the weekly post 1/7/16

RURAL BOXHOLDERLOCAL P.O. BOXHOLDER

****************ECRWSS*****

PRSRT. STD.U.S. POSTAGE PAIDElmwood, Illinois

Permit No. 13

Carrier Route PresortThursdayJan. 7, 2016

Vol. 3, No. 43

The Weekly Post“We Cover The News of West-Central Illinois With A Passion”

Serving the fine communities of Brimfield, Dahinda, Duncan, Edwards, Elmwood, Farmington, Kickapoo, Laura, Monica, Oak Hill, Princeville, Williamsfield and Yates City

FREE!Compliments of

Our Fine Advertisers!

Hot news tip? Want to advertise?Call (309) 741-9790

By JEFF LAMPEWeekly Post Staff Writer

ELMWOOD – Normally, only par-ents are smiling when Christmasbreak draws to an end. But for achange, even junior high students inElmwood had a reason to grin asthey headed back to school.

That’s because Tuesday was theunveiling of Elmwood’s new juniorhigh addition on the school’s south-west corner. While various odds andends remain unfinished inside andoutside the building, the bulk of theapproximately $1.7 million projectwas completed by D. Joseph Con-struction of Peoria on time in lessthan six months.

On Tuesday, students and teacherswere buzzing about the 2,700-square-foot expansion and the re-model of another 4,000 square feetof the old junior high.

Decorated in shades of blue andgray, the addition includes six bright,new classrooms, a computer lab, a“virtual high school” room for stu-dents who are taking online classes,a conference room, new restroomsand several storage rooms and clos-ets. There is also a new main office.

And the old office is being convertedinto a classroom.

“I’m really pleased about it,” Su-perintendent Chad Wagner said.“Obviously, any time you move intosomething new, there’s things thatstill need to be done. But (the con-tractors) have done a really good joband the kids are in and it’s exciting.

“This is a big deal, not just for ourstudents but for the whole commu-

nity. And the community has reallybeen supportive of this.”

Wagner said an open house to for-mally unveil the new facility to thecommunity will be scheduled laterthis winter, possibly by late Januarybut more likely in February. Untilthen, he welcomed community mem-bers to pay a visit.

“I think they are really going to

By BILL KNIGHTFor The Weekly Post

FARMINGTON – Four men from Farming-ton, Elmwood and Peoria have been indictedby a Peoria grand jury on obstructing justicecharges stemming from a fatal truck accidentlast spring.

A fifth man is scheduled to go on trial nextmonth in connection with the death of 22-year-old Josh Fuller of Trivoli. In April, Fullerdied as a result of injuries sustained when atruck driven by Dillon Nolan, 22, of HannaCity crashed near the intersection of McClel-lan and Claybaugh Roads outside Elmwood,officials said.

Nolan faces charges of reckless homicide,driving under the influence, obstructing justiceand leaving the scene of an accident, accord-

Elmwood opens new junior high

Area men indictedin connection withfatal April accident

Billtown plansfor new year


WILLIAMSFIELD – With the new yearcomes new plans, and the Williamsfield VillageBoard on Monday drafted a list of projects for2016.

“We’ll be limited somewhat by funds, but Ihope we’ll be able to do as much as possible,”said Board President Mick Gray. “We’ll seewhat we can get accomplished in 2016.”

On the Board’s list are renovating VillageHall and Veterans Park’s bandstand; workingwith the Daughters of the American Revolutionto have Caldwell Cottage open more regularly;constructing a pathway to the new library;scheduling a maintenance program and replace-ment for major equipment; setting up job de-scriptions and evaluations for the Village’sworkers, all of whom are part-time, at-will em-ployees; and addressing water system issues,from replacing meters and mapping shutoffs toupdating collection procedures.

Also possible are a few other park projects.Andy Fritz of the park board said three pro-

posals for Doubet-Benjamin Park are forthcom-ing before budget discussions start:

• a miniature golf course funded with private

Continued on Page 9

Continued on Page 2

Continued on Page 2

While work continues outside the windows of the new Elmwood Junior High School addition, students listen to teacherCindy Alcaraz, who for the first time is teaching in a classroom with windows. The new rooms were put to their first useTuesday. Photo by Jeff Lampe.

Work is still ongoing to complete a new entryway on the west side of the Elm-wood school and to grade topsoil. But students were able to use new class-rooms in the junior high addition on Tuesday.

www.wklypost.comTHE WEEKLY POST • Thursday, January 7, 2016

We Cover The News of West-Central Illinois With A Passion

BILLTOWN: New pavilion in park?donations,

• an electrical upgrade and possible ad-ditional service; and

• a new pavilion and service road.“We hope to work with the Park Asso-

ciation, the Village and the FFA AlumniAssociation,” he said, “and we’ll belooking into grants, too.”

Details, including cost estimates willbe presented in the next month or two, hesaid.

Budget-wise, the Village’s finances re-main strong, Gray said.

“We’re still doing well there [in thegeneral fund],” he said. “Operations andMaintenance is positive.”

The water fund showed $121,000 inrevenue and $114,000 in expenditures,

and Doubet-Benjamin Park had $8,000in revenue and $3,700 in expenditures,according to the financial report.

“The state did send some [Motor FuelTax] money,” Gray added. “They’re stillbehind there.”

In other news:• the Village’s new water-system gen-

erator is installed and connected, but iswaiting on Ameren to hook up a gas lineand a fence to be finished before it’s op-erational, which should be this month;

• resident Ruth Ann Herman during apublic-comment period clarified that herfamily opposes a proposal to close someof Kentucky Avenue, which was sug-gested by the School District;

• and the next Recycle Day was sched-uled for Saturday, Feb. 27.

Continued from Page 1

INDICTMENT: Warrants issued for 4ing to court records.

Warrants stemmingfrom the indictmentswere issued last week forJames Kosner, 22, ofPeoria; Cotyjo Milliman,21, of Elmwood; MichaelWilson, 21, of Farming-

ton and William Zamaro,28, of Farmington.

Zamaro was arrestedDec. 31 and transportedto the Peoria County Jail.

Prosecutors accuse thefour of lying aboutFuller’s medical condi-tion or how they ended

up with Nolan’s truck.An area resident on

April 16 reported to thePeoria County Sheriff’sOffice that there was de-bris in a field. Fuller,who Fulton CountyCoroner Steve Hines saidprobably died at thescene from blunt forcetrauma, was found themorning after the crash ata house on Mill Street inFarmington.

Nolan told police helost control of his truckwhen a tire blew out.

Fuller was a passengerin the vehicle.


www.wklypost.com


THE WEEKLY POST • Thursday, January 7, 2016

THE WEEK AHEAD

This Week’s Eventss NAMI Meeting – NAMI Mental Ill-

ness Education Meeting is today (Jan. 7)from 7-8:30 p.m. Located at ICC North,Poplar Hall, Rm. 129. Topic is Medica-tions for Mental Illness, speaker is Dr.Jane Larouche.

s Free Bread – Freebread available at Elm-wood UnitedMethodist Church Fri-day (Jan. 8) at 10 a.m.

s Craft Time – Wintermug craft time is Sat-urday (Jan. 9) at Morrison and MaryWiley Library in Elmwood from 9a.m.- 1 p.m.

s Coloring Adults – Adults welcomeat Brimfield Public Library on Tuesday(Jan. 12) from 12-7 p.m. to color stressaway. Supplies provided.

Future Eventss Family BINGO – Family BINGO is

Jan. 14 at Morrison and Mary Wiley

Library in Elmwood at 6 p.m. Regis-tration required, call (309) 742-2431.

s Fiction Addiction – Teens welcomeat Brimfield Public Library on Jan. 14from 3-4 p.m. to talk about books,movies, music and get advance copies

of soon-to-be releasedbooks. s Math Club – Kids

grades K-8 welcome toBrimfield Public Li-brary on Jan. 19 from1:30-2:30 p.m. to playmath games. s Ladies Craft – Ladies

18 and older welcome to make T-shirttotes on Jan. 21 at Morrison and MaryWiley Library in Elmwood at 6:30p.m. Registration required, call (309)742-2431.

s Chili Contest – Whitney’s WalkChili Cook-Off Jan. 23 at 5:30 p.m. $5for endless bowl to taste all entries.Hot dogs and brats also. Silent auction,live auction. Call (309) 446-9678.

Publicize Your EventCall us at (309) 741-9790

or email information aboutyour upcoming event [email protected].

HOT PICKS This Week!s Blood Drive – A blood drive is Monday (Jan.

11) at St. Patrick’s Catholic Church in Elmwoodfrom 12:30 to 5:30 p.m. For an appointment, visitredcrossblood.org or call 1-800-733-2767.

s Community Table – All local families invited toDahinda Methodist Church Wednesday (Jan. 13)at 6 p.m. for a free supper. Free meals continuethe second Wednesday of every month. Menu forthis month is chili bar with fixin’s.

310 N MAGNOLIA, ELMWOOD Enjoy thisspacious4BDR, 1.5BAtwo storyhome closeto downtownElmwood &schools!Great eat-in kitchen, oversized 2 car garage & cozy frontporch! Brand-new furnace! REDUCED TO $112,000

506 W. ASH, ELMWOODImmaculate 2 BDR ranch, att. garage, large living

room, eat in kitchen, all appliances stay plus great backyard all in nice location! $79,900

505 N. PINE ST., WILLIAMSFIELDGreat 3-BDR, 3-BA ranch, walkout located on almost 1

acre! $175,000

RESERVE YOUR LOT NOW!New golf course lots and others! $18,000 to $42,500

PENDING

616 N. Magnolia, Elmwood

496 Hwy. 18, Yates City

CURRENT PRICES: (NOTE: All Prices Subject to Change Without Notice)• Aluminum cans ...... $0.35 • Shredder material .... $20 per nt• Unprepared Iron ..... $40 per nt, $50 per nt (over 1000 pounds) • Prepared Iron ......... $70 per nt, $80 per nt (over 1000 pounds)

WE BUY SCRAP METAL!

Located on Illinois Route 78, 1.5 miles south of Canton • Hours: Mon-Fri 8 am - 4 p.m. • (309) 668-3217 • hitchcockscrapyard.com

112014-02743AC

Bradly Coyle 5005 American Prairie Dr

Peoria IL309-689-2981

Chris Peterson 12924 W Farmington Rd

Hanna City IL309-565-7313

309-265-8558 cell

Travis Lewis 4718 N Sheridan Rd

Peoria IL309-686-7050

309-922-0905 cell

David Vaughan 114 W Main StElmwood IL

309-742-2411309-712-3575 cell

Insurance can be confusingYou can always trust your COUNTRY Financial representative to answer all your questions in a timely manner with answers you can understand. Call today for a free, no-obligation Insurance and Financial Review.

Of guns, warm birds in trees & nice lights

The late Paul Harvey used to say,“You can’t un-ring a bell.” The firsttime I heard it, Ididn’t know whathe meant. Now, Iknow.

There was amusic teacher ina school districtwhere I oncetaught who foundhimself in abunch of trouble. The teacher was ahappily married man with kids of his

own. He loved his family, he lovedhis job of teaching kids how to playmusic, and he loved his students aswell. He was tough when he neededto be, yet gentle as he found the hid-den musical talents of his students.

Dan Fogleberg, whose father wasa music teacher, once wrote aboutthis seemingly oppositebehavior,calling it his father’s “thun-dering velvet hand.”

One day, a student’s parents calledthe school district. They were claim-ing that their daughter had been in-

appropriately touched by the musicteacher during a private lesson dur-ing the school day. Not only hadtheir daughter been touched, but fiveother girls came forward with thesame claim.

The district immediately sus-pended the teacher, despite hisclaims that he would never think ofdoing something like that. He wasdevastated. Everyone in town startedlooking at him differently, talkingbehind his back, and sometimes



The Weekly PostThe Weekly Post is published every Thursday (except the last

weeks of December and June) by Lampe Publications LLC, 115W. Main St., Elmwood, IL 61529. All phone numbers listed are in area code (309).

Postmaster - Send address changes to The Weekly Post, P.O.Box 745, Elmwood, IL 61529Phone - 741-9790 Fax - 741-9365Email - [email protected] Hours - Mon-Wed 9-3, Thurs 9-12, Fri 9-3News - Jeff Lampe 231-6040, [email protected] - Shelly Brodine 741-9790 Advertising - 741-9790Subscriptions - Subscriptions $50 for 50 issues. Deadlines - News due Tuesdays by noon. Retail ads and classi-fieds due Mondays by noon.

