property 1:A part of Lots Numbered Two (2) and Three (3), in Block Lettered“R”, in the Town (now City) of Elmwood as laid out by William J.Phelps, described as commencing at the Northwest corner of saidLot Numbered Two (2); running thence East Fifty (50) feet; thenceSouth Eighty (80) feet; thence West Fifty (50) feet; thence NorthEighty (80) feet to the place of beginning; situated in the County ofPeoria and State of Illinois;

Commonly known as 122 West Main Street, Elmwood, Illinois61529

P.I.N.: 11-07-435-001

Property 2:Twenty-five (25) feet off the South side of Lot Fifteen (15) andSeven (7) feet off the North side of Lot Eighteen (18), both inJONES FIRST ADDITION to the City of Canton; ALSO

One hundred (100) fee Two and one-half (2 ½) inches off the Westend of the following: a part of Lot Fifteen (15) in JONES FIRST AD-DITION to Canton, described as follows: commencing Twenty-five(25) feet North of the Southeast corner of said lot, running thenceWest to the West line of said lot, thence North Twenty-three feet two(2) inches, thence East to the East line of said lot to a point Twenty-three (23) feet two (2) inches North of the Place of Beginning,

thence South to the Place of Beginning, including the right andeasement to use and enjoy jointly with the owners of the propertiesadjoining said premises on the North and South the party walls onthe North and South line of said premises and subject to the use ofsaid party walls by said adjoining owners; and including also theright and easement to use and enjoy, as a party wall, jointly with theowners of the East Eighty-one (81) feet three and one-half (3 ½)inches of the North Twenty-three (23) feet two (2) inches of theSouth Forty-eight (48) feet two (2) inches of said Lot Fifteen (15)the brick wall running North and South along the East end of saidOne hundred (100) feet two and one-half (2 ½) inches, half ofwhich said brick wall is included in said One hundred (100) feet twoand one-half (2 ½) inches, together with the right to extend saidwall vertically, said wall and any vertical extension thereof to bemaintained at the expense of the owners of said West One hundred(100) feet two and one-half (2 ½) inches; reserving, however, to theowners of the East Eighty-one (81) feet three and one-half (3 ½)inches of the North Twenty-three (23) feet Two inches of the SouthForty-eight (48) feet two (2) inches of said Lot Fifteen (15) a right-of-way Four feet in width, clear of walls and other permanent ob-structions, across the North side of said West One hundred (100)feet two and one-half (2 ½) inches, and running from the alleyalong the West side of said Lot Fifteen (15) to the building locatedon the East Eighty-one (81) feet three and one-half (3 ½) inches ofthe North Twenty-three (23) feet two (2) inches of the South Forty-eight (48) feet two (2) inches of said Lot Fifteen (15), said right-of-way to be used and enjoyed in perpetuity jointly by the owners ofboth of said properties, and in such manner as not to interfere withthe use and enjoyment of either of said owners, and shall be keptpaved with concrete at the expense of the owners of said West Onehundred (100) feet Two and one-half (2 ½) inches, situated in theCounty of Fulton and State of Illinois;

Commonly known as 62 North Main Street, Canton, Illinois 61520

P.I.N.s: 09-08-27-412-007 and 09-08-27-412-009

The improvements on the properties consist of a commercial building oneach property.

Sale terms: 10 percent down on the day of the sale by certified funds, bal-ance within 24 hours by certified funds. No refunds.

The judgment amount was $180,772.82.

The property will NOT be open for inspection.

For information call Plaintiff’s attorney, Jennie C. Boswell, 129 North Wal-nut Street, P.O. Box 445, Princeville, Illinois 61559; Phone: 309.385.4616.

