2013 semester 1 summer recreate

RECREATE COURSESnew & improved 7 week options p18

UWA SPORTS Comps kick off your year p12

Come & Trysee what’s in store p5

RECREATE®

$12/week 2013 fitness memberships p7

SEM1summer2013

welcome to UWA 2013!

18

With 6 workout zones boasting state-of-the-art fitness training equipment, over 60 group fitness and training classes per week, and free court hire.

Visit us at the UWA Recreation & Fitness Centre at the north end of Crawley campus and see it for yourself.www.sport.uwa.edu.au | we fit your world

$12PER weekMEMBERSHIPFitnessUWA Sports

from

We Fit

Your World.

Fitness & TrainingINSTRUCTOR PROFILES

Directors Note

07 Memberships

Fitness

Group Fitness & Training

06

08

Recreate

Course List7 WEEKS LONG

18

Sport

Facilities

UWA Recreation & Fitness Centre

36

editor bea sonnenberg | artwork aaron mitcham | printing optima press, matt clarke | contact tel (08) 6488 2286 email [email protected]

Events Calendar04

How to Enrol06

Get outside and get active with a range of short course options to choose from.

Get more out of your University and get involved in fitness at UWA Sports.

Game on. Take to the field this semester with a variety of sporting competitions at UWA.

12 Social Sports

TSWATERTIARY SPORTS WA

15

Club & Team Contacts

30

10

On Campus CompsINTER-FACULTY & INTER-COLLEGE

SPORTS

14

Here at UWA Sports, we believe in living a healthy active lifestyle. Our memberships and programs are designed to give you everything you need to keep active and healthy.

Whether you’re looking for a fresh start to your fitness or want to maintain your current levels, to play sport or join a club, UWA Sports is ready and willing to help.

UWA Sports. We fit your world.

Australian Uni GamesNATIONAL INTER-UNIVERSITY SPORT

16

Australian University Championships

17

05 Come & Try WeekUWA SPORTS FEATURE EVENT

Staff & Alumni

Course List26

Go from work to work out with UWA Sports premium Staff & Alumni Fitness classes and training.

Clubs & TeamsJoin in the fun with UWA sport clubs and teams.

No matter where your passion lies, UWA Sports has you covered. Check out our state of the art facilities.

UWA Watersports & Leadership Centre

37

UWA Sports Park38

UWA International Martial Arts Centre

38

UWA Aquatic & Rehabilitation Centre

39

3

THINKFASTSTAYSOCIAL

FacebookCheck out the latest photos, notifications, and general news from UWA Sports at www.facebook.com/uwasports

TwitterGet updated with UWA Sports, and stay in the loop with handy hints, interesting new stories, and more. @UWA_Sports

Keep in touch with UWA Sports with our social media sites. We’ll keep you up to date with the latest promotions, events, fitness tips and much more, so you’ll never have to miss a beat.

Daily Replay BlogVisit www.dailyreplay.com.au for daily news, videos, articles, tips, healthy recipes and more straight from the UWA Sports office.

EmailGet UWA Sports straight to your inbox. Go online at www.sport.uwa.edu.au and click the orange RSS button.

Apr

1mon 2tue 3wed 4thu 5fri 6sat sun







20mon 21tue 22wed 23thu 24fri 25sat

sun






UWA Sports Sem 1 2013 Events Calendar

Come & Try Week

Uni Holiday New MonthRecreate® CoursesEvents Sport Days Uni Dates

TSWA

Good Friday

May

Semester 1 starts

7

14

21

28

5

12

19

31

3

10

17

24

Mar

Recreate courses,Social Sports start

TSWA

TSWA

TSWA

State Nickel Swim

4

Inter-Fac Sport

Inter-Fac Sport

Inter-Fac Sport

Inter-Fac Sport

Inter-Col Sport

Inter-Col Sport

Inter-Col SportInter-Col Sport

Fwy Bike HikeInter-Col Sport

TSWA - VC Cuprowing & sailing

TSWA

TSWA

TSWA

TSWA

Study Break

Easter Sunday

Inter-Fac Sport

Inter-Fac Sport

Inter-Fac Sport

Inter-Fac Sport

Inter-Fac Sport

Inter-Fac Sport

Inter-Col &

Inter-Col Sport

Inter-Col Sport

Inter-Col Sport

Inter-Col Sport

Inter-Col Sport

Inter-Col Sport

AUC orienteering

Recreate Courses start


Come & Try Week

24


sun

Semester 1 ends

26

Jun

35

RAC Freeway Bike Hike for Asthma24 March 2013Join Team UWA at this year’s Freeway Bike Hike to get out, get

active and raise much needed funds for the Asthma Foundation of

WA. Sunday March 24 will see the city bound lanes of the Mitchell

and Kwinana freeways closed and thousands of cycling enthusiasts

descending on Perth’s Langley Park, all in the name of charity.

Participants can choose the distance they want to ride with three

distance options; Mini Hike, Mid Hike and Full Hike, and with

starting locations on the north and south sides of the Swan River

it is easy to get involved. Being part of team UWA will not only

give you at 15% registration discount, but will also count towards

UWA’s challenge for the perpetual Uni-cycle Challenge Trophy and

bragging rights over other WA Universities.