Quotable – “And I claim I'm not excited with my life any moreSo I blame this town, this job, these friendsThe truth is it's myself” – Modest Mouse

Illinois Press Association Member

There’s just no way to unring a bell

JonGALLAGHER

Continued on Page 7

Rambling through central Illinoispondering if anybody will ever beatMom’s rhubarb pie.

uuu“Welcome back!” Nah. “Where

have you been you lazy bum?” Yes,we took a week off over the holi-days to sleep, eat cookies and enjoy

life. But wepromise, nomore breaks untilthe end of June.So buckle up. ...Taking a stanceon either side ofthe gun issuewill raise the ireof someone, andGeorge Tanner’s

anti-gun missive rankled readers, asyou will see on the following page.Just to reiterate our letter policy. Ifyou send a letter that is anonymousor asks that your name not be pub-lished, we will not print that letter.

uuuAmong the many reasons I enjoy

real Christmas trees is their manypost-holiday uses. Surely you’veseen crappie anglers trolling aroundtown, waiting for trees to be put outto the street. The trees provide fan-tastic short-term fish cover in lakeswhen sunk to the bottom. But withman-made habitat much more com-mon, trees are not in such great de-mand. Not to worry. Evergreensalso provide wonderful habitat forsmall birds. I place ours in a corner

of the yard (near one of neighborLinda Sager’s many bird-feedingstations). On a cold day, sparrowspack into that tree like you can’t be-lieve. Once spring arrives, the treeserves yet another purpose – there isno better fire starter than an ever-green that has been drying out forfour months. Gas doesn’t burn anyquicker. ... Another year, I simplydumped the tree by the burn pile. Arabbit moved in, casting one morevote for real trees.

uuuMy favorite Christmas lights,

aside from Gene Wilson’s showcase,was a simple round corn cribadorned with lights west ofPrinceville on a farm place ownedby Jim Bird. It was a welcome sightdriving to the Princeville HolidayTournament. ... Another hornetemerged this week. Don’t tell. ...Parting shot: The answer is, no.

Contact Jeff Lampe at 231-6040 [email protected]

JeffLAMPE

150 Main StreetCanton, IL 61520

cantonharvesterinn.com309-357-5820 Fax 309-357-5821

Jean L. StoneOperations Manager

Mike CecilFinancial Advisor3430 W Willow Knolls Dr.Peoria, IL 61614Office 309-693-3019Cell 309-357-1001

[email protected] www.edwardjones.com

I hope each of you has had a goodyear and terrific Christmas season –both have been better for me than Ianticipated a year ago, and I thankall who have helped make 2015 ayear I will choose to remember.

I have spent much of my adult lifemaking New Year’s resolutions toalter my behavior, mostly centeredaround consuming fewer calories, tolittle avail. But last year I wrote ofmy resolution in this paper.

I have had some success with myresolve to try to find something posi-

tive in the daily events I encounter.It has made a difference for me. Itfeels good to know I am entering2016 with the same resolve and havea chance to succeed.

Best wishes for a happy, healthy2016. I have one request – if yousee me during the next year and Iseem preoccupied with some lessthan pleasant thought, send a smilemy way.

It will help me remember my res-olution.

– Mit Beres, Elmwood

Seeking help with a 2016 resolution

To the Editor:On Dec. 24, my doorbell rang and

to my surprise there was a gift witha Santa hat on it. All I could do wasto call out to thank them and wishthem a Merry Christmas.

When I opened the gift all I coulddo was cry. I wanted to know who

could have given me such a won-derful gift.

How could I thank them? God bless you and I will never

forget your kindness. I am still cry-ing over my new sewing machine.

– Annie Saunders, Elmwood

Anonymous gift elicits tears of true joy

www.wklypost.com THE WEEKLY POST • Thursday, January 7, 2016

GUEST VOICES


To the Editor:As I read George Tanner’s letter

in The Weekly Post (Dec. 24, 2015)on his stance against guns and free-dom in America, I was once againastonished as to how any of my fel-low Americans would willingly giveup the right others had paid such aheavy price to procure. No free manever had to ask permission to exer-cise the most basic God givenhuman right to defend himself, hisfamily, or property.

Nowhere can it be found, wherethe framers of our constitution, whoembraced the right to keep and beararms as the second most importantright of American citizens, limit thatright to only a single shot .22 or anold double- barrel shotgun.

Tanner’s asinine assessment ofthose who wish to possess a semi-automatic rifle or a handgun ofbeing either suicidal or having crim-inal intent is an insult to millions ofAmerica’s gun owners who don’tneed more of man’s laws as they al-ready live in accordance to God’slaws.

Maybe Tanner doesn’t understandthat the first line of defense and thegreatest deterrent to criminals is thelawfully armed citizen. Most ofAmerica’s law enforcement officialsrecognize and endorse the right ofthe lawful citizen to bear arms.

Tanner doesn’t need to mentionthe connection between the use,misuse and abuse of drugs and gunviolence. In nearly every case theabuse of drugs comes before themisuse of guns. Much of the gun vi-olence would subside if the use ofdrugs was taken back 50 years.

It certainly can’t help having theoccupant of our White House inten-tionally arming the Mexican drugcartels, releasing drug dealers fromprison, releasing the most vileminds of terrorism from Gitmo andallowing refugees into America whoare known to be infiltrated with ter-rorists.

If anti-constitutionalist and rabidgun banners want an answer as towhy there is seemingly a rise insenseless gun violence from 50years ago, the answer can bequickly be found in the rubble fromthe war on Christianity and the rot-ting moral and cultural foundationof America, caused by the terminalgrowing cancer call liberalism.

– Robert Walter, Laura

Should we blame cars,trains for deaths?To the Editor:

This is in response to George Tan-ner’s letter.

Tanner blames the gun for shoot-ing deaths. Does he blame cars,

trucks and trains for deaths causedby these? Also airplanes and ships?

We ask Tanner to please show us agun taking itself into a venue andpulling its own trigger. Also, pleaseshow us a vehicle driv-ing itself to an accidentand killing people.

Perhaps, we need toaddress the status of thehuman doing thesethings. If someone hada gun perhaps thehuman killer could have beenstopped. We also ask Tanner tocheck crime in cities with extensivegun control compared to cities thatdo not.

Our founding fathers knew the ef-fect of power for the few. Theyknew citizens must be armed to pro-tect themselves from government.Please read their writings.

– Ed and Sharon Dunbar,Princeville

Disputing points madein Tanner’s letterTo the Editor:

I am writing in response toGeorge Tanner’s letter.

1. Why should a law-abiding citi-zen who is legally able to own afirearm feel guilty for owning anytype of legal firearm because acriminal performs a violent actusing a firearm obtained illegally?

2. There is no “mountain” of realevidence to show owning a hand-gun, an AR-style rifle, or any otherfirearm, for that matter, will lead tomurder, suicide, or a tragic accident.

There are, unfortunately, plenty oflies generated by the gun ban lobby.Those groups, such as the BradyCampaign, the Coalition to StopGun Violence and others, hope tosway low-information citizens withsensational statistics that have nobasis in reality.

3. Actually, American citizensshould worry about what the currentPresident has tried, or what HillaryClinton could do if she gets her way.They most certainly would try topass legislation requiring the regis-tration of firearms and their owners.

They and others like them alsodesire to nullify the First and Sec-ond Amendments to the U.S. Con-stitution. Either way, the next step isconfiscation of all firearms.

Fortunately, the NRA and otherstate and local level groups exist tomake sure this does not happen. Theproblem with this narrow thinking isthat law-abiding citizens will be leftdefenseless while the criminal ele-ment will still have their supply ofillegal firearms.

4. If the mental condition of massshooting perpetrators is truthfully

analyzed, they will all be found tobe mentally ill. The U.S. has, fordecades, lacked a truly effectiveMental Health System. Therefore,these people are allowed to roam

free when they shouldbe confined.

5. As for Gun FreeZones, what is thelogic behind this? Thepeople who couldlegally carry into thesezones are prevented

from doing so. However, the crimi-nal does so and wreaks havoc. Andno one is there who can stop it!

6. A growing number of policechiefs and sheriffs favor a legallyarmed populace. Policemen anddeputies can’t be everywhere at alltimes. Those who think dialing 911for instantaneous arrival of help tosave the day are simply wrong. Awell trained and legally armed citi-zen capable of holding a law-breaker at bay until help arrives canchange the outcome.

7. For the truth about violentcrime trends, visit: www.pewsocial-trends.org/2013/05/07/gun-homi-cide-rate-down-49-since-1993-peak-public-unaware/

8. So we are all on the same page,the extremely popular AR-style rifleis a self-loading rifle not capable ofautomatic firing. The military uses aselectable-fire M-16 or a variant notlegally available to civilians.

9. It takes a very special, difficultto obtain and expensive license toeven attempt to legally purchase afully automatic weapon. The pricetag for these weapons makes themout of reach for almost all citizens.

10. Diane Feinstein, a U.S. sena-tor from California, who is a rabidgun ban proponent, carries a pistolin her purse. Guess she considersherself better than the rest of us. I’llbet many of her crowd do likewise.

11. That brings us to the most im-portant topic: self defense. Eachperson has the right to defend them-selves against bodily harm and theconfiscation/destruction of one’sproperty.

12. Is the main reason violentcrime has decreased in the last 22years because so many law-abidingcitizens have armed themselves andthe criminal element has discoveredthis the hard way?

It’s not because the governmenthas arrested, tried, and incarceratedthose found guilty of violent crimeinvolving firearms. Crimes commit-ted using firearms by felons is a fed-eral offense automatically punish-able with mandatory sentences of 10years or more. It is rare that this ac-tually occurs!

– Richard Dickson, Princeville

Tanner’s gun letter triggers responses

Spencer Curtale, OwnerServing All of Central Illinois

Residential • Commercial • FarmFree Estimates!

309-691-0276 office 309-222-1152 cell

Butler Repair LLCREPAIRS ON ALL AUTOS AND DIESELS

Time to winterizeyour car and getthose tires on before the winterweather is here.

Hours: Monday thru Friday8:00 am - 4:30 pm.

24015 W. Farmington Rd (Rt. 116)309-245-2525 for appointment

Now acceptingmajor credit or

debit cards

We are a fair shop, with fair prices and honest repairs.

(309) 678-9010

Thinking of Buying or Selling? Please Call!

[email protected]

21822 N. N. Route 78, Laura - $119,900 105 Jim Court East Peoria - $89,900

2021 W. Callender Ave West Peoria - $85,000 233 E Van Buren .383 acre, Brimfield - $20,000

PENDING12145 N. Whispering Woods, Dunlap - $164,900

22035 N. Main St., Laura - $44,900

STEWART’S FAMILY RESTAURANT

Tuesday-Sunday6-2

Closed Monday• Full Menu• Breakfast All Day • We Can Accommodate

Large Groups• Home Style Cooking

309-362-240818925 West Farmington Rd.Trivoli, IL

FARM CAREFARM MANAGEMENT • REAL ESTATE SALES

605 W. South St., Elmwood. Newer 3BR home on 3lots, 2.5 baths, Excellent view of the countryside, bigback yard, move in before Christmas! Lots of familyroom. $174,900

Call Gene VaughanManaging Broker742-2273

www.FarmCareIllinois.com

TLC Childcare in Elmwood

Owned and operated bySusan Mock with 19 years experience. DCFS licensed.(309) 742-CHILD(4453)

New hours6am-5:30pm

Openings available for 6 weeks-4years oldDaily lessons

Check Out our Facebook page

B&K Repair, Inc.Bob & Karen Settles, Owners

309-245-4005200 S. Main St.

Farmington, IL 61531

Monday-Friday 8 am-5 p.m.Saturday 8 am-Noon

OPEN HOUSE - Sunday, Jan. 10 - 2-4 p.m.10800 W Parks School Rd, Princeville - $259,900



PALACE THEATREElmwood, IL • 309-742-4211

In Digital Cinema!

Tickets $5

Matinee$4

PG-13

Starts Friday!

Daddy’s HomeFri (Jan. 8) - 7:15 pmSat - 2:30 & 7:15 pmSun - 2:30 & 7:15 pm

From the Management: This film is NOT suitable for young children!

NOTE: Charges are merely an accusa-tion. All suspects are presumed innocentuntil proven guilty in a court of law.

No injuries in Christmas Eve fire

FARMINGTON – Peggy Riley,59, of London Mills escaped injuryabout noon on Dec. 24 when hervan burst into flame on IllinoisRoute 116 west of here.

“She reported smoke coming outfrom beneath the dashboard so thecause was probably electrical,”said Rick Anderson, London MillsFire Chief.

The blaze was extinguished inminutes.

The vehicle was a total loss.Brimfield woman hurt invehicle crash

BRIMFIELD – Breanna Mills,19, of Brimfield on Jan. 3 was in-jured after she fell asleep at thewheel and her 2012 Ford Fiesta,westbound on U.S. Route 150 nearPrinceville-Jubilee Road, left theroad to the south, struck a tree androlled over, according to the PeoriaCounty Sheriff’s Office.