Dated: November 26, 2015

ANNUAL STATEMENT OF AFFAIRS SUMMARYFOR FISCAL YEAR ENDING JUNE 30, 2015

Copies of the detailed Annual Statement of Affairs for the Fiscal YearEnding June 30, 2014 will be available for public inspection in the schooldistrict/joint agreement administrative office by December 1, 2015. Indi-viduals wanting to review this Annual Statement of Affairs should contact:

WILLIAMSFIELD COMMUNITY UNIT SCHOOLS DIST. 210325 W. Kentucky Ave., Williamsfield, IL 61489

309-639-2219Office hours: 7:30 am to 3:45 p.m.

Also by January 15, 2016, the detailed Annual Statement of Affairs for theFiscal Year ending June 30, 2015, will be posted on the Illinois State Board ofEducation’s Website @ www.isbe.net.SUMMARY: The following is the Annual Statement that is required to be

published by the school district/joint agreement for the past fiscal year.Statement of Operations as of June 30, 2015:Local Sources: Educational 2,781,702; Operations and Maintenance

333,580; Debt Services 7; Transportation 232,629; Municipal Retirement/So-cial Security 138,916; Capital Projects 169,014; Working Cash 0; Tort 72,906;Fire Prevention & Safety 1,027.Flow-Through Receipts/Revenues from One District to Another District:

Educational: Educational 0; Operations and Management 0; Transportation 0;Municipal Retirement/Social Security 0.State Sources: Educational 193,745; Operations and Maintenance 0; Debt

Services 0; Transportation 80,694; Municipal Retirement/Social Security 0;Capital Projects 0; Working Cash 0; Tort 0; Fire Prevention and Safety 0.Federal Sources: Educational 100,767; Operations and Maintenance 0;

Debt Services 0; Municipal Retirement/Social Security 0; Capital Cash 0; Tort0; Fire Prevention and Safety 0.TOTAL DIRECT RECEIPTS/REVENUES: Educational 3,076,214; Operations

and Maintenance 333,580; Debt Services 7; Transportation 313,323; Munici-pal Retirement/Social Security 138,916; Capital Projects 169,014; WorkingCash 0; Tort 72,906; Fire Prevention and Safety 1,027.TOTAL DIRECT DISBURSEMENT/EXPENDITURES: Educational 3,296,141;

Operations and Maintenance 442,136; Debt Services 0; Transportation282,944; Municipal Retirement/Social Security 161,820; Capital Projects259,890; Tort 77,470; Fire Prevention and Safety 0.Other Sources/Uses of Funds: Educational 0; Operations and Maintenance

0; Debt Services 0, Transportation 0; Municipal Retirement/Social Security 0;Capital Projects 415,000; Working Cash 0; Tort 0; Fire Prevention and Safety0.BEGINNING FUND BALANCES July 1, 2014: Educational 2,398,027; Opera-tions and Maintenance 1,032,335; Debt Services 20,248; Transportation593,018; Municipal Retirement/Social Security 9,381; Capital Projects239,431; Tort 0; Working Cash 4,274; Fire Prevention and Safety 38,055.Other Changes in Fund Balances: Educational (49,590); Operations and

Maintenance 0; Debt Services 0; Transportation 0; Municipal Retirement/So-cial Security 0; Capital Projects 0; Working Cash 0; Tort 0; Fire Prevention andSafety 0.ENDING FUND BALANCES - June 30, 2015: Educational 2,128,510; Opera-

tions and Maintenance 923,779; Debt Services 20,255; Transportation623,397; Municipal Retirement/Social Security (13,523); Capital Projects563,555, Working Cash 0; Tort (290); Fire Prevention & Safety 39,082.