Just remember when registering to search for the team name

“UWA” and enter the discount code (available by emailing Alicia

[email protected]) to join in the fight for UWA

supremacy.

For more details on courses, start and finish times and locations

or to register go to http://events.sportsnewsfirst.com.au/event/

freewaybikehike/.

Feature Events

Come & Try Week18 - 22 February 2013Attention all UWA Students! Get your gym clothes out of the

wardrobe, dust off your racquet and get down the UWA’s Recreation

and Fitness centre to “Come and Try” a taste of what YOUR fitness

centre can offer YOU.

From the 18th to 22nd of February the Recreation and Fitness

Centre (located next to Hackett Hall, north end of the Crawley

Campus) will be hosting an action packed program of group fitness

classes, Recreate® course sampler programs and drop in sports

activities open to all UWA Students. Most classes have limited

spaces available, so be quick to register. Once you’re hooked to

the wide range of group fitness classes or to the vast assortment of

state-of-the-art equipment available have a chat to the Rec Centre

staff about $12/week membership offers.

Courts are also available to hire during this week, free of charge

including equipment, simply leave your student card with reception.

To register and for more information go to www.sport.uwa.edu.au/

event/come_try and we look forward to seeing you get active at

Uni.

Welcome to Recreate® Semester 1 Summer.

With new and returning students buzzing around campus, filling it with life and busily preparing for the start of semester, UWA Sports is putting on an exciting range of fitness, recreation and sports activities to complement the UWA experience:

FitnessThe UWA Recreation & Fitness Centre is ready to open its doors to all gym enthusiasts on campus: State-of-the-art equipment, extended opening hours and qualified fitness staff, many of whom have a sport science background, are awaiting the rush of fitness-minded students.

Paying your Amenities & Services Fee entitles you to a complimentary Sport Association Membership with great discounts off fitness memberships. Take advantage of this fantastic opportunity and reap the benefits.

RecreationKeen to learn a new skill? Then take a look at our Recreate® program, which will teach you paddling, windsurfing or

Bruce MeakinsExecutive DirectorUWA Sports

sailing in no time. Running for 7 weeks at a time, sessions are structured to lead you to the desired outcome by the end of the course.

SportsHow about playing sports? UWA Sports offers an outlet for every type of sporting ambition and ability: Get your mates together and get involved in Social Sports for a more laid back approach, or pursue an elite athlete pathway through a variety of university sporting competitions and our sports club system and follow in the footsteps of some of Australia’s greatest Olympians, who have started their sporting journey at UWA.

Get active this semester and make the most of your UWA experience.

Bruce MeakinsExecutive DirectorUWA Sports

How to

ENROL and get involved.

Who Can Enrol?Anyone can participate with UWA Sports. UWA Sport Association members receive a 25% discount on all courses and memberships.

CancellationsIf a Recreate® course is cancelled due to insufficient numbers, fees will be refunded in full and you will be notified.

Enrolment FormsAre available for download online at www.sport.uwa.edu.au/forms or from the UWA Recreation & Fitness Centre front desk.

NoteParticipants must be physically and mentally capable to undertake the activity they involve themselves in.

In Person The fastest way to enrol. Head down to the UWA Recreation & Fitness Centre front desk and complete your enrolment with one of our friendly staff.

Online Get started with UWA Sports from your computer. Check us out online at www.sport.uwa.edu.au and see membership prices, updated course info, all the fitness classes, as well as all of our programs and events.

There’s more than one way to live a healthy active lifestyle. Whatever your passion, UWA Sports can offer you a path. Enrol in fitness, sport, short courses and other programs at UWA Sports.

6

UWASPORTSMEMBERSHIPS

4

$0 freeUWA STUDENTSPayment of the Amenities & Services Fee gives you FREE UWA Sports Association Membership, including all benefits and discounts.

$150UWA STAFF, ALUMNI,& ASSOCIATES

$12/week12 MONTH MEMBERSHIPTotal cost: $600Duration: 50 weeksAvailable to: UWA students & Association membersCommunity price: $850

$16/week6 MONTH MEMBERSHIPTotal cost: $400Duration: 25 weeksAvailable to: UWA students & Association membersCommunity price: $550

$20/weekSTAFF FITNESS & ALUMNIPREMIUM MEMBERSHIPTotal Cost: $1,000Salary packaging availableIncludes special benefits; see page 12.Duration: 50 weeksAvailable to: UWA staff & alumni only.

$90MULTIPASSDuration: 10 casual visitsAvailable to: UWA students & Association members Community price: $120

Associates are immediate family members of UWA staff, students, and alumni, and to students and alumni from other universities.

Association membership is not available to community members.

ASSOCIATION Members Fitness MembersFitness memberships include access to all gym floors, group fitness classes, free appraisals, as well as an hour court hire free every day.

Association memberships are the gateway to UWA Sports, giving you discounts on our services and programs

pool access

only $3extra

*/week

*only available with 12 month membership package 7

I break the fitness protocol for my clients down into three simple and effective areas; nutrition, training, and consistency.