AMT transported her to OSF St.Francis Medical Center.Ashes blamed for fire inOak Run trailer

DAHINDA – Firefighters fromDahinda and Williamsfield onDec. 12 responded to a utilitytrailer fire on Briarwood Place inOak Run, according to the KnoxCounty Sheriff’s Office.

The trailer, owned by KevinWood of Maquon apparentlycaught fire from smoldering ashesloaded along with construction de-bris from the property, police said.Sheriffs investigatingabandoned car

PRINCEVILLE – Police are

seeking a person of interest in aDec. 18 incident in which a 2006Pontiac was found abandoned onWhite Grove Road near Streitmat-ter Road in Princeville Township.

The car appeared to have beentraveling southbound on WhiteGrove Road when it swerved, leftthe road, hit brush and a tree, androlled onto its top, police said.

The vehicle was towed from thescene by Extreme Ridez.Police reports

• Martin Lloyd, 35 of Dahinda onDec. 12 was arrested for driving ona suspended license and transportedto the Knox County Jail.

• Jackie Heid, 34, of Princevilleon Dec. 22 was arrested for domes-tic battery and transported to thePeoria County Jail.

• Jesse Eldridge, 31, of Brimfieldon Dec. 31 was arrested for drivingon a suspended license and trans-ported to the Peoria County Jail.

• Samantha Williams, 24, of Ed-wards on Jan. 2 was arrested for re-tail theft of less than $300 andtransported to the Peoria CountyJail.

• Chad McGinn, 34, of Princeville

on Jan. 3 was arrested for domesticbattery and transported to the PeoriaCounty Jail.

• Pierre Trade, 65, of Edwards onJan. 3 reported a residential burglaryon North Trigger Road, where acomputer and coins were foundmissing.

Deer accidents• Dec. 17: Brett Teske of Abing-

don on U.S. Route 150 near KnoxRoad 1900E in Truro Township.

• Dec. 18: Nathan Zimmerman ofDahinda near Knox Roads 1550Nand 1600E in Persifer Township.

• Dec. 31: Andrew Chamberlainof Mahomet on Interstate 74 nearmile marker 58 in Persifer Town-ship

• Dec. 31: Keely Hamm of Peoriaon White Grove and StreitmatterRoad in Princeville Township.

• Dec. 31: Mila Stedman ofBrimfield on Illinois Route 40 nearBristol Hollow Road in MedinaTownship.

Marriage license• Matthew Holland of

Princeville and Lauren Stine ofMacon, Ill.

PUBLIC RECORD

SIT-n-KNITyarn shop

wed, thurs, fri, 10-4sat 10-noon

additional hours by appt

309.289.2379 309.368.8841236 e. main st. • Knoxville, Illinois Owner - Maureen Carlson

sitnknit.net

Dawson Chiropractic

309-742-8921116 N. Magnolia St. • Elmwood, IL

• Neck and back pain• Extremity complaints• Blue Cross, Humana, Medicare Provider

FRED’S SHOE REPAIR, INC.The Fine Art of Shoe RepairEXPERT REPAIR OF ALL KINDSZippers • Luggage • Ball GlovesOrthopedic Work • Shoe Dyeing

Pool/Boat Covers • Shoe StretchingLeather Goods • Shoe Care SuppliesWhile You Wait - M-F 8-5:30, Sat 8-4

www.fredsshoerepair.com3033 N. University, Peoria, IL • (309) 686-4115

London Mills firefighters on Dec. 24 put out this car fire on Illinois Route116. Photo by Russell Baker.

MERRICK FLOORCOVERING, INC.

Carpet • Vinyl • HardwoodLaminate • Ceramic

116 E. Main St., Elmwood, IL 61529(309) 742-8608JOE MERRICK

PROFESSIONAL INSTALLATION

Brimfield Mini Storage8’ x10’ and 10’ x 24’size units available24/7 Access - Secure

309-303-8703309-446-3565

brimfieldministorage.com

www.wklypost.com



GALLAGHER: Teacher cleared of allegationseven to his face. Therewas no shortage of peoplewho were willing to sharewith him how disgustedthey were.

The teacher continued tovigorously maintain his in-nocence and then the po-lice investigating the casenoted something strange:Each one of the six storieswere exactly the same. Ex-actly. Almost word forword. It was like each girlhad memorized the storyand rehearsed it.

They also noted that allsix girls were best friendswho hung out together allthe time – before school,after school, at lunch. Infact, the six girls had verylittle contact with anyother students.

As police pressed thematter with each girl, theybegan to crumble, one byone. Finally, the main in-stigator admitted she hadfabricated the story. Theteacher had criticized heror given her a bad grade orsomething that made hermad. Her way to get re-venge was to accuse himof molesting her.

She knew that if shewent at it by herself, peo-ple might not believe her.She enlisted the aid of the

other five girls, concoctedthe story, memorized allthe details, and then wentto their parents.

Every one of the girls(with the exception of onewho refused to talk aboutit ever again) recantedtheir story and admittedthey were just trying to getthe teacher in trouble.

The teacher was rein-stated at full pay, but heknew his time was limited.He knew that you can’tun-ring a bell.

All six girls were kickedout of the music programand received in-schoolsuspensions. They wererequired to attend school,but were not allowed toassociate with other stu-dents, and they werebarred from extracurricu-lar activities for the re-mainder of the year.

Two years later, themusic teacher was let go

due to a Reduction InForce. The districtcouldn’t find money tocontinue the music pro-gram, yet miraculouslyfound the money beforethe school year began (andafter the teacher had foundanother job).

The district claimed ithad nothing to do with thelegal action the teacherwas pursuing against thedistrict because as far asthey were concerned, hehad been cleared.

But you can’t un-ring abell.

He has found employ-ment since that time as amusic teacher in anotherdistrict. No one in his newdistrict knows what hewent through so manyyears ago, and that’s why I haven’t mentioned eitherhis name or the townwhere this happened.

I was reminded of this

story recently when I sawa woman from that schooldistrict who mentioned theteacher. Then she re-minded me of the Hell hehad been put through.

I pointed out that he’dbeen cleared of all allega-tions and that the girls hadadmitted to lying to theirparents and authorities.

“Well,” she said, stick-ing her nose in the air,“there had to be somethingto it. You just don’t makeup that sort of thing!”

You just can’t un-ringthat bell.


Prices Good: JAN. 5-11, 2016 farmking.com

The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959

STORE HOURS: Monday to Friday 8:00am to 8:00pm, Saturday 8:00am to 7:00pm, Sunday 9:00am to 6:00pm

40 LB. WILD BIRD SEEDAttracts a variety of birds. (PWB40-FK/5627003) Reg. 11.99

MEN'S WRANGLER COWBOY CUTPRE-WASHED FIT JEANS(13MWZPW) Reg. 39.99

SAVE $5

MEN'S WRANGLER MEN'S WRANGLER MEN'S WRANGLER 3499

SAVE $1SAVE $2569999

ALL IN-STOCKBIG DOG, SUMMIT & MARKSMANTREESTANDS(BDF 076, BDL 386/3332, 2657, 5534) Limited to stock on hand.

ALL IN-STOCKSPRINGFIELD ARMORY PISTOLS(Vendor# 2684)

REGULAR PRICE

HOT DEAL

REGULAR PRICE10%10%

OFF

REGULAR PRICE

HOT DEAL

REGULAR PRICE15%%

OFFALL IN-STOCKMEN'S ITASCA &NORD TREAD BOOTS(Vendor# 5143, 6971, 805, 1269)

REGULAR PRICE

SAVE BIG

REGULAR PRICE25%25%

OFF

CAJUN INJECTOR ELECTRIC SMOKER30" glass front with meat probe temperature display. (22174-01709/1087025) Reg. 219.99

SAVE $40

17999

DELUXE PELLET SMOKER GRILL40,000 BTUs. 180˚F to 500˚F range. (72440/1135757) 29999DELUXE PELLET 299 ALL IN-STOCK

Drill driver sets, drill bits, saw blades, abrasive wheels, driver bits and all hand tools. (Vendor# 1990)

Drill driver sets, drill bits, saw blades,

40 LB. RANCHER’S CHOICE ADULT DOG MAINTENANCEDOG FOOD21% protein and 9% fat. (P15010/1009753)

REGULAR PRICE

SAVE BIG

REGULAR PRICE

$1 OFF

32 OZ. DIESEL FUEL SUPPLEMENTPrevents fuel gelling in temperatures as low as -40˚F. (1025-12/665001) Reg. 6.69

The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959The Family Store With More Since 1959

25% off the regular prices.

Dept. 154 Sub Dept. 100

25% OFFTOYSALL IN

STOCK ALL IN-STOCKBIG DOG, SUMMIT & MARKSMANTREESTANDS(BDF 076, BDL 386/3332, 2657, 5534) Limited to stock on hand.

REGULAR PRICE

HOT DEAL

REGULAR PRICEREGULAR PRICE30%

OFF

(Vendor# 5143, 6971, 805, 1269)

24001 W. Farmington Road, Farmington, IL 61531




ELMWOOD – The ElmwoodCity Council on Tuesday suggestedways the City might help Fair-ground Acres resident David Ram-say with a water drainage issuewithout becoming directly involved.

Ramsay appealed to the Councilto help address standing water onhis property stemming from adja-cent properties’ sumps releasingwater into yards instead of AshStreet, and others’ recent efforts todirect excess water away. The prob-lem is so bad, he said, that he hadstanding water nine months of lastyear.

He said he thinks the situation is aCity problem and suggested theCity grade the affected yards totheir original slopes, redirect sumpdischarges into Ash Street, or installa field tile. The consensus of theCouncil was that since the problemwasn’t on City land or right of way,the City was limited.

“Our engineers have advised us

not to get involved in private prop-erty,” said Ward 1 Alderman BryanDavis.

Ramsay said he might be able tobuild up the area himself, but thatwould just transfer the problem tosomeone else.

“I don’t think the best solution isfor me to bring in more dirt,” Ram-say said. “I can solve my waterproblem, but [then] it’s going to besomeone else’s problem next year.”

Davis sympathized.“I agree that putting in soil is the

wrong thing to do,” Davis said. “Itmight have to take a cooperative ef-fort by the neighbors.”

The Council agreed to consultwith engineers to see what thestorm sewer system could handle ifwater was directed there, and to ap-proach neighbors about working to-gether toward a resolution.

Meanwhile, City TreasurerHarold Jehle reported December re-ceipts of almost $50,000 in statefunds, including $6,100 for sixmonths of video-gaming revenues,

$23,000 for five months of withheldMotor Fuel Taxes, and $20,000 insales-tax revenues, which includedthree overdue payments.

Also, the $21,000 in income taxesreceived from the state last monthindicates that the City is about$30,000 over its projected income-tax receipts for the fiscal year.

In other news, the Council:• unanimously approved an ordi-

nance facilitating the disbursementof $83,000 in additional state fund-ing to complete the Safe Routes toSchool sidewalk project;

• heard Police Chief Aaron Beanreport 37 incidents, 26 reports, 7warnings, 4 stops, and no arrests inDecember; and

• heard Economic DevelopmentDirector/Zoning Administrator DickTaylor report the Zoning Board willhave two hearings Tuesday (Jan.12) on amending the home occupa-tion language to make a table con-sistent with the text, and to considerthe clarification of property lines onWest Ash Street.

Elmwood council discusses drainage

By JOYCE GRANTFor The Weekly Post

For many of us, prepar-ing for winter involvespulling out heavy coatsfrom the closet and mak-ing sure our vehicle isready for intense weather.Whether your winterbrings snow, ice, or flood-ing, you need to be pre-pared.

Preparing for a possiblephysical or mental disabil-ity is the same. Many peo-ple don’t think ofdisability as somethingthat could happen tothem. Statistics show thechances of becoming dis-abled are greater thanmost realize. Fifty-sixmillion Americans, or 1-in-5, live with a disability.

Thirty-eight millionAmericans, or 1-in-10,

live with a severe disabil-ity. A sobering fact for 20year-olds is that morethan a quarter of them willbecome disabled beforereaching retirement age.Disability can happen toanyone. But who is pre-pared?

When disability doeshappen, Social Securitycan help people meet theirbasic needs. Our disabilityprograms provide finan-cial and medical benefitsfor those who qualify topay for doctors’ visits,medicines, and treat-ments.

You can learn moreabout how you might becovered if you are dis-abled by going online atwww.socialsecurity.gov/planners/disability.