Gross payment for Certificated Personnel:Salary range Less than $25,000: Susan Beebe, Brenda Dexter, Rachel

Eberle, Ivy Engebretson, Nadine Farquer, Sharon Farquer, Trevor Foley,William Fritz, Amanda Gibson, Patrick Hise, Alberta LaFollette, Barbara Mc-Connell, Kali Mustain, Kyle Mustain, Briana Nannen, Nancy Niebuhr, MaxOlson, Megan Robbins, Susan Ross, Carla Sanders, Cathy Shover, RobertTasker, Jeffrey Taylor, Jorja Thiel, John Van Nieuwenhuyse, Connie Wight,Rachel Williams, David Wilson.Salary range $25,000 - $39,999: Robert Anderson, Marcy Brugger, Cyn-

thia Fuller, Tami German, Tyson Hart, Kirk Mustain, Joseph Newman, AmandaPyrcik.Salary range $40,000 - $59,999: Amy Blackhurst, Amy Buss, Jenni Davis,

Elizabeth Klein, Connie Krans, Victor Mahnesmith, Becky Nichols, RebeccaRappenecker, Jana Sims, Brooke Traphagan, Kathleen Wight.Salary range $60,000 - $89,999: Ann Banks, Zachary Binder, Becky

Blankenship, Sandra Boucher, Brenda Bridson, Cathryn Ren, R. Kent Rigg, J.Robert Ross, Lori Secrist, Starla Yelm.Salary range $90,000 and over: Tim FarquerGross Payment for Non-Certificated Personnel:Salary range Less than $25,000: Diana Biddle, Jody Booth, Brenda Brid-

son, Mary Kay Bronny, Kelly Brooks, Alexsia Brown, Dixie Brown, NancyBrown, Norma Brown, Marcy Brugger, Lucinda Chandlee, James R. Clark,John Clark, Lorie Collopy, Stephanie DeWitt, Brenda Dexter, Jo A. Dykeman,Melissa Ehnle, Nadine Farquer, Andrew Fritz, Hannah Gilles, Patrick Godsil,Myrl Gray, Tyson Hart, Wendi Hughs-Benson, Cyndi Johnson, Willard Kimler,Kadance King, Travis King, Jeanie LeRoy, Kirk Mustain, Joseph Newman,Darrin Peterson, Kari Powell, Amanda Pyrcik, Vicki Quick, Annette Sams,George G.R. Secrist, Samuel Secrist, Jana Sims, Haley Smith, Richard Staker,Timothy Stewart, Dana Tucker, Michael Weitekamp, Connie Witt.Salary range $25,000 - $39,999: Lisa Bohannan, Mark Chandlee, Deborah

Clifford, Pamela Courson, Wendy Doubet, Julie Strom.Salary range $40,00 - $59,999:Margaret Allen, Michael Chandlee, Russell

Groeper, Richard Hartz, Melinda Philbee.Payments over $2,500, excluding wages and salaries:JourneyEd.com