Nutrition: Abs are made in the kitchen.We know that food has three sources of energy - fats, proteins and carbohydrates. Somewhere along the line someone decided that fats were bad for us. Seems intuitive enough, “I don’t want to get fat so why would I eat fats?”. So we laden our diets with carbohydrates and protein.

Carbohydrates as an energy source were designed to be used to fuel vigorous activity and refuel after vigorous activity. If you’re going to the gym its ok to have some carbs in your meal beforehand as you know it will get used while you exercise. If you have just finished a gym session, have some carbs in your meal straight after, you know it’s replenishing the muscles you’ve just used. At no other times are carbs really necessary. Your desk job certainly isn’t vigorous and doesn’t require a large breakfast of carbs: cereal, toast, fruit, fruit juice. At all other times, those carbohydrates are converted to fat and stored in your fat tissue.

That someone who decided eating fat made you fatter? They were wrong. When a larger portion of your diet is made up of

good fat, you signal to your body that fat as an energy source is not scarce. This tells your body you no longer need to treat it as a scarce energy resource, that you can burn it off and you’re body doesn’t need to store it.

Now assuming that you aren’t eating more than your body needs (no one can lose body fat if they are eating above their daily requirement) you are in the most optimized state to burn that fat! The only stipulation to all this is that you add healthy fats (not bad fats) to your diet. Think almonds, avocados, healthy oils (EVOO) and lean meats.

Training: Building Muscle Mass.The goal for everyone, both male and female, has and will always be to add lean body mass and reduce body fat.

Consider this simple analogy of your body. We have two cars, both hold 50L of fuel. We

As a trainer one rule still holds constant: you (the trainee) get exactly what you want and you can ask for anything. If you insist you want to walk on the treadmill for 30 minutes that is exactly what we will do. My role as a trainer is to make what you want to do and what you need to do to match up. My goal is to set you on the right path with a few basic principles of health and fitness that should deliver you the best results.

To an outsider the fitness world can be very confusing and is ever changing. There is always a new fad diet today and a new training philosophy tomorrow. High carb versus low carb or no carb? High protein or low protein? What about low intensity long distance running/riding, short sprints or interval training? Or are you better off doing weight training? The questions go on and on and the answers are often conflicting.

My process is simple; no tricks, just consistent and thorough training. You only get out what you put in.

start the cars and we’ll keep them running continuously until all the fuel is gone. In this analogy the fuel refers to the extra fat we are carrying around that we want to get rid of. Car A has a V6 engine and Car B has a V8 engine. Which car uses its fuel up the fastest? Its Car B, because it has a bigger engine that uses more fuel per unit of time. So we need to figure out how to build a bigger engine for the human body so it too can burn that extra fuel (fat) we are carrying around.

The quickest way to build that engine is strength training, specifically 3 to 4 weight sessions of 45 minutes each per week. The important thing to remember is to push yourself beyond your normal limits. That last rep in every set is meant to challenge you, it’s meant to be almost impossible. Run for that last minute on the treadmill even though your lungs are screaming at you to stop. It is the intensity that will work for you in the long run.

The goal for everyone,

both male and female,

has and will always be to

add lean body mass and

reduce body fat.

Consistency: Day in and day outNone of the above will get you any results unless you can do it day in and day out. This is where our minds hold us back the most. Yes we can do the hard work in the kitchen for one day of good eating and yes we can go hard in the gym for one day, but its the people that can do it day after day that see the results.

That’s the final frontier we all have to conquer, making sound daily habits so this part of our life can be put on auto pilot. That even when life’s hurdles get in the way, when you haven’t been eating well or haven’t had the chance to get to the gym for a couple of weeks, your preformed habits are so well ingrained that you can get back to the basics covered above quickly.

ARUN SIVAKUMARUWA SPORTS FITNESS TRAINER PROFILE

Qualifications:Human Anatomy & Physiology, 5th Year Bachelor of Medicine and Surgery, Senior First AidAreas of Expertise: Body Recomposition - Nutrition and Fat Loss, Strength and Conditioning, Hypertrophy Training, Boxing for Fitness.

Why the fitness Industry?Being active has always been an important part of my life, whether it’s playing sports, running or working out in the gym. Even as a kid I participated in my mum’s aerobic classes, back then known as ‘Jazzercise’. I loved the social aspect and buzz of the gym environment. So four years ago I began teaching group fitness as a side job at UWA Recreation and Fitness Centre. After many years of working in a sedentary office job I soon realised my energy was best spent fulfilling my passion and sharing it with others. Naturally moving into the fit-ness industry was the next step. Being able to motivate others, see the increase in their confidence and being able to help them achieve their fitness goals is so worthwhile. There is no greater gift than being able to enjoy what you do every day. Health and fitness goalsMy fitness goal for 2013 is to build overall body strength, in particular through the upper body. One milestone is to complete 5 pull-ups by the end of the year! Attaining a better work/life balance is also a big one for this year. I firmly believe in always striving to achieve and do your best in what you do but not at the cost of time with your friends and family. Also give yourself permission to take some time-out to do something that you really enjoy. This is vital to maintaining a healthy mind, body and soul. It’s about finding out what your priorities are and giving the quality time to those other areas

sources of exercise, however being that one of the goals for this year is to build upper body strength, UWA Sports trainer Jordan has designed a fantastic strength based program that includes heavy weight resistance exercises. I try to do the program three times a week as it’s a great challenge with speedy results. Pull-ups here I come!