Social Security pays

benefits to people whoworked and paid SocialSecurity taxes, but whocan no longer work andwhose medical conditionmeets the strict definitionof disability under the So-cial Security Act. A per-son is considered disabledunder this definition if heor she cannot work due toa severe medical condi-tion that has lasted or isexpected to last at leastone year or result indeath.

The person’s medicalcondition must preventhim or her from doingwork that he or she did inthe past, and it must pre-vent the person from ad-justing to other workbased on their age, educa-tion, and experience.

Supplemental SecurityIncome (SSI), our otherdisability program, is aneeds-based program forpeople with limited in-come and resources.

You can find all the in-formation you need abouteligibility and benefitsavailable to you by read-ing our publication, Dis-ability Benefits, atwww.socialsecurity.gov/pubs.

While extreme winterweather may not affect allof us, the risk of beingdisabled and needing helpisn’t based on geography.Chances are you knowsomeone who is disabledor perhaps you live with adisability. If you wish tohelp a friend or familymember — or need toplan for disability yourself— visit www.socialsecu-rity.gov/disability.

12 MonthsSame

As Cash!

Expires January 31, 2015

LEHMAN PLUMBING, INC.Residential • Small Commercial • Service

Bonded & Insured

FREE ESTIMATES

Randy Lehman

Licensed Plumber

Cell: 309-303-5799Office: 309-685-0883

or 309-446-3496Fax: 309-446-9401

Prepare for winter disasters

There are not enough words to express our gratitude for theoutpouring of care and kindness shown to our family following thepassing of Jim Cecil. Your kind words, sharing of memories, calls,cards, visits, food, flowers, and memorials have helped us throughthis difficult time. Special thank you to Haskell-Hott Funeral Homefor your amazing compassion and support, and to the FairviewAmerican Legion Home and Kevin Ferry for your roles in the serv-ice. While we miss his physical presence, we know he is with useach day. We certainly know he’ll be there cheering on his Cardinalswhen the new season begins! Thank you again,

Donna Cecil Jamie & Geoff Monari Steve ParkerStephanie & Walt Knox Stacy Dikeman & John WisniewskiAnd Grandkids – Dustin, Shawn, Travis, Kelsey, Justin, Mathew

and Kailey


THE WEEKLY POST • Thursday, January 7, 2016www.wklypost.com

Classifieds just $5! Call 741-9790.

BRIEFS

Princeville issuessnow route reminder

PRINCEVILLE – The Villageof Princeville this week remindedresidents to move their vehiclesoff the streets if two or moreinches of snow accumulation isforecast.

In that weather situation, it’s un-lawful to allow any vehicle ortrailer to remain on anyPrinceville street or alley in a waythat interferes with snow-removaloperations.

Vehicles parked on the streetswill be towed at the owner’s ex-pense.

Motorists who need places topark cars are invited to park in theempty lot at the corner of SpringStreet and Santa Fe Avenue – thelot that’s west across from Coun-try Feed and Supplies.

People taking advantage of thatoffer are asked to inform the Vil-lage Hall by calling (309) 385-4765.

Also, the Village suggests call-ing concerning any other ques-tions, too.

Windish gets more timein Kickapoo dispute

KICKAPOO – Roger Windishhas more time to respond to Kick-apoo Township’s request for infor-mation in a lawsuit alleging theKickapoo farmer trespassed anddamaged the Township’s right ofway on Gilles Road east of here.

Judge Katherine Gorman onMonday approved the Township’smotion to extend the discoverydeadline, according to Windish’sattorney, Blake Dunlap.

The parties previously agreedthat discovery would close Dec. 31but Windish “has failed to respondto Plaintiff’s written discovery,”the motion says.

Gorman granted the motion byKickapoo attorneys Emily Perkinsand Tim Bertschy to extend thedeadline to March 31.

Et ceteraThe Peoria County State’s At-

torney’s Office welcomed backLarry M. Evans as its newly ap-pointed chief of the Civil Divi-sion. Evans previously served theState’s Attorney's Office as chiefof its Criminal Division from2003-08, and as a felony assistantstate’s attorney the two yearsprior.

Since 2008, he has served asdeputy chief of the criminal divi-sion for the Tazewell CountyState’s Attorney’s Office.

The Civil Division of the State’sAttorney’s Office represents Peo-ria County government in all civillitigation involving the organiza-tion, including personal injuryclaims, zoning disputes, andclaims of law enforcement mis-conduct.

In addition to managing litiga-tion involving the County and su-pervising civil division staff,Evans will work as a felony pros-ecutor.

like what they see,” hesaid.

The new classroomsare equipped with drop-down projectors and allbut oneclassroomand the com-puter labhave win-dows –somethingnew to mostveteran Elm-wood juniorhigh teach-ers.

Gone is the maze-likegrid of doors and corri-dors that in some casesforced students to walkthrough one classroom toenter another. Never anideal situation, that lay-out was supposed to be

“a temporary fix” for thejunior high back in the1980s. Now it is finallyfixed.

Gone also are theportable trailers that

housedclasses sinceschool beganlast summer.

“Havingthose trailersgone is sonice,” Princi-pal Stan Ma-theny said. “Ihated them.The teachers

and students did greatwhile we had them, butit’s so nice to have themall under one roof.”

Still to be added arelockers for junior highstudents, which are onback order and should ar-

rive in a few weeks,Wagner said.

Blinds for the largewindows on the additionare also on back order.

Previously completedwork that was part of thisproject included the in-stallation of two newboilers. That work, whichwas done in October,should increase effi-ciency from 60 percent to90 percent, Wagner said.

The combination ofmore efficient boilers andplenty of passive solar

energy streaming throughwindows is expected tocut energy costs “signifi-cantly” according toWagner.

Work on the additionand remodeling was orig-inally planned to be donein time for the start ofschool, but problemswith the original contrac-tor led to the projectbeing rebid.

Wagner said a finaltotal on the project willrange between $1.6 and$1.7 million.


JR. HIGH: Windows are a welcome change

Lockers will fill the empty spaces in a new hallway ofthe Elmwood junior high once they arrive in a fewweeks. Temporary signage is also present in places,as on the new boys restroom (at left). Photos by JeffLampe.



Answers on Page 12

6:30 p.m. - Winners Announced & Awards Ceremony for the following Categories

Most Original Chili Name, Best Tasting Chili - HOT,

Best Tasting Chili - Mild, The People’s Choice Chili,

and Best Tasting Non-Traditional Chili

Hot Dogs and Brats will also be available for purchase.

Come Join us for Food & Fun at

Brimfield American Legion

CHILI COOK-OFFWHITNEY’S WALK

Registration for Chili Cook-Off participants is from

4:00 - 5:00 p.m.

Bring your “Prepared” 4-Quart Pot of Chili with appropriate serving utensils

Entry Fee- $20.00

“Honoring life by supporting programs for depression awareness and suicide prevention.”

Wishing You the Best in 2016!

from your friends at

Elmwood Pharmacy

New Hours in 2016Mon.-Fri.

9 a.m.-5:30 p.m.Saturday

9 a.m.-NoonClosed for Lunch

12:30-1:00 p.m.

ph. 309.742.2611

Auctioneer champ to appear at FairviewBy Weekly Post Staff Reports

FAIRVIEW – Brandon Neely, 2015World Livestock Auc-tioneer Champion,will be visitingFairview Sale Barn(1120 Carter Street,Fairview) on Saturday(Jan. 9) starting atabout noon.

Neely will be on theauction block, sellinglivestock and showing off the chant thatearned him the world title.

Fairview Sale Barn will host a specialCAB feeder cattle sale beginning atnoon.

Neely defeated 29 other contestants towin the World Livestock AuctioneerChampionship (WLAC) in Clifton,Texas.

During his year as champion, Neelywill travel across the U.S., with appear-ances at LMA member-markets and in-dustry events.

Local livestock markets work to bringin multiple buyers on sale day, increas-ing competition with more bids.

Neely


www.wklypost.com THE WEEKLY POST • Thursday, January 7, 2016

CLASSIFIED AND LEGAL ADS - Call (309) 741-9790FOR SALE

• 2005 JAGUAR: X-Typesedan, blue with ivoryleather interior. Power win-dows, seats, locks, moonroof, dual exhaust, heatedseats, 6-CD, premiumsound system. Purchased

at Jaguar-Land Rover-Peo-ria. 71K miles. Beautifulcar, excellent condition.$9,800 OBO. Call (309)368-1451.• RECLINER: Electric re-cliner, light blue, in goodshape. $50. Call after 5 pm

(309) 645-0643.• WOODEN TABLE: Antiquewooden drop-leaf table.$30 OBO. (309) 231-3350.• VINYL FLOORING: De-signer’s Image PlatinumSeries self-stick 16x16floor tile, 412 square feet,

12 boxes, 20 pieces perbox. (309) 741-9790.

FOR RENT• HOUSE: 4BR, 2 BA, twostall garage, between Kick-apoo and 74. Brimfieldschool district. (309) 712-9952.

CLAIM NOTICE CIRCUIT COURT OF

THE TENTH JUDICIAL CIRCUIT OF ILLINOISPeoria County, in Probate

In the Matter of the Estate of RONALD L. ROHRER, 15-P-559

NOTICE OF CLAIM DATE

Notice is hereby given to creditors of the death of RONALD L.ROHRER. Letters of Administration were issued to SUSAN L. ROE,whose address is 304 N. Ellen Ave., Princeville, Illinois 61559, as Ex-ecutor, whose attorneys are CORDIS & CORDIS, Attorneys at Law,129 North Walnut Street, P.O. Box 445, Princeville, Illinois 61559.

Claims against the estate may be filed in the Circuit Clerk's Office,Peoria County Courthouse, Peoria, Illinois, or with the representative,or both, on or before the 17th day of June 2016, or if mailing or deliv-ery of a notice from the representative is required by Sec. 18-3 of theProbate Act of 1975, the date stated in that notice. Every claim filedmust be in writing and state sufficient information to notify the repre-sentative of the nature of the claim or other relief sought. Any claimnot filed on or before that date is barred. Copies of a claim filed withthe clerk must be mailed or delivered by the claimant to the represen-tative and to the attorney within ten (10) days after it has been filed.

Dated: December 14, 2015 .

SUSAN L. ROE, Administrator of the Estate of RONALD L. ROHRER, Deceased

Cordis & CordisAttorneys for Executor129 North Walnut Avenue By: /s/ Kerry R. CordisP.O. Box 445 Attorney for EstatePrinceville, Illinois 61559309.385.46l6

CLAIM NOTICE IN THE CIRCUIT COURT OF

THE TENTH JUDICIAL CIRCUIT OF ILLINOISPeoria County

In Re ESTATE OF )ROBERT L. NELSON, ) N0. 15-P-495Deceased. )

NOTICE is given to creditors of the death of ROBERT L. NELSON onSeptember 11, 2015. Letters of Office were issued by the above enti-tled Court to JOAN M. OWENS, formerly known as JOAN M. NELSON,of 3001 West Alan Court, Peoria, Illinois 61615, as Executor, whoseattorneys of record are WHITNEY & POTTS, LTD., 118 West MainStreet, P. O. Box 368, Elmwood, Illinois, 61529-0368. Claimsagainst the Estate may be filed in the Circuit Clerk's Of fice, PeoriaCounty Courthouse, Peoria, Illinois, or with the repre senta tive or bothon or before the 11th day of July, 2016, or if maili ng or delivery of aNotice from the representative is required by Sec. 18-3 of the ProbateAct of 1975, the date stated in that Notice. Every claim filed must be inwriting and state sufficient information to notify the representative ofthe nature of the claim or other relief sought. Any claim not filed on orbefore that date is barred. Copies of a claim filed with the Clerk mustbe mailed or delivered by the claim ant to the representative and to theattorney within ten (10) days after it has been filed and shall file withthe Court, proof of any required mailing or delivery of copies.

DATED this 27th day of October, 2015.

JOAN M. OWENS, formerly known as JOAN M. NELSON, Executor ofthe Estate of ROBERT L. NELSON, Deceased.

WHITNEY & POTTS, LTD.Attorneys for the Executor118 West Main StreetP. O. Box 368Elmwood, Illinois 61529-0368Telephone: (309) 742-3611

Real Estate & Estate AuctionLocated at: 507 N. Putnam Street, Elmwood, IL 61529

Saturday, January 9th 2016 @ 10:00 a.m.Real Estate Description: Offering a 1400+ sq ft (4)Four Bedroom Ranch style home situated on (6) lots, Real Es-tate to be offered in (3) Parcels, #1-Home w/ three lots- #2 (3) lots(14-15-16)- #3-Home w/all (6) lots. This homeoffers some great opportunities and is one that deserves a good look. Elmwood is a great community with an out-standing school system. Call today for an appointment to view-309-370-5305 Legal Description: Putnam’s Addition NW ¼ SEC 8-9N-5E Lots 11 thru 16 Blk 2 PIN# 11-08-105-008Terms for Real Estate: 10% Down at time of final accepted bid. Owner reserves the right to accept or reject any orall bids. Both buyer & seller will be required to sign written agreement furnished day of auction. Property will besold “As Is” and not subject loan approval.