2,504, Alpha Baking Co. 2,729, IL Power Marketing 2,745, Ameren Il 22,264,Apple Computers 24,532, Baird Insurance Co. 3,608, Blue Cross Blue Shield340,967, B&D Halls Plumbing, Inc. 10,236, Ruby Bledsoe 12,150, Blucker,Kneer & Assoc. 6,200, Breedlove’s Sporting Goods 24,666, Brimfield Bank250,000, Brimfield Hardware 13,609, Broadleaf, Inc. 15,441, BSN Sports3,297, Card Center 20,890, CDW Government, Inc. 100,851, Central IL EpoxyLLC 23,331, Central Restaurant Products 40,375, Central States Bus Sales3,449, Collopy Trucking 6,865, Consolidated Plastics 12,824, Ed Conlee SonsConcrete 750, DP Industrial Supplies 6,040, Dreambox Learning 3,475, DuraWax Company 4,035, IRS/SSA 79,862, Eplastics 3,119, Flex Court Athletics6,087, Four Seasons 24,910, Fox River Foods 5,417, Galesburg Electric3,557, Galley, Inc. 21,618, GECRB/Amazon 13,395, Glenroy, Inc. 8,931,Charles R. Goodin 24,999, Gopher 3,137, G.P. LLC 17,800, Grainger 13,220,Hanson Industrial, Inc. 3,325, Fred & Norma Hartz 14,782, Heartland SchoolSolutions 7,072, H & H Industries, 4,980, Illinois Assoc. of School Boards2,848, IMRF 82,179, Johnstone Supply 14,574, Shirley Kellstadt 2,569,Knox-Warren Special Education 26,878, Kohl Wholesale 40,447, LaFolletteEarthmoving 8,108, Lehman Plumbing, Inc. 3,743, Lowes 17,731, LoweryMcDonnell Co. 7,813, McGraw-Hill School Education 2, 540, MBS BuildingSupplies 70,099, Mechanical, Inc. 4,258, Menards 21,024, Midwest BusSales 73,200, Mid Century Telephone 5,385, Miller, Tracy, Braun, Funk15,537, David Plunk, Music Makers 2,703, Nasco 6,337, Newman Plastering10,362, Nextera Energy Services 29,110, Nichols Diesel Service 6,256, OfficeSpecialists 12,922, Peoria Brick Co. 11,167, Phillips & Associates, Inc.72,775, Prairie Farms 13,036, Prairie Pella 5,610, Promaxima Manufacturing5,495, QBE 7,938, Quill 12,722, Richard Ramadon 5,585, Rask Transporta-tion 3,740, RE Powered, Inc. 3,998, West Central FS 29,274, School Specialty3,183, Selective Insurance 92,973, Sherwin Williams 4,025, Spoon RiverLandscape LLC 15,084, Standard Insurance Co. RC 3,332, Standard DentalInsurance Co. 19,039, Stahl Lumber Co. 21,119, Staples Credit Plan 3,238,T.H.I.S. Fund 28,749, Titan Industries 3,845, Trotter General Contracting175,373, Teachers Retirement System 235,971, Tyco Integrated Security, LLC5,783, Walsworth Publishing 6,401, Williamsfield Water Department 3,634,Webstaurant Store 6,422, Wells Fargo Financial 21,504, Wight Chevrolet9,631, Wigand Disposal 5,390, Wilson Paper Co. 5,299

www.wklypost.com



CLASSIFIED AND LEGAL ADS - Call (309) 741-9790

NOTICE OF INTENTION OFCOMMUNITY UNIT SCHOOL DISTRICT NUMBER 326PEORIA, MARSHALL AND STARK COUNTIES, ILLINOISTO ISSUE $2,000,000 WORKING CASH FUND BONDS

PUBLIC NOTICE is hereby given that on the 10th day of Novem-ber, 2015, the Board of Education (the “Board”) of Community UnitSchool District Number 326, Peoria, Marshall and Stark Counties,Illinois (the “District”), adopted a resolution declaring its intentionand determination to issue bonds in the aggregate amount of$2,000,000 for the purpose of increasing the Working Cash Fund ofthe District, and it is the intention of the Board to avail of the provi-sions of Article 20 of the School Code of the State of Illinois, and alllaws amendatory thereof and supplementary thereto, and to issuesaid bonds for the purpose of increasing said Working Cash Fund.Said Working Cash Fund is to be maintained in accordance with theprovisions of said Article and shall be used for the purpose of en-abling the District to have in its treasury at all time sufficient moneyto meet demands thereon for expenditures for corporate purposes.

A petition may be filed with the Secretary of the Board (the “Sec-retary”) within thirty (30) days after the date of publication of thisnotice, signed by not less than 263 voters of the District, said num-ber of voters being equal to ten percent (10%) of the registered vot-ers of the District, requesting that the proposition to issue saidbonds as authorized by the provisions of said Article 20 be submit-

ted to the voters of the District. If such petition is filed with theSecretary on or before the 14th day of December, 2015, an electionon the proposition to issue said bonds shall be held on the 15th dayof March, 2016. If such petition is filed with the Secretary withinthirty (30) days after the date of publication of this notice and afterthe 14th day of December, 2015, an election on the proposition toissue said bonds shall be held on the 8th day of November, 2016.The Circuit Court may declare that an emergency referendumshould be held prior to either of said election dates pursuant to theprovisions of Section 2A 1.4 of the Election Code of the State of Illi-nois, as amended. If no such petition is filed within said thirty (30)day period, then the District shall thereafter be authorized to issuesaid bonds for the purpose hereinabove provided.