Nutrition1. Eat foods that provide the most

nutritional value to keep your body fuelled for exercise.

2. Be kind to yourself, we all have our vices so if you do have a few ‘not so healthy snacks’ see it as a treat and enjoy it, tomorrow’s another day!

Just as important as it is to fuel up before you exercise, your body needs to replenish lost energy and nutrients as well as repair muscle post-workout with a combination of protein and carbs.

Achieving a terrific Tush!It’s all about finding a mixture of functional cardio and weight resistance exercises that will strengthen the glutes, give you definition and assist with activities for daily living. Try these exercises every second day begin with body weight then gradually add load with dumbbells (barbell for squats), for higher intensity give the plyometric exercises a go!• Squats – or plyometric (jump squats)• Lunges – or plyometric (jump lunges) • Step ups• Bridge glute raises• Single leg deadlifts• Hill running

Why the Fitness Industry?Being active has always been an important part of my life, whether it’s playing sports, running or working out in the gym. Even as a kid I participated in my mum’s aerobic classes, back then known as ‘Jazzercise’.

I loved the social aspect and buzz of the gym environment, so four years ago I began teaching group fitness as a side job at UWA Recreation and Fitness Centre. After many years of working in a sedentary office job I soon realised my energy was best spent fulfilling my passion and sharing it with others. Naturally moving into the fitness industry was the next step. Being able to motivate others, see the increase in their confidence and being able to help them achieve their fitness goals is so worthwhile. There is no greater gift than being able to enjoy what you do every day.

Health and Fitness GoalsMy fitness goal for 2013 is to build overall body strength, in particular through the upper body. One milestone is to complete five pull-ups by the end of the year! Attaining a better work/life balance is also a big one for this year. I firmly believe in always striving to achieve and do your best in what you do but not at the cost of time with your friends and family. Give yourself permission to take some time-out to do something that you really enjoy. This is vital to maintaining a healthy mind, body and soul. It’s about finding out what your priorities are and giving the quality time to those other areas in your life.

Staying in ShapeI currently train six days a week, teaching group fitness classes that combine high intensity cardio, core conditioning and yoga/pilates. These tend to be my main

Keeping a positive mental body imageWorking in the fitness industry it is easy to be consumed with ‘how you look’ and at times can become an unhealthy obsession.

One thing I have learnt - how you feel about the way you look is a reflection of how you feel about yourself on the inside and this is influenced by your thoughts. “.. your inner wisdom represents the voice that speaks from your heart - and the more you tune into this voice, the more power you give it.” You alone have the power to change your attitude towards your body image though positive thinking.

A common error that we are all guilty of is comparing ourselves to others, this is a waste of energy as we all have different body types and genetics that we can’t change. Embrace the body you have been given and if you want to make a change write down what you want and research how you are going to do it, while setting realistic and achievable goals.

Know that having a down day is okay and happens to everyone, then take some time to acknowledge your achievements and how far you have come.

whatever is true, whatever is worthy of respect, whatever is just, whatever is pure,

whatever is lovely, whatever is commendable, if something is excellent or praise-

worthy, think about these things.

- Philippians 4:8.

Laura Birchenoughfrom desk job to gym junkieAfter joining the UWA Recreation & Fitness Centre team as a group fitness instructor 4 years ago, she lets us in on what motivates her to stay fit, happy, and healthy.

9

GROUPTRAINING

Powered by passionate instructors, you’ll always find enough energy to hit that next big beat!MUSIC + MOVES + PASSION = GROUP FITNESS!!

The UWA Sports Group Fitness team are experienced

professionals in delivering and leading incredible fitness

experiences every day. On goes the mic, on goes the

music…and they’re away! Our tireless team will inspire

and motivate you through each and every workout so

you never have to do it alone! We now offer 6 Les Mills

programs, Zumba & Yoga.

Need the music and want to see what we got? Try one of

our instructor-led classes: BODYPUMP™, CXWORX™,

BODYATTACK™, BODYCOMBAT™, RPM™,

BODYBALANCE™, Yoga & Zumba Fitness®.

Latest TimetableScan the code on the right to view the latest Group

Fitness & Training timetable, then come along to a class

and meet fellow fitness enthusiasts.

Ask us fitness questions and we’ll keep you posted on

the latest releases and classes!

Don’t need the music, but need that extra push? Try one

of our trainer-led Group Training classes: JumpStart,

Fitbox, UltraFit & RunClub.

Whatever it is that you want out of your workout, you’ll be

able to find something that suits every day!

GROUP Training CLASSES

FITBOX

Practice your boxing skills, improve your agility and functional core strength. FitBox combines agility drills, partner boxing and challenging abdominal exercises for an effective full body workout.

55minsintense | BOXing

JUMPSTART

JumpStart your calorie-burning engine with a mixture of cardiovascular and resistance training. Designed to motivate you and keep you on track with your long term fitness and weight loss goals. Open to all levels of fitness.