---------- Personal Property to be auctioned immediately following the sale of above Real Estate -------Vehicles; 2005 Chrysler PT Cruiser-All power-very clean car with 159,000 miles, 1993 Ford F-150 V-8 5.0 Liter-Au-tomatic-Pwr Windows/Locks-Running Boards-175,000 Miles (currently not running)Display Case Items-Jewelry-Advertising-Vintage Fishing; Cameo’s, Necklaces, Earrings, Brooches, Pins, CAT 20 yrpin, Watches, Mickey Mouse Watch, Santa Fe Glass/Dish, Civil War Era Flatware, IL Central Railroad Rule Book,1920 Locomotive Ref Book, Small China Dolls, Spectacles, 8” Carved Jade Statue, Cast Iron/Tin/China Banks, Ad-vertising Pieces, Pabst Bank, Sterling Silver, Wall Shaving Kit, Metal Signs, Salem Cig Therm., Cig Advertising,Cast Iron Woman Boot Jack, Cast Iron Nut Cracker, United Cast Iron Wall Clock, Austria Meat Grinder, BlatzCoasters, NMA Lic Plaque, Prints, Oil Cans, Critic Feeds Elmwood Elevator Adv., Pocket Knives, Straight & SafetyRazors, Porcelain/Wood Castors, Door Knobs, Winchester Oil Can, Vintage Fishing; Musk-E-Munk Lure in Box,Mudd Puppy in Box, Handmade Lures, Wood Lures, Shakespeare Marhoff 1964 Reel & Others, Galvanized Min-now Buckets, Antique Furniture-Antiques-Crocks-Glass-China-Primitives & Collectables: Marble Top Dresser, Oak Sideboardw/Mirrored Back Splash, Doctors Cabinet, Marble Top End Tables, Parlor Tables, Library Table, Oak Dressers,Smoking Stand, Record Cabinets, Oak Commode, Oak 3-Drawer Washstand, Single Drawer Telephone Stand, HighBack Rocker, 4’ Round Oak Table, Chrome Table/Chairs, Plank Bottom Rocker/Chairs, Child’s Rockers, WoodKitchen Cabinet, Oak Dbl Bed, Drop Leaf Tables, Press Back Chairs, Spring Chairs, Steamer Trunk, Tables, 1950’sCaloric Ultamatic 6 Burner Enamel Stove, (2) IH Refrigerators, Cabinet Stereo, Westinghouse Little Jewel Radio,Slag Glass Swag Lamp, Floor Lamps, Light Fixtures/Globes, Pottery Lamps, Blackhawk Foundry (Iowa) WeinerDog Boot Scrapper, 1901 Wall Coffee Grinder, GE Lamps Display Rack, Motion Lamp, 16” Exec Weber CastelloGlobe, 12 & 8 Gal Western Crocks, 1 & 2 Gal Crocks, Crock Jugs, Pottery Bowls, Pottery Planters, 15+ Cast IronSkillets, Blue Canning Jars, Galvanized Tubs/Water Cans, Enamel Ware, Carpenters Boxes, Double Washtub Stand,Mobil & Standard Oil Cans, Primitive Kitchen Appliances/ Utensils, Product Tine/Bottles, Bordens Wood Milk Case,Washboards, Nail Kegs, Printers Tray, Ford Falcon Steering Wheel, Edison Records, Records-45s-78s-LPs, EggCrate, Rug Beater, Kraut Cutter, Sad Irons, Vintage Cameras/ Brownies/Projector, Pyrex, Cookie Jars, Chalk WallPcs, Glass Ornaments, Dial Phones, Fostoria Stemware, Pressed & Pattern Glass, Carnival, Depression, GlassSets, Ruby Glass, Murano Glass, Jadeite, Lots of Fire King, Lots of Partial Sets of China, Beer & Shot Glasses, AWMugs, Japan Figurines, China Birds, Charlie McCarthy Puppet, Red Wagon, Quit, Embroidered Pillow Cases,Needlepoint, Crochet, Doilies, Buttons, Books, Appliances-Modern Furniture-Household-Fishing-Shop-Yard & Garden; Wards 20 cu ft Side By Side Frig., Freez-ers, Imperial Gas Range, Dorm Refrig., Maytag Washer, Gas Dryer, Sofa, Lazboy Recliner/ Others, Curio Cabinet,Kitchen Table/Chairs, Singer Stylist Sewing Machine, Like New White #510 Sewing Mach., End/Coffee Tables,Component Stereo, New Hood Fan, Sweepers, Fans, Heaters, Microwaves/Stands, Lamps, Guardian Ware, SmallKitchen Appliances, Boxes of Pots & Pans, Flatware, Pyrex, Corning Ware, Meat Saws, Tupperware, Cookbooks,Boxes of Canning Jars/Jugs, Boxes of Blankets/ Sheets, Sewing Items, Thread, Material, Christmas & HolidayDécor, Cleaning Supplies, Boxes of Novels, Lots of Lures, Tackle Boxes, Rods/Reels, Pocket Fisherman, GardenTractor Belt Drive Tiller/Snow Blade, Shop Vac, Remington Chainsaw, (2) Lawn Sweepers, Air Compressor, TableSaw, 4’& 6’Levels, Rock Island Bench Vise #573, Bench Grinder, Wood & Alum Step Ladders, Ext Ladder, CementTools, Hand Tools, Recip Saw, Power Miter Saw, 4’ Concrete Bull Float, Hand Power Tools/Trimmers, Hedge Trim-mers, Wood Clamps, Long Handled Tools, Roof/Ladder Jacks, Screw Jacks, Kwikset Lock Set Kit, HandymanJack, Pipe Tap Set, Log Chains, 36” Entry Door, CB Radios, Drop Cords, Garden Planter, Auctioneers Note: This is a nice property with great potential. There is also a great selection of Personal Prop-erty. Two Rings will be run. Statements day of auction supersede all others.TERMS: CASH OR CHECK • NOT RESPONSIBLE FOR ACCIDENTS • LUNCH STAND • RESTROOM

Estate of Gladys D. Matthew-Executor: Sharon K. ShanklinCulver Auction Service Lic#440.000447 Greg Culver Farmington. IL 61631 ph: 309-370-5305

Tim Placher Lacon, IL. Lic#440.000339-Jimmy Johnson – Andrew Whitsitt

Brimfield park building likelyBy TERRY BIBOFor The Weekly Post

BRIMFIELD – With boosts from a“highly motivated” Brimfield AreaMen’s Club and an anonymous donor,the village may have a fully-operationalpark building later this year.

Village trustees voted 5-0 on Mondayto add $10,000 to a special fund forpark improvements.

“It’s a total of $20,000. I want toshow an investment on the village’spart,” said President Dan Fishel. “Wemay not spend that much, but we’d liketo have it available.”

Centrally located near the flagpole atthe village park, the new concrete blockbuilding would include restrooms, con-cessions and storage. Fishel told boardmembers the men’s club had alreadypledged funds for park improvementsbefore and may be in financial shape todo more now.

“It’s an opportunity to make some-thing good happen,” he said.

Preliminary estimates indicate thebuilding could cost $25,000. But therehave been offers of help with labor and

a lot could change.“I’m sorry about the sketchy details,”

Fishel said. “Essentially, without a parkboard, you are the park board. Yourinput will be needed.”

In other business during the briefmeeting, board members agreed to senda letter to residents of Alma Court, ask-ing them to be more careful parkingcars. Resident Barb Shipley had indi-cated concerns about accessibility, fear-ing emergency vehicles might not beable to get through. After checking,board members agreed.

Rather than take drastic action, theydecided to start with a letter asking forvoluntary cooperation.

After months of waiting, the villagereceived tax funds from the state.

“We did get some money from thestate,” Fishel said. “We’ll just turnaround and spend it all, but it is here.”

“We put some in a money market(fund),” said Village Clerk Holly John-son.

Terry Bibo is a freelance journalist. She canbe reached at [email protected].



OBITUARIESDale Nichols

FARMINGTON – Gordon DaleNichols, 90, of Farmington, passedaway on Tuesday, Jan. 05, 2016, athis residence.

He was born on March 31, 1925,in Rosie, Ark., toGuy and Beulah(Bowman)Nichols. They pre-ceded him indeath.

He married thelove of his life,Betty Sornson, onJuly 31, 1947, inBassett, Ark. She survives.

Also surviving are their children,Vernon Nichols, Kay Faralli, Rod-ney (Cathy) Nichols, JimmyNichols, Carol (Terry) Dicks, all ofFarmington, brothers, Jim and BillyNichols, grandchildren, Angie andGina Faralli, Trent (Kim) Dicks,Beth Nichols, David (Coral)Nichols, Brett (Courtney) Dicks,Scott and Chett Dicks and greatgrandchildren, Shelbey, Trista,Kylie, Tryce, Anna and Riley.

He was preceded in death by hisson-in-law, Bob Faralli, two brothersand five sisters.

Dale retired from Caterpillar after31 years of service. He spent his re-tirement enjoying life. He was amaster gardener; he could make any-thing grow. Actually, he could doanything and was always up to lend-ing a hand, whether it was fixing acar or building a garage, he’d knowhow to do it.

Incredibly proud of his family,Dale loved spending time with them.He also liked country music, fishing,word searches, thick-cut bacon,pecan pie and lawn mowers.

Funeral services will be held at 2pm, on Friday, Jan. 8, 2016, at theOaks-Hines Funeral Home in Can-ton with a visitation one hour priorat the funeral home. Burial will beheld at the Trivoli Cemetery.

Memorials may be made to Farm-ington Rescue Squad or the Farm-ington Food Pantry.

To view Dale’s memorial tributeor to leave online condolences, visitwww.oakshinesfuneralhome.com.

Clarence HedgesCANTON – Clarence E. “Butch”

Hedges, 74, of Canton, passed awayon, Monday, Jan. 4, 2016, at his resi-dence.

He was born on April 9, 1941, inCanton, to Chester and Evelyn(Huggins) Hedges. They precededhim in death.

He marriedBetty L. Morse onMay 28, 1963 inPalmyra, Mo. Shesurvives.

Also survivingare his sons, Ed-ward (Julie)Hedges of Canton,Timothy (Donna)Hedges of Canton, sister, Rhonda(John) Lemon of Canton and threegrandchildren and Ashley, Kelseyand Brant.

Butch worked for InternationalHarvester Company for 22 years andworked in small engine repair. Hewas a member of the 1st Church ofthe Nazarene.

He was elected to receive the de-gree in Masonry at Horeb Lodge#363 in Elmwood in 1977. He wasinitiated as an Entered Apprentice onAugust 24, 1977, passed to the de-gree of Fellowcraft in 1977 andraised to the sublime degree of Mas-ter Mason.

He served as Master of the HorebLodge in 1983 and 1993. He servedthe Grand Lodge as District Deputyfrom 2001 to 2009 and was servingas Certified Lodge Instructor, a posi-tion he had held for the past 20years. He was a 38-year member ofHoreb Lodge.

Butch was also a member of theEureka Chapter #98 Royal Arch Ma-sons in Canton, the Cryptic MasonsCouncil #1 in Knoxville and Gales-

burg Commandery #8 of KnightsTemplar in Monmouth. He hadserved as the head of all three ofthese bodies.

He served as the funeral coordina-tor and conducted several Masonicfuneral services.

A visitation was Jan. 6, from 5-7,at the Oaks-Hines Funeral Home inCanton with a Masonic Service at 7p.m. A funeral service will be heldon Thursday, Jan. 7, 2016, at 10 a.m.

Burial will be held at the Oren-dorff Cemetery.

Memorials may be made to theAmerican Diabetes Foundation.

Condolences may be left online atwww.oakshinesfuneralhome.com.

James R. FinneganELMWOOD – James R.

Finnegan, 82, of Bloomington, diedJan. 3 at his home.

Survivors include his wife, E.Joanne Milford; six children, James(Jeanne) Finnegan, Jr., of Phoenix,Ariz., Jack (Melinda) Finnegan ofColumbia, Mo., Peg (John) Kuntz ofBloomington, Mary (Steve) Sobottaof Boiling Springs, Pa., Kathleen(Tom) Conklin of Elmwood andPatrick Finnegan of Bloomington;15 grandchildren, Kevin Finnegan,Allie, Andrew, Robert and MaggieKuntz, Nick, Matt, Kate and MegSobotta, Eileen, Maddie, Cece andRory Conklin, Connor and GavinFinnegan.