By order of the Board of Education of Community Unit SchoolDistrict Number 326, Peoria, Marshall and Stark Counties, Illinois.

DATED this 10th day of November, 2015.

Susan HeflerSecretary, Board of Education,Community Unit School District Number 326, Peoria, Marshall and Stark Counties, Illinois

Darin CowserPresident, Board of Education,Community Unit School District Number 326, Peoria, Marshall and Stark Counties, Illinois

DEPARTMENT OF NATURAL RESOURCESOFFICE OF REALTY & ENVIRONMENTAL PLANNING

DIVISION OF CONCESSION & LEASESNOTICE OF SEALED BID PROPOSALS FOR FARM LEASING

Sealed bid proposals for farm leasing will be accepted by theDepartment of Natural Resources, on one lease, approximately195 acres, of CRP and agricultural farm ground. The acreage is lo-cated near Jubilee College S.P. Bid forms and related informationwill be discussed at a Mandatory Vendor Conference to be con-ducted by the Department of Natural Resources at the site office atJubilee College S.P., located at 13921 West Route 150, BrimfieldIL 61517 at 10:00 a.m., December 9, 2015. The State publishesprocurement information, including updates, on the Illinois Pro-curement Bulletin (IPB) at www.purchase.state.il.us. Prospectivebidders will need to download and print the necessary forms fromeither the Agency Website atwww.dnr.illinois.gov/procurement/Pages/default.aspx) or the IPB

prior to the vendor conference.

Bids and supporting documents are due by 2:00 p.m., Decem-ber 23, 2015 to: Department of Natural Resources, Attn: AnnFletcher, One Natural Resources Way, Springfield IL 62702. Bidswill be opened at that time. Public may attend the bid opening.The farm lease shall be awarded to the responsive, responsible,qualified bidder with the highest price.

The State of Illinois, Department of Natural Resources, shall notunlawfully discriminate on the basis of race, color, sex, nationalorigin, age or handicap in admission to, or treatment or employ-ment in, programs or activities.

The Department of Natural Resources reserves the right to rejectany or all proposals.

BY ORDER OF THE DEPARTMENT OF NATURAL RESOURCESWayne A. Rosenthal, Director

TRIVIA TEST By Fifi Rodriguez1. GENERAL KNOWLEDGE: When didThanksgiving become a national holi-day in the United States?2. TELEVISION: What TV show fea-tured neighbors named Lenny andSquiggy?3. GEOGRAPHY: Which of the GreatLakes is located entirely within theUnited States?4. MOVIES: What 19th-century novelwas the movie “Clueless” looselybased upon?5. MEASUREMENTS: What measure-ment is used to determine the heightof a horse?6. SCIENCE: What instrument is usedto measure atmospheric pressure?7. ANIMAL KINGDOM: What is a babyturkey called?8. FAMOUS QUOTATIONS: What sci-ficharacter once said, “Do. Or do not.There is no try”?9. MUSIC: Which Christmas carol be-gins with the lyric “City sidewalks,busy sidewalks, dressed in holidaystyle”?10. MEDICAL TERMS: What is thecommon name for aphthous ulcers?

Answers1. 18632. “Laverne & Shirley”3. Lake Michigan4. “Emma,” by Jane Austen5. Hands (one hand equals four inches)6. Barometer7. A poult8. Yoda, in “The Empire Strikes Back”9. “Silver Bells”10. Canker sores(c) 2015 King Features Synd., Inc.