55minsMEDIUM | CIRCUIT

ULTRAFIT

If you are looking to test and push yourself to the limit, than UltraFit is the class for you. UltraFit is a challenging mix of high intensity cardio and muscular endurance resistance training. Go from fit to UltraFit. Medium level of fitness necessary. Good attitude essential.

55minsINTENSE | Conditioning

RUNCLUB

This is an opportunity to become part of a community - part of a “club” that will train together twice a week towards a different monthly event around Perth. Sessions will be structured to improve stamina, strength, speed and endurance and have you ready to run your best race!

60minsmedium | RUNNING

GROUPFITNESS

10

GROUP FITNESS CLASSES

BODYATTACK™

BODYATTACK™ is the sports-inspired cardio workout for building strength and stamina. This high-energy interval training class combines athletic aerobic movements with strength and stabilization exercises.

55minsintense | sports | 735kcal

BODYCOMBAT™

An MMA inspired workout that combines moves and stances from a range of self-defence disciplines like karate, boxing and taekwon-do. A fierce, energetic experience which raises fitness levels throughout the whole body. Unleash your warrior with an ultimate workout.

55minsintense | | 737kcal

BODYBALANCE™

A mix of eastern disciplines like yoga and tai chi, with popular new methods such as pilates. Controlled breathing, concentration, and a carefully structured series of stretches and poses creates an holistic workout that brings the body into a state of harmony and balance.

55minslight | | 390kcal

BODYPUMP™

A 60 minute class using barbells and adjustable weights to sculpt, tone, and condition muscles whilst raising metabolic rate for rapid fat-burning. The “world’s fastest way to get in shape”, challenging all your major muscle groups as you squat, press, lift, and curl.

60minsmedium | weights | 530kcal

RPM™

The ultimate ride to the rhythm of powerful music. A safe, motivational, aerobic experience designed to get you into the zone fast. Take on the terrain with your inspiring team coach as they lead the pack through hills, flats, mountain peaks, time trials, and interval training. Discover your athlete within - sweat and burn to reach your endorphion high.

45minsmedium | cycle | 635kcal

CXWORX™

Based on cutting edge scientific research, this 30 minute Les Mills™ workout combines the best of personal training with the energy of a group fitness class. CXWORX ™ hones your abs, glutes, back and obliques, while also improving functional strength and assisting with injury prevention.

30minsmedium | core | 230kcal

martial arts

yoga & Tai chi

YOGA

Vinyasa Flow Yoga focuses on poses & movements synchronised with breath. Static poses build strength, heat & flexibility, while a strong focus on core conditioning leaves you long, lean, calm & centred.

55minsLIGHT | YOGA

ZUMBA®

Dance away stress and reinvigorate yourself with Zumba®. The Zumba® program fuses hypnotic latin rhythms and easy-to-follow moves in a group workout environment.

55minsmedium | DANCE

11

SOCIALSPORTS

FREE! fitness

membershipfor team captains

Basketball

Enrolments open 11 FebKeen for a more laid back approach to sport? Get on the field with Uni Social Sports at UWA this semester. Get together with your mates and sign up!

UWA Social Sports is a casual sporting competition open to UWA students, alumni, staff, and community teams. Games commence 4 Mar and run the length of the semester. (13 weeks with finals being contested in week 13).

uwa

Game Times

Come into the UWA Recreation & Fitness Centre to sign up for a team, or head online by scanning the QR code right on your phone to visit our website www.sport.uwa.edu.au/sport/ess.

6:00 - 10:30pm UWA Sport & Research Park

MO

N Soccer* 6:00 - 10:30pm UWA Recreation & Fitness Centre

Netball 6:00 - 10:30pm UWA Netball Courts

Ultimate 6:00 - 9:00pm James Oval

M

M

M

M

W

W

W

W

mx

mx

mx

mx

TUES

Netball 6:00 - 10:30pm UWA Netball Courts

Touch 6:00 - 10:30pm James Oval

M

M

W

W

mx

mx

WED

Soccer* 6:00 - 10:30pm Riley Oval

Volleyball 6:45 - 10:30pm UWA Recreation & Fitness Centre

M

M

W

W

mx

mx

Prices$45 per game per team

Enrolment

12

M W mxmen mixwomen

SOCIALSPORTS

FREE! fitness

membershipfor team captains

INTRODUCING

FIND YOUR MATCH

FRIDAYNIGHTFUTSAL

Kick around, on us. Bring your team mates along or come find some new ones. Then register for the tour-nament the following friday night!

competitions

Friday 8 MarchKnock Out rounds and repechage5 - 8pm

Friday 1 MarchCome & Try3 - 5pm

Friday 15 MarchFinals5 - 8pm

$45per game per team

Got experience umpiring or refereeing any of these sports? We want you!

Email us your details, including any

qualifications and experience, and you

could be joining the UWA Sports team as an

offocial

Contact [email protected]

13

COMPETITIONS

Inter-Faculty is a great way for UWA students to represent their faculties, get fit and brag that their faculty is the best! Fierce rivalry has been taking place amongst the faculties ever since the University was founded. Competitions take place on most Wednesday afternoons and include excitement, fun and comraderie.

Sports representatives are elected from each faculty on campus at UWA. The representative coordinates the selection, training and games of each faculty. All sports representatives are required to attend the Inter-Faculty meeting.