His funeral will be at 10 a.m., Fri-day, Jan. 8, at Holy Trinity Church,Bloomington. Burial will be in HolyCross Cemetery, Normal. Militaryrites will be accorded. Visitation isfrom 3-7 p.m. Thursday, Jan. 7, atCarmody-Flynn Funeral Home.

Condolences may be left online atwww.carmodyflynn.com.

Charles BarnesELMWOOD – Charles S.

“Chuck” Barnes, 74, of Elmwooddied Dec. 26 at his home.

He is survived by his daughter,Jodi Marie.

A funeral service was Jan. 2 atWright & Salmon Mortuary, withburial in St. Patrick Cemetery inKickapoo.

Condolences may be left online atwww.wrightandsalmon.com.

Vernetta BrewerFARMINGTON – Vernetta M.

Brewer, 93, of Peoria, mother of aFarmington woman, Dec. 20 at her

This Week’s Obituaries• Charles Barnes, 74, Elmwood• Vernetta Brewer, 93, Farmington• Donald Clegg, 61, Williamsfield• Tina Marie Coulter, 46, Yates City• James Finnegan, 82, Elmwood• Clarence Hedges, 74, Canton• Dale Nichols, 90, Farmington• Steven Noll, 70, Princeville• Brad Polhemus, 59, Farmington• Darlene Powell, 81, Princeville• Maude Reeves, 89, Edwards• Michael Simpson, 55, Laura• Regina Spencer, 91, Princeville• James Thompson, 85, Farming-ton

We print basic obituaries forfree. Longer obituaries cost $1 percolumn inch;$5 per picture. Call(309) 741-9790.

PUZZLE ANSWERS

15 months1.01% APR

Nichols

Hedges

www.wklypost.com



BRIMFIELDSt. Joseph

Catholic ChurchFather John Verrier

314 W. Clay, Brimfield(309) 446-3275

www.stjosephbrimfield.orgSat. Confession: 3:30-4:45 pm

Sat. Mass: 5 pmSun. Mass: 10:30 am

Daily Mass: Tues.-Fri. 8 amSt. Paul’s

Lutheran ChurchThe Lutheran Church -

Missouri Synod“Preaching Christ Crucified”“Liturgical & Reverential”Pastor Michael Liese

204 W. Clay St., Brimfield(309) 446-3233

Sun. Divine Service: 10 amBrimfield E-Free Church

Pastor Donald Blasing11724 Maher Road

Brimfield, IL 61517(309) 446-3571

www.brimfieldefree.orgWorship: 10:30 am

Sunday School: 9:30 amAWANA - Wed. 6:15 pm, for

ages 3-12Brimfield UnitedMethodist Church

Pastor Leonard Thomas135 S. Galena St., Brimfield

(309) 446-9310Sun. Worship: 9 amSun. School: 9 am

Thurs. Bible Study: 7 pmUnion Church at BrimfieldUnited Church of ChristPastor Stephen Barch

105 W. Clay Street, Brimfield(309) 446-3811

Sunday Worship: 9 amTuesday Bible Study: 6:30 pmFirst Sunday each month isCommunion Sunday (gluten

free communion offered)EDWARDS

Bethany Baptist Church7422 N. Heinz Ln., Edwards

(309) 692-1755www.bethanycentral.org

Sat. Evening Worship: 6 pmSun. Worship 8:15 & 11 amWednesday Awana: 6:15 pm

Christ Alive! Community ChurchPastor Lance Zaerr

9320 W US Hwy 150, Edwards(309) 231-8272

www.christalivecc.comSun. School: 9:15 amWorship: 10:30 am

ELMWOODCrossroads Assembly of God

Pastor Tim Cavallo615 E. Ash St., Elmwood

(309) 830-4259www.crossroadselmwood.org

Wed. Worship: 7 pm

Sun. Worship: 10:30 amElmwood Baptist ChurchPastor Dennis Fitzgerald

701 W. Dearborn St., Elmwood(309) 742-7631, 742-7911

Sun. School: 9:30 amSun Worship: 10:30 am, 6 pmWed. Prayer Meeting: 7 pm

First Presbyterian Churchof Elmwood

Reverend Marla B. Bauler201 W. Evergreen, Elmwood

(309) 742-2631firstpresbyterianofelmwood.org

Sun. Worship: 10:30 amSun. School: 9:30 am

St. Patrick’sCatholic ChurchFather Paul Stiene

802 W. Main St., Elmwood(309) 742-4921

Sat. Confession: 3:45 p.m.Sat. Mass: 4:30 p.m.Sun. Mass: 10 am

Tues. Rosary: 8:15 amUnited Methodist Church

of ElmwoodPastor Bradley F. Watkins II821 W. Main St., Elmwood

(309) 742-7221www.elmwoodumc.org

Sun. Worship: 9 am, 10:30 amYouth Sun. School: 9 amAdult Sun. School: 8 am

FARMINGTONFirst Presbyterian Church

of FarmingtonReverend Dr. Linda Philabaun83 N. Cone Street, Farmington

(309) 245-2914www.firstpresfarmington.com

Sunday School: 9:30 amFellowship: 10:30 amWorship: 11:00 am

New Hope FellowshipAssembly of GodPastor Tom Wright

1102 N. Illinois Route 78

Farmington(309) 245-2957

Sun. Worship: 10 amWed. Worship: 7 pm

PRINCEVILLEPrinceville UnitedMethodist ChurchPastor Ken Dees

420 E. Woertz, Princeville(309) 385-4487

[email protected]. Worship: 9 am

Sunday School: 10:15 amYATES CITYFaith United

Presbyterian ChurchReverend Marla B. Bauler

107 W. Bishop St., Yates City(309) 358-1170Worship: 9 am

Sun. School: 10:15 amThurs. Choir: 7 pm

AREA CHURCHES

OBITUARIEShome.

Survivors include daughter Linda(Ben) Shermer of Farmington; twoother daughters; 5 grandchildren; 13great-grandchildren; and 6 great-great-grandchildren.

Funeral services were Dec. 24 atDavison-Fulton Woolsey FuneralHome in Pekin, with burial at Lake-side Cemetery in Pekin.

Condolences may be left online atwww.davisonfultonwoolsey.com.

Donald Ernest CleggWILLIAMSFIELD – Donald

Ernest Clegg, 61, of Williamsfield,died Dec. 27 in Galesburg.

Funeral services were Dec. 31 atColonial Baptist Church in Gales-burg, with burial at Maquon Ceme-tery in Maquon.

Condolences may be left online atwww.watsonthomas.com.

Tina Marie CoulterYATES CITY – Tina Marie Coul-

ter, 46, of Yates City, passed away at6:49 p.m. on Dec. 24, 2015 at herresidence.

She was born Dec. 13, 1969 inPeoria to Bill and Linda (Wells)Cassel. She married Ross Coulter onMay 10, 1994, in Elmwood. He sur-vives. Also surviving is one son,Ross William Coulter of Yates City;one brother, Robert Cassel of YatesCity; one sister, Sherry Cassel ofYates City; and her mother Linda.

Preceding her in death is onegranddaughter.

Tina was a member of the YatesCity United Methodist Church.

Cremation was accorded. A Cele-bration of Life was Jan. 4, 2016, atthe Community Center in Yates City.Anderson-Sedgwick was in chargeof arrangements.

Steven NollPRINCEVILLE – Steven LeRoy

Noll, 70, of East Peoria, a native ofPrinceville, died Dec. 30 at OSFSaint Francis Medical Center.

Survivors include his wife ShirleyElizabeth Jones; two stepdaughters,Julie (Richard) Mullins of Metamoraand Janel (Craig) Gerdes of Toluca;five stepgrandchildren; two step-great-grandchildren; and five sib-lings of Metamora and Peoria.

A memorial Mass was Jan. 6 at St.Mary’s Catholic Church in Meta-mora, with burial of ashes at St.

Mary’s Cemetery in Metamora.Condolences may be left online at

www.masonfuneralhomes.com.Brad Polhemus

FARMINGTON – Brad A. Polhe-mus, 59, of Farmington died Dec. 29at OSF Saint Francis Medical Cen-ter.

Survivors include his wife Diane(Kepple) Polhemus; children Jill(Steve) Witt of Hawk Point, Mo.,Jenni (Jay) Kuzniar of Canton andJosh (Cindel) Polhemus of MountCarmel; seven grandchildren; andbrother Scott (Kathy) Polhemus ofCongerville.

Services were Jan. 2 at Anderson-Sedgwick Funeral Home in Farm-ington, with burial at Oak RidgeCemetery in Farmington.

Condolences may be left online atwww.sedgwickfuneralhomes.com

Darlene PowellPRINCEVILLE – Darlene J. Pow-

ell, 81, of Bartonville, formerly ofPrinceville, died Jan. 2 at her daugh-ter’s residence.

Survivors include one son, fivedaughters, one foster daughter, 16grandchildren, 21 great-grandchil-dren and one great-great-grandchild.

Funeral services were Jan. 6 atHaskell-Hott Funeral Homes inPrinceville, with burial at PrincevilleCemetery.

Condolences may be left online atwww.haskellhott.com.

Maude ReevesEDWARDS – Maude E. Reeves,

89, of Peoria, mother of an Edwardsman and sister of a Farmington man,died Dec. 27 at Manor Court of Peo-ria.

Survivors include her children,Harold E. (Rita) Taylor of Edwards,Jane Allsup of Bartonville, MarianneGraham of Peoria and Gary (Deb-bie) Taylor of Peoria; five grandchil-dren; seven great-grandchildren; onebrother, Edwin (Lee) Diefendorf ofFarmington; and close friend, Eve-lyn Smith of Peoria.

Cremation was accorded. A pri-vate burial at Parkview Cemeterywill take place at a later date.

Condolences may be left online atwww.davison-fulton-bartonvil-lechapel.com.

Michael SimpsonLAURA – Michael E. Simpson,

55, of Laura died Dec. 14 at his resi-dence.

Survivors include wife Debra(Compton) Simpson; sons Chaz(Tasha) Simpson of Brimfield andJosh (Tiffany Shore) Simpson ofPekin; daughter Nicole (Jose)Moreno of Peoria; and eight grand-children.

Cremation was accorded and amemorial service was held Dec. 28at Princeville United MethodistChurch.

Condolences may be left online atwww.haskellhott.com.

Regina SpencerPRINCEVILLE – Regina I.

Spencer, 91, of Pekin, sister of aPrinceville man, died Dec. 23 at herhome.

Survivors include daughters MaryWright and Brenda (Ernest)Wieburg, both of Pekin; brotherJames (Shirlee) Clark of Princeville;sisters Elizabeth (John) White ofDyersburg, Tenn., Faye Sammett ofLouisville, Texas, and Maxine Longof Houston, Miss.; five grandchil-dren; four great-grandchildren; andone great-great-grandchild.

A service celebrating Regina’s lifewas Dec. 28 at Henderson FuneralHome & Crematory in Pekin, withgraveside services Dec. 29, in Lake-side Cemetery in Pekin.

Condolences may be left online atwww.hendersonfuneralcare.com.

James ThompsonFARMINGTON – James M.

Thompson, 85, of Farmington diedDec. 26 at the OSF Richard L.Owens Hospice Home in Peoria.

Survivors include wife Patricia(Wykoff) Thompson; children Karen(Stephen) Johnston and DonaldWykoff, both of Farmington, Mary(Brad) Strickfaden of Trivoli, Donna(Les) Elder of Louisville, Ky., andWilliam (Debra) Wykoff of Morgan-ton, N.C.; six grandchildren; andfour great-grandchildren.

Masonic services were Dec. 29 atAnderson-Sedgwick Funeral Homein Farmington. Cremation rites wereaccorded, with burial at a later date.

Condolences may be left online atwww.sedgwickfuneralhomes.com.

Newell’s Auction & Farm Realty(309) 358-1218

NEW LISTING: 7305 Twp Rd 625E, Toulon is a 3 BR, 1.5Bath Ranch on 5+ Acres! Full walkout basement, sunroom,whole house generator, geo-thermal heat/AC, and 50’x30’ shed!½ mile south of Stark Co. High School. Must see!

Priced at . . . $182,500REDUCED: 511 Happy Hollow Dr., Dahinda is a 2 BR, 2Bath Ranch with full walkout basement located in small pri-vate lake community. Newer kitchen and baths. Appliancesincluded. NEW Price ... $69,000

Color Photos at www.williamsfield.org

Debbie Newell, Broker/Sales Ron Newell, Broker/Auctioneer

Traders Unlimited

3622 N. Knoxville Ave.Peoria, IL 61603

Each office independently owned and operated.