FOR ANSWERS SEE PAGE 14

MOVIES1. Spectre (PG-13) 2. The Peanuts Movie (G) 3. Love the Coopers (PG-13)4. The Martian (PG-13) 5. The 33 (PG-13) 6. Goosebumps (PG) 7. Bridge of Spies (PG-13) 8. Prem Ratan Dhan Payo (NR) 9. Hotel Transylvania 2 (PG) 10. The Last Witch Hunter (PG-13) 2015 King Features Synd., Inc.

STOPTHE

AD TAX

STEWART’S FAMILY RESTAURANT

Tuesday-Sunday6-2

Closed Monday• Full Menu• Breakfast All Day • We Can Accommodate

Large Groups• Home Style Cooking

309-362-240818925 West Farmington Rd.Trivoli, IL



BOYS: Swearingen tallies 17 points

ALL SPORTS ROUNDUP

Senior tackle BradNovak of Brimfield wasthe lone area player tabbedfor the Illinois FootballCoaches Association all-state teams.

Novak, a 6-foot-8, 290-pounder for the Elmwood-Brimfield Trojans, wasnamed to the 18-playerClass 3A team.

Novak has been re-cruited by Illinois StateUniversity and is also con-sidering attending the U.S.Naval Academy.

Stark County had a pairof Class 1A all-staters:lineman McCauley John-ston and running backChase Johnston.• Junior high – Farm-

ington reached the final ofits own IESA 7-3A girlsbasketball regional onMonday before falling toHavana, 54-26.

No. 2 seed Farmingtondowned Avon-Abingdonin the semifinals 45-33.

In 7-2A girls action,Princeville’s No. 2 seeded

squad played MossvilleTuesday night in the 7-2Aregional at Mossville.

Elsewhere, Brimfieldwon its opener against St.Thomas (33-8) and thenfell to No. 2 seed IlliniBluffs (37-19).

Elmwood’s seventh-grade team won its openerover St. Vincent de Paul(31-17) and then fell totop-seed Lewistown Cen-tral (39-5).Email information to

[email protected].

B-E tackle Novak a 3A all-stater

which was also without a top scorer.Picking up the slack for Groeper were

sophomore Vince Lenzi (14 points and12 rebounds(, junior Jake Roberts (12points, 8 boards) and senior Jake Har-low (10 points). Elmwood (2-0) also gotnine points from freshman starter JacobBrown.

“Roberts and Vince really got after iton the boards and we played well,”Fugitt said. “But we showed our youth,particularly on defense.”

Then on Tuesday the Trojans won 60-59 as a last-second basket by Annawanwas ruled after the buzzer. Roberts had21 and Groeper was back for 15. Elm-wood meets Midland Friday at 7 p.m.and Wethersfield Saturday at 8:30 p.m.

FarmingtonSenior Trey Swearingen had 17 points

and sophomore Judd Anderson added 16as the Farmers routed North Fulton, 51-28, in the opener of the Tip-Off Tourna-ment at Astoria. The Farmers playLewistown at 7 p.m. Friday and thetournament concludes Saturday.

ROWVA-WilliamsfieldA 67-37 win over Galva to open the

ROWVA/Williamsfield InvitationalTournament was not enough to relaxcoach Bob Anderson.

“We didn’t look real good doing it,”said Anderson, who is leading the first-year co-op. “We’ve got a long way to goto get everyone acclimated to our styleof play.”

Ricky McCreary and Garrett Wightled the Cougars with 12 points apiece.

The Cougars play West Central Fridayat 8, Henry on Saturday at 8 and thenface United Monday (Nov. 30) at 8.


Members of the Princeville varsity boys basketball team for 2015-16 are:Back Row (left to right) Asst. coach Tait Sennett, Justin Janssen, Jadon Ben-ningfield, Griffin Headley, Will Feucht, Keegan Conrad, Noah Bauman,Coach Jeff Kratzer, Asst. coach Chris Bergschneider. Front Row (l to r) Mar-shall Martin, John Remmert, Matt Thole, Nick Kraft, Brendan Streitmatter andWeston Bridson. Photo by Collin Fairfield.