SPORTSSquash | men women | 6 marTouch | men women | 13 marVolleyball | men women | 27 marBadminton | men women | 10 aprTable Tennis | open | 17 aprAFL | men | 24 aprNetball | women | 24 aprRowing | mix | 1 mayStaff v Student Cricket | 8 MayNetball | mix | 22 may

Part of college life is bragging about how good your college is to students from other colleges, and nothing gives you more bragging rights than winning the Inter-College cups. These two trophies, the WICSA for women, and the Nicholson for men, are fought for on Sundays during the academic year, in some hotly contested and fierce competition.

Getting involved is as easy as speaking to your respective College Sport Representative and telling them you’re interested in helping your College win.

SPORTSBasketball | 3, 10, 17, & 24 marSwimming | 13 marSoccer | 14, 21, & 28 marTouch Rugby | 1 mayVolleyball | 5 & 12 mayCricket | 19 & 26 maySoftball | 19 & 26 may

Do you have the need to compete? Scratch that itch with UWA Sports.

UWA Sports offers all varieties of sporting competitions, from casual local leagues to competitive tournaments. No matter what grade you’re after, you’ll find the right team for you with UWA Sports.

To get involved send us an email at [email protected].

INTER-FACULTY SPORT INTER-COLLEGE SPORT

on-campus

Do you have the need to compete? Scratch that itch with UWA Sports.

14

TERTIARY SPORTSWESTERN AUSTRALIA

Play for UWA and take on other Perth universities in a wide range of sports.

TSWA aims to enhance the student experience and foster the development of sport and recreation in tertiary education institutions by providing opportunities for students to represent their univeristy in quality competitions and programs in Western Australia.

GET INVOLVEDTSWA is open and encouraged to all univeristy students, across all faculties. It is the premier inter-university sporting competition in Perth, and is a great way to meet new people and stay active.

TSWA competitions are used as a precursor to the Australian Uni Games, which sees over 5,000 students from all over Australia compete in a variety of team and individual sports.

Head to www.tswa.com.au for more details or email [email protected] to register your interest and get involved today.

AUSTRALIAN RULES FOOTBALL

BADMINTON

BASKETBALL

BEACH VOLLEYBALL

CRICKET (SUPER 8S)

FLOORBALL

FOOTBALL (SOCCER)

FUTSAL

GOLF

HANDBALL

LAWN BOWLS

HOCKEY

NETBALL

ROWING

RUGBY UNION 7S

SAILING

SQUASH

2013 SPORTSTABLE TENNIS

TENPIN BOWLING

TENNIS

TOUCH FOOTBALL

ULTIMATE

VOLLEYBALL

UWA Selection TrialsMARCH15 Mar | Squash & Futsal22 Mar | AFL & Beach Volleyball27 Mar | Basketball & Touch

15

APRIL3 Apr | Volleyball & Hockey10 Apr | Badminton, Ultimate, & Rugby

Visit us online! Use your phone to scan the QR code left.

www.tswa.com.au

2013 AUSTRALIANUNIVERSITYGAMES

Gold Coast, QLD29 Sept - 4 Oct 2013

Since its inception in 1993, the Australian University Games (AUG) has grown to be Australia’s largest annual multi-sport event. Held each September/October, the Games are renowned for providing a friendly but competitive environment for Australian university athletes and is the flagship event on the national university sporting calendar.

The Games are recognised as a perfect opportunity for university athletes to compete against each other in a national multi-sport event. As such, the Games have built up a reputation as a not to be missed, event attracting over 5,000 participants each year.

Sports on offer at AUG 2013:Athletics, Australian Rules Football, Badminton, Baseball, Basketball, Beach volleyball, Cricket (Twenty20), Cycling, Fencing, Football (soccer), Futsal, Golf, Handball, Hockey, Judo, Kendo, Lawn Bowls, Netball, Rugby Union 7’s, Sailing, Softball, Squash, Swimming, Table Tennis, Taekwondo, Tennis, Tenpin Bowling, Touch, Ultimate (Frisbee), Volleyball, Water Polo

Get InvolvedUWA Sports has a proud history of sporting excellence at the Games, winning the Overall Champion Trophy at home in Perth 2010, then taking the Doug Ellis Trophy two years in a row for 2011 and 2012 at the Gold Coast and Adelaide Games respectively.As the premier event on the

sporting calendar, UWA students are encouraged to participate in other sport competitions throughout the year in order to qualify for AUG. Please see the contact details below to get in touch with joining our interfaculty, intercollege, and TSWA teams.

All teams must qualify through TSWA events if offered.

qualify through

TSWA!

CONTACT

Alicia Anderson

(08) 6488 [email protected]

16

qualify through

TSWA!

AUSTRALIAN UNIVERSITY CHAMPIONSHIPS2013

AUSTRALIAN UNIVERSITY CHAMPIONSHIPSAustralian University Sport has a number of exciting Championships on offer in 2013. These stand-alone events give students the opportunity to compete at a national level in one of eight great sports which are not offered at the Australian University Games. Competitions take place at different venues all over the country throughout the academic year.