WE BRING BUYERS AND SELLERS TOGETHER

yllyEmiimKKi aPPa

lhaahttaSSttaat

Unlimited

2

Trn

294-7861653-546

REKORBy

6RB

ieciffffohcaE

kbtd2tbunob,moornusagnidulcniserutaateffesuocni,ngisedmoordebretsamtilpsafostsisfnidnaan;stenibaabctnaandnubaabdnaandnaanlsi,raarbgnilieclardehtaatcdnaanecaaclperiffidedislaudrgninidlamrofa:gnirutaateffeemohsihtfonepoehTellivecnirP,truoCnetuA8151

ELLELIILVVIECCENIINRPPR

Unlimited

3

sredaTr30616LI,airoeP

.evAellivxonK.N2263

.

275-696IRG,REKOR

R

detarepodnadenwoyltnednepedn

EHTEGO TSRELLE SDN ASREYU BNGIR BEW

tit’Dtllbtkdehsiniffi,yrdnuaaulroolfniaaim,moorsu-remunsahesuoH.smoordeb3gnidulc-nocnaanlproolfehT.aeraargninidlamroftsafkaakerb,yrtnaanpegraarlhtiwnehctik;ghtiwmoortaaterg;gniliecyaayrthtiwmoonoisnaanpxeehtotuoysemoclewreyofn

!sdeeNetatsElaeRruoYYollAroFsUtcatnoC

.tnemesablluffu,egaraargraarc2egraarL.moorffolevelreppU.denibmocmoorgnivilehtyojnnjeotmoorylimaamffoffomoornos.roolfflniaaimnosetiusmoordeb2serutaateFoordeb4luffurednoWWo.stsocgnisolcdnaanrellesdetaatvitoMellivecnirP,hcniF809

.000,062$.seitilibissoplatnerddalla;swodniwnesrednA,.caacvlartnecstnemesablluffudnaankcedderaarhs,segaraargoolfflniaaimdnaanshtaatb2,smoordebegraarlhtiwsnehctikni-taateerutaateffesedisxelpudmtraarpaapezisycneiciffifffenaan,aeraargnivil.dr3sybedisasatliuB.ytreporptnemmetsevniaitnetoptaaterGellivecnirP,nellE.N303PdnaanrGfoseppohSehtmorffrsetunim02sercaac42.1noemohgninnutssihtrofytinksabetaatraarpesdnaanegaraargraarc2,tnemmeesaasb

.000,491$sunobdnaanhtaatblluffu,smoordeb2sreffe-moorgninidlamroffoegraarL.sroodtuoe-aes3.moorylimaamffadnaannehctiknepO.tolrenrocnoemohhtaatblluffu3,moecnaanwollaedargpusreyubgnireffefffosr

taaterG.pihsnaanmkrowfoytilauqehtot,sllawretsalP.edishcaacenohtaatbhtiwraarc2-2eraardedulcnioslA.yrdnuaaulro2,smoorgnivilymmyoor,egarotstaaterghehtfohcaacE.egaagraargdehcaacttaathtiwtnemasreffefffooslagnidliubsihtxelpudedisylevolsihtforenwotxenehtstiaaiwaawla

.000,913$.eiriaairPylnO.ellivecnirP–slliHyaaywkcorBni-utropporuoyssimt’noD.truocllabtek

AIIAROEPPE.009,441$.egarots

dehsroiretxE.oitaatpetercnochtiwdraaryadhtiwecaacpsgnivildednaanpxerofswollamoorhtaatbynaanM.sseccaacmoorhtaatbllij//jkcaacjykcaacbruoyyojnnjeotaeraargninid/nehctikt,sretnuocetinaanrghtiwnehctikdetaatdpuolfdoowdraarhserutaateffemoorgniviL.tolordebeerhtyzoCnikeP,namreeV0031

NIINKKIEPPEdnaanlsIkcoRdnaansloohcsotesolC.egaraargvilylimaamffaetaatraarpes3;sroolffldoowdraarhhctikrewenserutaateffehtaatb2/12,moordebc,mraarhchtiwsetaatidaryrots2luffuituaaueBsumuoYellivecnirP,eunevAAvnwoT907

rosyotruoyroffomoorartxesedivorpkcaacbegraarlnidecneF.swodniwthgilyaaymoorylimaamffalevelrewolehT.setaatdpumserutaateffemoordebretsaM.sweivdraaryni-taatE.secnaanilppaapSSdnaangniroolffleliehtyojnnjE.naanlproolfflnepodnaangniroorenrocnodetaatcolemmeohlevel-irt,moo

.009,981$.liaairtdraarc3,yrdnuaaulroolfniaaim,saeraargniv,sretnuocetinaanrg,stenibaabc"24htiwneh3sihT.sedargpufostoldnaanretcaacraarhc!taatertehtottegotegakcaacpehtnepots

.009,991$.tnaanlpellivssoMTAATCmdnaan,tcirtsiDloohcSpaaplnuDnidnuorgnedraargderucinaanmylluffuituaauebdnaandraarykceddereit-2suoicaacpsylluffurednow,fooruo-klawhtiwemohelytshcnaanrkcirBlla052revOpalnuD,slliHradeC.W0231

PALLANNLUUNDtuohguorhttniaaiphserffr,roolfflniaaimnoelit1,tnemesabelbaabsU.gniniaaitretnetaatergrofaL.smoordeblanoitiddaetaatercotsnoitpogihdnaangniroolfdoowdraarh,sni-tliubluffuituorhteunitnocewsA.noitaatcoltaaterg,gnihtgnellluffuehtssorcaacsnmulocegraarlhtiwhchcumosserutaateffeemohsihT.sthgieHskcolbtsujdetaatcol,tnemesablluffudnaanirbluffurednoWWoairoeP,tcepsorP.N4224

dnaantnemmeniaaitretne,gnippohsotsetunimmifoercaacnaannoeromdnaansihtllA.saeraarkcaacbdedoowetaatvirpagnikoolrevO.krednuselcihev3roffoecaacps,tnemesabtsihtniecaacpsgnivilylimmiaamffo.tfft.qs00

.009,541$.tdnaantepraarcweN.egaraargdehcaactedraarc1moorgniniddnaanmoorgnivilnepoegraarhtiwsmoordeb3yltnerruC.sgniliechg-uaauebecitonlliwuoyesuohehttuohg-cneffeliaairhtiwtolrenroca,hcroptnorffredistuotraartss'teL.mraarhcdnaanretcaacraarhairoePfonoitcaacnwotnwodehtmorffrlevelreppudehsiniffihtiwwolagnubkc

Donna Brewer, Local Representative (309) 742-4661

Mon-Fri 9-4; Sat 9 to noon



and play at a faster pace.”The Trojans grabbed an early

lead against Henry in the third-place game at Princeville, struggledin the second half and then ralliedfor a 49-39 victory. Vince Lenzihad 20 points to lead Elmwood andJohnny Keefer added 8 – severaloff nice feeds from Isaiah Groeperwho has made a real effort to dis-tribute the ball more.

Elmwood also beat DePue 60-39behind 14 points apiece fromGroeper and Lenzi.

Elmwood is home Friday againstROWVA-Williamsfield.

FarmingtonWith top scorer Trey Swearingen

shut down for 10 days due to re-cover from a strained hip flexor, theFarmers (11-4) went shorthandedto the competitive Macomb Holi-day Tournament.

But with the exception of a 65-39opening loss to Illini West, Farm-ington was in every game.

Eric Higgs averaged 14 pointsper game for the Farmers and putup 32 against Canton in a 58-50,double-overtime win. Farmingtonalso topped Abingdon-Avon 50-30(Reid Berry 10 points) but lost toWest Hancock in the consolationfinal (Higgs 10).

“We ran out of gas against WestHancock,” coach Jeff Otto said.“But to be sitting at 10-4 with theinjuries we’ve had, I’m prettypleased. We haven’t talked much

about the guys that aren’t in thereand I’ve been proud of the kids thathave stepped up.”

No question he was happy to seeSwearingen back in the line Tues-day for a 69-56 win over Ridge-wood. Judd Anderson scored 25,Swearingen 18 and Higgs 15.

Farmington is at Havana Friday.Princeville

Princeville (7-6) had a letdownafter its second-place tourney finish,falling 45-41 to Roanoke-BensonTuesday despite 12 points fromNick Kraft. That leaves Kraft sixpoints short of 1,000 for his career.

Prior to that the Princes had beenplaying well at the tourney, crushingNorth Fulton, 61-25 (Streitmatter,Kraft 22 apiece) and Henry, 69-49.

“We played awful well that night.Bauman, Kraft and Streitmatterscored but Matt Thole had 13 andthat’s huge for us to get that fourthscorer,” Kratzer said.

Rest prior to the tourney helpedThole’s nagging shoulder injury,Kratzer said.

ROWVA-Williamsfield“Christmas break nearly broke

us,” ROWVA-Williamsfield coachBob Anderson said.

He wasn’t kidding, as Tuesday’slopsided loss to Kewanee Wethers-field demonstrated.

The Cougars (9-2) lost fourstarters since their last outing, a winover North Fulton back on Dec. 22.

That includes two top scorers:Zach Smith is out after rolling hisankle and “might be back in a week

or two” Anderson said; Ricky Mc-Creary will miss 11 games for a dis-ciplinary suspension.

Two other injured starters who arealso sidelined are Michael Gibsonand Bret Woodside, who might seeaction as he recovers from a crackedbone in his foot.

Brian Brown, who was expectedto start Tuesday, rolled an ankle inpractice and was sidelined.

“The only starter we’ve gotwhose been with us most of the yearis Garrett Wight,” Anderson said.“We’re in sad shape now.”


BOYS: Swearingen rested sore hip muscle

TRIVIA TEST By Fifi Rodriguez1. POLITICS: What sitting vicepresident shot and mortallywounded a political rival in a duel?2. LANGUAGE: What does the Latinsuffix “grade” mean?3. MOVIES: What was the name ofthe angel who visited George Baileyin “It’s a Wonderful Life”?4. TELEVISION: What was the titleof the theme song to the sitcom“Cheers”?5. U.S. STATES: What state’s mottois “North to the Future”?6. ANIMAL KINGDOM: What kindof animal would be described as“lupine”?7. GAMES: How much money doyou get when you pass “Go” inMonopoly?8. LITERATURE: What are thenames of the two feuding familiesin “Romeo and Juliet”?9. GEOGRAPHY: What two coun-tries does the Cheviot Hills rangedivide?10. GENERAL KNOWLEDGE: Whatis the birthstone for April?

Answers1. Aaron Burr2. Walking or moving3. Clarence4. “Where Everybody Knows Your Name”5. Alaska6. A wolf7. $2008. Montague and Capulet9. England and Scotland10. Diamond

(c) 2015 King Features Synd., Inc.

FOR ANSWERS SEE PAGE 12

MOVIES1. The Hunger Games: Mockingjay

— Part 2 (PG-13)2. In the Heart of the Sea (PG-13) 3. The Good Dinosaur (PG)4. Creed (PG-13) 5. Krampus (PG-13) 6. The Night Before (R) 7. Spectre (PG-13) 8. The Peanuts Movie (G)9. Spotlight (R) 10. Brooklyn (PG-13) 2015 King Features Synd., Inc.

Jake Roberts, ElmwoodElmwood High School senior Jake Roberts

plays basketball and baseball and is also part ofNational Honor Society, Student Council, Elm-wood Excellence and Key Club. After graduatinghe plans on attending Butler University where heplans to obtain a business degree.

Jake has played basketball for many years andsaid that he especially loves, “The team aspect ofbasketball. You play as ateam, but at any time, one per-son can really make a differ-ence.”

Jake said that high schoolsports have taught him manythings, but one lesson was,“Life goes on – if you have abad game or bad play, the sunis still coming up tomorrowand you need to shake it offand move on.” A moment Jake said he would longremember was, “In the fifth inning of our sectionalgame last season, we were down 2-0, and I hit atwo-run homer to tie up the game.”

When asked about his support system, Jake sin-gled out his older sister Bekka, saying, “Bekka hasgone through it all before and lets me vent thengives me good advice.”

Jake also said that he thought he was nominatedfor Athlete of the Week because he had played bothbaseball and basketball for all four years of highschool and because he tried to be a leader to under-classmen on the teams. When he graduates, he saidhe will especially miss the welcoming sense hegets from, “Walking down the hallway and saying‘Hi’ to each person.”

– Erik Davis

ATHLETE OF THE WEEK

Sponsored by The Weekly Postand Elmwood Insurance Agency, Inc.

CUBA – The ICAC boys bas-ketball tournament opens Monday(Jan. 11), with games at Cuba.