PRINCEVILLE BASKETBALL 2015-16

Members of the Princeville varsity girls basketball team for 2015-16 are:Back Row (left to right) Coach John Gross, Kaitlyn Boland, Madison Boland,Sydney Ladd, Lucy Waid, Breana Bauman, Maddie Hite and Paige Lane.Front Row (l to r) Marisa Horton-Meza, Jessica DeVries, Claire Berchtold,Natalie Cokel, Karlen Sandall and Madison Roe. Photo by Collin Fairfield.

www.wklypost.com



GIRLS: Farmington 1-3 at Fulton Co. tourney

12 MonthsSame

As Cash!

Expires November 31, 2015

Sophomore K. Hamptonand freshmen GraysonRynearson and MontanaLedbetter came in to giverest to the regulars.

The Lady Trojansstarted in man-to-mandefense but quicklyswitched to an aggres-sive 2-3 zone, ending thefirst quarter with a 15-13advantage. The teamsstayed close for most ofthe second quarter withElmwood playing well,except at the free throwline.

A Meyers rebound,full-court layup and freethrow got the Lady Tro-jans out to a 26-19 leadat the 2:54 mark. A Jonesjumper with 1:50 leftmade it 29-21, where itstayed until the halftimemark.

Berg and Meyerstraded baskets to start thethird quarter. A MorganLedbetter three at 5:16widened the Elmwoodlead to nine, and aLaFollett to Meyers passsoon after got the advan-tage to double digits.

A 5-0 Midwest Central

run in the middle of thequarter would turn out tobe their last stand in thegame, as Berg wouldsoon pick up her fourthfoul. Meyers, Lafollett,Jones and Morgan Led-better would all score forthe commanding 45-32third-quarter difference.

When Berg re-enteredearly in the fourth, toeventually finish with 19,it was too late. MWCwent to a full-court manpress, but Elmwood ex-panded the lead as theywere easily able to getthrough the pressure. Atthe 2:27 mark MidwestCentral put up the whiteflag by clearing thebench.

“Early in the game wefound Allie with goodpasses, then as she re-ceived pressure from thedefense, she passed off toMorgan, Jordan, Regan,and Grace for scores,”Meyers said. “It’s obvi-ously a long season, butwe’re doing good things,and I’m also happy withthe help we’re gettingfrom sophomores andfreshmen.”

FarmingtonFarmington went 1-3

at the Fulton CountyTournament. CoachJimmy Jordan’s youngteam finished off in ahard-fought loss to SouthFulton, 50-42, asMeghan Wherley ledwith 11 points, followedby nine from Rylie Pu-trich.

The Lady Farmers’ wincame in a 42-23 trounc-ing of North Fulton. Go-to post player MeganGilstrap scored 15, andAbbey Brown had nine.

A 66-24 loss to top-seed Canton did at leastprovide a learning expe-rience for the youngteam. Gilstrap had six,and Julia DePriest andPutrich each scored five.

The team’s opener wasagainst Lewistown asFarmington battled towithin four in the thirdquarter, but Lewistownwent on an 8-0 run toend the period. Lewis-town finished with a 52-38 victory.

“I feel we grew upover the course of theweek and got better.

Having a young team,we stress to trust theprocess, and experiencewill be the best way toget better,” Jordan said.“Free throws are ourbiggest issue at this time.We were 45 for 106 inthese games. We’re play-ing aggressive in gettingto the line, so we need tofinish by making theshots.”

BrimfieldA power outage called

off games Saturday at theBrimfield Turkey Tour-nament.

Last Friday, Brimfield(2-0) beat Wethersfield53-43 behind 16 pointsfrom Kenzie Schlipf and13 more from NicoleThurman.

The girls play Fridayvs. Princeville at 3 p.m.and Saturday against Ke-wanee at 3:30.