SPORTS3 on 3 BasketballSnow SportsDistance RunningOrienteeringSurfingRowingTriathlonTwenty20 Cricket

CONTACTFor UWA students who would like to participate, please contact:

Alicia Anderson

(08) 6488 [email protected]

17

RECREATE®

COURSES

Through Recreate® short courses, UWA Sports offers specialised and in depth training and recreational opportunities. These courses are available to both UWA students, staff, & alumni, and the community. Recreate® Semester 1 Summer courses will begin on Monday 4 March and run for 7 weeks.

Apply first aid (full)Never completed a First Aid course before? Has your First Aid qualification expired?

Many workplaces and organisations value members with first aid credentials. This course provides you with access to pre-course study material and a 1 day face-to-face course with registered trainers which will qualify you with HLTFA311A - Apply First Aid.

DetailsFri 12 Apr8:30am - 4:30pmUWA Watersports & Leadership Centre1 day course

$110 $150student/assoc member Community

afl for beginnersLearn the basics of this iconic sport and find out why Australians are so keen on it!

Learn the skills of handballing, bouncing and kicking as well as the rules of the game. Participants will then be able put into practice what they have learnt with social competition during the classes.

This course is suitable for men and women who are new to the sport and all participants will really feel a part of the team with your very own training shirt. Some sessions end in typical Australian style with a BBQ provided.

Begins Wed 6 Mar

DetailsWed 5 - 6pmUWA James Oval7 weeks


weeks LONG7

includes

free training

shirt & bbq

NOW

APPLY First aid (requalify)Need to renew your First Aid Accreditation?

If you have a current First Aid Statement of Attainment (SOA) this 1-day course will requalify you for another three years. This course will qualify you with HLTFA311A-Apply First Aid.

Please provide a copy of your SOA at the time of booking to be eligible for this course.DetailsFri 12 Apr8:30am - 4:30pmUWA Watersports & Leadership Centre1 day course


Cardio TennisForget doubles, Cardio Tennis triples your fun.

Cardio Tennis is a fun, social, group tennis and fitness program for people of all ages and abilities. It’s more about getting a great, high-energy workout than pure tennis technique.

Burn calories, increase your fitness and improve your game at the same time in this fun, music-fuelled group workout. Run by Tennis Australia qualified coaches, Cardio Tennis caters to all ability levels.Begins Thu 7 Mar

DetailsThu 5:30 - 6:30pm orThu 6:30 - 7:30pmUWA Recreation & Fitness Centre7 weeks

Racquets provided, but participants can bring their own. $70 $95

student/assoc member Community

CPRNeed to learn Cardio-Pulmonary Resuscitation or renew your existing qualification?

This skill can be highly regarded by employers or even for safety at home or around the pool/ water. This 2 1/2 hour course will qualify/requalify you with HLTCPR211A-Perform CPR accreditation. You will have the confidence and ability to perform CPR if you are ever called upon for help.

DetailsFri 12 Apr8:30 - 11:00amUWA Watersports & Leadership Centre1/2 day course


Hatha YogaIyengar Style Yoga is for beginners and intermediates looking to relax, unwind and learn the basic principles of yoga.

Basic Hatha Yoga poses are taught in the Iyengar style with each class building on the previous week’s work. Importance is given to the physical alignment of the body while performing the poses and will progress onto actions using props including blocks, straps, blankets and bolsters.

This is a combined beginners/intermediate class for participants with limited or no previous yoga experience. This class won’t be challenging enough for experienced yoga practitioners.

Begins Tue 5 Mar

DetailsTue 5:30 - 7:00pmUWA Watersports & Leadership Centre7 weeks


Kickboxing for fitnessTime to try something a little different? Kick away the calories and get fit with Kickboxing.

If you are looking to keep fit whilst learning some simple self-defence techniques, kickboxing is the course for you.

This class incorporates the basic techniques of kickboxing with a focus on cardio fitness with classes building in intensity over the progression of the course. No prior knowledge or experience is required, just a ready to learn attitude.

Begins Wed 6 Mar

DetailsWed 7:00 - 8:00pmUWA Recreation & Fitness Centre7 weeks


flower arranging (basic) workshopThis course is an intensive 2 hour class for anyone who would like to learn the art of floral arranging.

Participants will learn how to create a bouquet, how to best show flowers in a vase and how to wrap individual roses. Participants will be able to take home the bouquets and roses they create. Also covered will be the basics of floristry such as, flower care and making your arrangements lastlonger, using flowers in difference ways, basic colour matching of different floral varieties, how to wire gerberas and wrapping bouquets and basic ribbons.

Please note: this workshop does not provide any qualification in the floral industry. It is for ‘at home’ floral enthusiasts.

DetailsWed 3 Apr1 - 3pmUWA Boat Shed1 day workshop

Included in the course price are the flowers and sundries needed to create the pieces, which participants can take home, as well as the option to purchase some extra supplies at the end. $70 $95


take home

your own

arrangements

Learn to paddle workshopKeen to get onto the water but not sure where to start?

The Lean to Paddle Workshop is for you! This one off 3 hour introduction to paddling a kayak takes place in a fun, social environment, for those with little or no experience. This course has an emphasis on learning basic paddling skills in a Kayak.