Monday, Jan. 115 p.m. – Delavan vs. Williamsfield6:30 – Elmwood vs. Illini Bluffs8 – North Fulton vs. Brimfield

Wednesday, Jan. 135 p.m. – Brimfield vs. Delavan6:30 – Elmwood vs. Williamsfield8 – Illini Bluffs vs. North Fulton

Friday, Jan. 155 p.m. – Brimfield vs. Illini Bluffs6:30 – Delavan vs. Elmwood8 – Williamsfield vs. North Fulton

Saturday, Jan. 162 – Illini Bluffs vs. Williamsfield3:30 – Elmwood vs. Brimfield5 – North Fulton vs. Delavan

Monday, Jan. 182 p.m. – N. Fulton vs. Elmwood5:30 – Illini Bluffs vs. Delavan7 – Williamsfield vs. Brimfield

ICAC Tournament

www.wklypost.com



AAuuttoo HHoommee BBuussiinneessss LLiiffee HHeeaalltthh

YYoouurr PPrrooffeessssiioonnaall IInnddeeppeennddeenntt IInnssuurraannccee AAggeennccyy

PPeegg BBiivveennss,, CCPPCCUUAgency Principal

113311 NN PPuubblliicc SSqquuaarreeKKnnooxxvviillllee

((330099)) 228899--44113377wwwwww..lleeaagg..bbiizz

CCaallll TTooddaayy!!

to start the third quarter, as Farm-ington had been scoring inside onus,” coach Jim Blane said.

Not only did that work, but Ken-zie Schlipf re-entered after first halffoul trouble and was effective in-side, as was Shayla McCormick.Kennedy Dura, who scored 23points, and Nicole Thurman, with18, also found their touch outside.

That game followed a solid show-ing at The State Farm Classic inBloomington. Brimfield finished inthe consolation championshipagainst a familiar foe, Peoria Chris-tian, and lost a tough one, 45-40.Dura had 16 in the loss.

Brimfield was successful in thetwo games it needed to reach theconsolation championship, toppingRock Island Alleman, 40-27, andLeRoy, 66-56. Three Lady Indianswere in double figures versusLeRoy: Dura with 26, Thurmanwith 15 and McCormick with 11.

In its tournament opener, Brim-field fell 41-35 to powerful Kanka-kee Bishop McNamara. Afourth-quarter comeback wasn’tenough for the Lady Indians to off-set a four-point second quarter.

“I was happy overall with whathappened for us in the tournament,”Blane said. “ We played very goodteams and battled back when wewere down, which will help us inthe long run.”

ElmwoodElmwood bounced back from a

rough holiday tournament by crush-

ing West Prairie on Monday. Elm-wood (10-6) jumped to a 43-5 half-time score in a 62-32 final. AllieMeyers scored 12 and Morgan Led-better added 11 to pave the way.

A 43-33 loss to the PrincevilleHoliday Tournament host teamended a difficult run. Regan Mc-Fall’s 13 points and nine from Led-better weren’t enough.

On day two of the tournament,the Lady Trojans fell to Roanoke-Benson, 49-28. Elmwood led afterthe first quarter by one and waswithin striking distance down eightat the half, but could only scoreseven in the third and was shut outin the fourth. Meyers, despite beingdouble- and triple-teamed, was ef-fective early, but found scoringharder as the game progressed andfinish with 11.

Elmwood opened with a 51-49win by surviving a Bushnell PrairieCity comeback. A 30-12 lead defi-nitely didn’t mean a cruise to vic-tory as the Lady Spartans struck for21 in the third and 16 in the fourth. Elmwood’s productive post duo ofMeyers and Morgan Ledbetter,along with play-making guard Jor-dan Jones, sparked Elmwood. Mey-ers had 19 points and 14 reboundswhile Ledbetter added 10 pointsand Jones scored nine.

FarmingtonFarmington (8-12) played the first

half of Monday’s game with Brim-field like a highly rated team with alot of confidence. Particularlystrong was inside play of Morgan

Powell, who scored 14 and MeghanWherley’s seven. But both an offen-sive and defensive drought struckthe Lady Farmers, as the teamstruggled to a 23-8 deficit in quarterthree of a 68-44 loss.

“Of course we have to finish, es-pecially against good teams likeBrimfield, but we hope that firsthalf is a sign of things to come,”coach Jimmy Jordan said. “ Gettingthe ball inside and being strongthere is encouraging, but it didn’thappen that way in the second half.”

Farmington’s final game at the24- team Beardstown Holiday Tour-nament was against PrairielandConference opponent Abingdon-Avon and resulted in a 52-36 lossfor the Lady Farmers. That was thethird meeting already for the twoteams and Jordan knew the taskwould be a challenge.

“It’s hard to beat a team threetimes in a short period of time,” hesaid.

Farmington also fell to IlliniBluffs, 52-43, after braving a longtrip to Beardstown in wet, windyweather. The scoring was balanced.Megan Gilstrap had 12, followedby Abbey Brown with 11 and JuliaDePriest with 10.

A 56-30 loss to third seed WestCentral saw Gilstrap score ninepoints. The Farmers got off to agood start with a 54-22 dismantlingof Griggsville Perry. Balanced scor-ing was the theme: Rylie Putrich ledwith 12, DePriest had 11, Brownhad 10 and Gilstrap added 9.

Generac Automatic Standby GeneratorsGenerator Sales-Service-Installation

309-639-2400

Ingle

GIRLS: Brimfield in consolation title gameContinued from Page 16

poll has Brimfield ranked No. 2 inClass 1A (behind only Okawville),this after the Indians were No. 4 tostart the season.

Then again, rankings mean so lit-tle it is laughable. Remember allthe ranked teams unranked Brim-field beat to go 34-2 and win it all?Being a dark horse might havehelped the Indians. Not this year.Riding a 33-game win streak, theywear bull’s-eyes every night.

So far Brimfield has been up toevery test, including Tuesday’ssticky game at Elmwood. And thereare several reasons why.

Phelan Kelly is No. 1. Vastly im-proved, he can score from inside

and outside and is emerging as thego-to guy. But he has help in thebackcourt. Koby White is also ascorer and Jace Swietek is a wildcard – a streaky shooter who, whenhe gets hot as he did vs. Elmwoodon Tuesday, can change a game.

“Nobody is as good as theCuevas kid, but Kelly is very goodand so is White. Maybe the two ofthem as a combination are tougherto beat,” ROWVA-Williamsfieldcoach Bob Anderson said.

Beyond that is the big fella, 6-foot-8 Brad Novak, a huge pres-ence on both ends. Imagine fightingthrough pesky guards only to runinto that big wall. No thanks.Novak is also a better scorer and

Brimfield has done more to get himthe ball.

“I think they’re right where theywere last year,” Princeville coachJeff Kratzer said. “They’ve gotsome depth coming off the benchand they’ve got real scorers.”

Let’s leave the final assessmenton a question that won’t be an-swered until March to Brimfieldcoach Scott Carlson.

“I will say at this time last year Ihad no idea how good we were,”Carlson said. “The big differencethis year is we have four guys aver-aging double figures. I think our of-fense is more diverse. But we needto get better defensively. Once weshore up the defense ...”

LAMPE: Brimfield ranked No. 2 in Class 1A Continued from Page 16

SEE OUR CLASSIFIEDS ... Page 11Place yours for JUST $5 @ (309) 741-9790

Weekly Post Sports www.wklypost.comTHE WEEKLY POST • Thursday, January 7, 2016


Hot news tip? Want to advertise?Call (309) 741-9790

Text Your Scores To (309) 231-6040 or email

[email protected]

By JEFF LAMPEWeekly Post Staff Writer

PRINCEVILLE – Thelead was just eight. Thecrowd was stirring in aspecial New Year’s Eveedition of the PrincevilleHoliday Tournament.

Then Phelan Kellymissed a 3-pointer, fol-lowed his shot, grabbedthe rebound, drove to thebasket for a layup andended talk of an upset.

Brimfield (13-0) wenton to win its third straightPrinceville tourney and itseighth in the past nineyears with a 61-47 victoryover Princeville.

“All the momentumwent right back to them,”Princeville coach JeffKratzer said of Kelly’splay. “He’s a tough guardand he made some toughshots.”

That included one left-handed layup from underthe basket that drew ravesfrom coach Scott Carlson,who actually raised hisvoice in the second half ofthe title game – for one ofthe first times this season.

“They can’t just gothrough the motions andwin ballgames,” Carlsonsaid.

Instead, Kelly racked up27 points and 6-foot-8Brad Novak scored 16 on8-for-11 shooting andgrabbed 10 rebounds.

That offset 14 pointsapiece from Princes gun-ners Brendan Streitmatterand Noah Bauman.

The title game was asclose as things came forBrimfield in the tourney,as the defending Class 1Astate champs routed Elm-

wood in the semifinals70-39 (guards Kelly andKoby White combined for34) and crushed Low-point-Washburn, 77-7.

Brimfield followed itstitle with a second win atElmwood on Tuesday, thistime by a closer score of58-48. Kelly had 23points and Jace Swietekheated up for 13 of 16 inthe first half. Novak alsoscored 16. Jake Robertsled Elmwood with 13 andJacob Brown had 10.

Brimfield is home vs.North Fulton on Friday.

ElmwoodIf not for playing Brim-

field twice in its past fourgames, Elmwood (7-7)would be feeling muchbetter about things.

“We played pretty wellagainst DePue andHenry,” coach Josh Fugittsaid. “Henry is a prettygood team and we wereable to press them a littlebit, get some turnovers

By PHIL JOHNSONFor The Weekly Post

John Gross reached a milestoneMonday, earning his 700th careervictory as the Lady Princes cruisedby ROWVA, 63-18

Breana Baumanled with 16 pointsand Claire Berch-told added eight forPrinceville, whichhas edged over the.500 mark at 9-7.

The Lady Princesalso placed secondat their own holiday tournament, fin-ishing 2-1 with a 43-33 victory overElmwood. Princeville was led in thatgame by 16 points from Bauman and12 from Jessica DeVries.

Earlier in the tourney, Princevillewore down Bushnell Prairie City,46-30. A big early lead of 21-2, fol-lowed by a BPC rush in the middle,then a strong finish by the LadyPrinces was the result. Lucy Waid’s15 points, followed by Bauman’s 14

helped to lead the way.“We like to play up tempo, and we

finally figured out their man press,which both helped us to pull away,”Gross said. “Sophomore (Cait)Pullen is coming on strong to help usin those areas.”

In its tourney opener, Princevillefell in overtime to Roanoke-Benson,47-43. It was a 20-12 fourth quarteradvantage that gave Princeville achance. The leading scorer was Waidwith 18, followed by Bauman at 11and Pullen with 8.

“We had our chances, but I washappy with us for not giving in,”Gross said.

BrimfieldOn Monday, seventh-ranked Brim-

field found itself in a first-half battlewith Farmington. Leading just 31-29at the break, the Lady Indians cameout of the locker room with a 21-0run that eventually resulted in a 68-44 victory for Brimfield (18-3).

“We decided to go to a 1-3-1 zoneContinued on Page 14Continued on Page 15Continued on Page 15

Brimfield winsP-ville tourney

Gross posts 700th victory

Brimfield’s 6-foot-8 BradNovak enjoyed a sizeadvantage over foes inthe Princeville HolidayTournament. Photo byCollin Fairfield.

Brimfield senior guard Koby White is one reason the Indians are off to a per-fect start that included a Princeville Holiday Tournament championship.Photo by Monte Kenney of Brimfield/Elmwood Sports Shots.

Gross

The question is premature andsome might say ludicrous. Butit’s a cold winter day. What elseis there to do but argue aboutbasketball?

So here goes: Is it possible thatthis year’s Brimfield boys bas-ketball team is better than lastyear’s Class 1A state champs?

Seriously. Yes, Carson Cuevasgraduated and was a once-in-a-generation talent. But by the endof next week, Brimfield (13-0)may have a better record thanlast year’s squad, which lost con-secutive games to Delavan and

Elmwood inthe ICACtournament.

Prior toTuesday, thisyear’s teamhad beenpushed onlytwice – andwon thosegames by dou-ble figures,

going away. The Indians havebalanced scoring, depth, size,shooting and that darned 1-3-1zone that pesters everyone – par-ticularly foes who do not see itvery often.

Elmwood coach Josh Fugitthas lost twice to Brimfield thisseason, most recently on Tues-day by a 58-48 score in a muchbetter showing for the Trojans.Fugitt offered this assessment.

“I think they are more bal-anced at this point in the season.And I think they are fartheralong as a team than last year,”Fugitt said. “They are playingseven seniors. You don’t see thatvery often. The last time yousaw it, Illini Central won a statechampionship.”

So is a two-peat possible?Well, the latest Associated Press

Is it possibleBrimfield iseven better?

JeffLAMPE

the weekly post 1/7/16

Documents