PrincevilleThe Lady Princes (1-1)

topped Kewanee 40-34last Friday at the Brim-field Turkey Tournament.

Princeville is back inaction at the Brimfieldtournament this Fridayagainst Brimfield at 3p.m. and then Saturdayvs. St. Bede at 12:30p.m.


Swami Sez ...Stark champs!Stark County overcame snow,

power outages, playing a“home” game at Dunlap onSunday, and a tough OttawaMarquette team to make it intothe state championship.

They will play at 10 a.m. onBlack Friday in DeKalb for theClass 1A title.

Even more impressive is the46-yard field goal right before

half that turned out to be thewinning score for the Rebels inthe 10-7 game. An NFL kickerwould be proud to make one thatlong in those conditions.

Stark County will face Arcolafor all the marbles. The Swamiwill make his final prediction of2015 and say the Rebels comeaway as State Champs! Stark

County 28-21.

TheSWAMI

ADVERTISE IN A NEWSPAPER PEOPLE READ!

Call (309) 741-9790

Weekly Post Sports www.wklypost.comTHE WEEKLY POST • Thursday, November 26, 2015


Hot news tip? Want to advertise?Call (309) 741-9790

Text Your Scores To (309) 231-6040 or [email protected]

Boys hoops teams start strongBy JEFF LAMPE

Weekly Post Staff Writer

Three of the four area boysbasketball teams won theirseason openers Monday.

Here’s a look at how theteams fared.

BrimfieldCarson Cuevas is gone, but

his replacements at guard puton a good show in the openerfor the defending state cham-pions. Phelan Kelly had 15points and Koby Whiteadded 11 as Brimfield rolledPrinceville 56-36 in theopener of the BrimfieldThanksgiving Tournament.

Brimfield bombed in 10 3-pointers en route to winningits 21st straight game.

Nick Kraft led Princevillewith 10 points.

Brimfield plays Friday at 5p.m. against Tremont andSaturday at 6 vs. Eastland.

Princeville plays Friday at6:30 vs. Eastland.

ElmwoodThe big news at the start of

the opener was that the Tro-jans would be without lead-ing scorer Isaiah Groeper.

“He had to complete all his

official requirements for en-listing in the NationalGuard,” explained coachJosh Fugitt. “It was all out ofhis control.”

The big news as Elm-

wood’s first game at theWally Keller Invitationalcontinued, was that the Tro-jans played well enough toupend Bureau Valley, 56-41,

Elmwood girls out to 4-1 startBy PHIL JOHNSON

For The Weekly Post

ELMWOOD – The Elmwoodgirls basketball team opened itshome schedule in style on Mon-day against Midwest Central andpreseason small school player ofthe year candidate Lisa Berg.

Elmwood won plenty of battleswith Berg and also claimed thewar in a 57-36 decision that uppedthe Lady Trojans to 4-1.

“I was happy that we put pres-sure on Berg under the basket, andalso we took the ball to her, get-

ting her into foul trouble in thesecond half,” Elmwood coachGregg Meyers said.

Allie Meyers scored Elmwood’sfirst 12 points on her way to ateam-high 21, and then got goodhelp from Jordan Jones’ 14 andMorgan Ledbetter’s 10.

Without starter Rachel Jacob-son, who had to leave school ear-lier in the day due to illness,Grace LaFollett and Regan Mc-Fall made big contributions on de-fense and passing.

Senior guard Koby White had 11 points for Brimfield in aseason-opening 56-36 win over Princeville. Photo by MonteKenney of Brimfield Sports Shots.

Continued on Page 18

Despite snowyconditions,numbers wereup during thefirst weekendof shotgundeer huntingin Illinois andseveral bigbucks were re-ported. Thatincluded thismonster shotby Kyle Essexof Trivoli inFulton County.For details,see Page 13.

BIG BUCK DOWN

Continued on Page 19

the weekly post 11/26/15

Documents