Skills covered:• Forwardspaddling• Backwardspaddlingandemergencystops• Turningthekayak• Launchingandlanding• Emergencyexitsandre-entries• Safetyonandoffthewater

DetailsSun 24 Mar8 - 11amUWA Watersports & Leadership Centre1 day workshop


Paddling Gold (over 50’s)This is a friendly get together for people over 50 who are interested in paddling.

Beginners are most welcome with no previous paddling experience required however it is necessary that participants are able to swim 50 metres.

All equipment is provided and classes begin with a warm up/flexibility session followed by lunch (bring your own). Then it’s out paddling on the river for about 2 hours, finishing with afternoon tea back at the Boat Shed.

The paddling activities vary depending on the skills of the participants but make sure you take a look outside your kayak and see Perth from a different perspective.

Begins Tue 5 Mar

DetailsTue 12:00 - 4:00pmUWA Boat Shed7 weeks


Paddling BeginnersThis course is an introduction to paddling a kayak in a fun, social environment for those with little or no experience.

This course has an emphasis on learning basic paddling skills and trying a variety of kayak styles. Participants learn practices such as forwards and backwards paddling and emergency stops, turning, launching and landing a kayak, emergency exits and re-entries and safety both on and off the water.

Participants need to be able to swim 50 metres and classes are suitable for those with little or no prior kayaking experience. Please bring clothes suitable to wear on the water and enclosed footwear. Expect to get wet!

Begins Thu 7 Mar

DetailsThu 5:30 - 6:30pmUWA Watersports & Leadership Centre7 weeks


flower arranging (basic) workshop

Pilates BeginnersThis class will introduce you to the fundamentals and principles of Pilates by focussing on the basics of alignment, breathing and technique.

All participants will be taught correct Pilates methods right from the start, learning form and execution of all exercises while receiving the benefits of improved flexibility, strength and overall tone.

The beginners course is perfect for those who are new to Pilates (exercise) or those looking to “brush up” on the basics. It is also suitable for individuals who are recovering from mild injuries and are looking for a safe way to workout.

*monday course will only run for 6 weeks due to the Easter monday public holiday.

Begins Mon 4 or Wed 6 Mar

DetailsMon 5:30 - 6:30pmorWed 6:30 - 7:30pmUWA Watersports & Leadership Centre6*/7 weeks

Please inform the instructor if you are injured or pre-/post-natal. $70 $100


Paddling INTERMEDIATESIf you already have paddling experience and are confident on the water the intermediate course is for you.

With a focus on exploring the Swan River, participants will need to be proficient in performing basic kayaking strokes, such as forward and backwards paddling and sweep strokes.

Participants will also need to be able to swim at least 50 metres and be able to perform a vessel emergency exit and re-entry. Please bring clothes suitable for wear on the water and enclosed footwear as you know you will get wet!

Begins Tue 5 Mar

DetailsTue 5:30 -6:30pmUWA Watersports & Leadership Centre7 weeks


Paddling advancedThis is a course catering to those who are already highly skilled at paddling and who are looking to extend their abilities, improve their fitness and learn advanced paddling theory.

Participants will need to:• Have already attended the Paddling Intermediates course (participants may be

exempt if discussed with instructor prior to course start)• Be comfortable with wearing a spraydeck and be able to demonstrate a wet exit

whilst wearing one• Be familiar with rescuing yourself and/or others in a capsize situation• Be able to swim at least 50 metres

Begins Wed 6 Mar

DetailsWed 5:30 -6:30pmUWA Watersports & Leadership Centre7 weeks

For safety reasons the instructor reserves the right to move participants to an intermediate/beginners group where the instructor seems it appropriate.


Pilates INtermediatesPilates Intermediates is a progression from the beginner course and offers a more challenging program for its participants.

The class focuses on strength, precision and flow of movement. Attendees will learn to be more aware of their breathing patterns and spinal alignment while engaging the deep muscles of the core.

Participants are expected to know the basic fundamentals of Pilates before joining this course.

*monday course will only run for 6 weeks due to the Easter monday public holiday.

Begins Mon 4 or Wed 6 Mar

DetailsMon 6:30 - 7:30pmorWed 5:30 - 6:30pmUWA Watersports & Leadership Centre6*/7 weeks

Please inform the instructor if you are injured or pre-/post-natal. $70 $100


Pilates morningsStart your mornings the right way with a dash of invigorating Pilates.

This course covers all the fundamentals of Pilates, correct breathing technique, beneficial exercises for postural improvement and core strengthening, dynamic stretching and creating the groundwork for improving your flexibility.

Classes are designed for beginners through to intermediates and will introduce progressions and challenges as the course develops.Begins Tue 5 Mar

DetailsTue 7:00 - 8:00amUWA Watersports & Leadership Centre7 weeks

Please inform the instructor if you are injured or pre-/post-natal.


Paddling INTERMEDIATES

Paddling advanced

Recreational Skippers TicketEvery skipper of a registrable, recreational vessel, powered by a motor greater than 4.5kwp (6 hp) is required to hold a Recreational Skippers Ticket.

Pending numbers, UWA Sports will be facilitating a group qualification session. Please register your interest; dates will be set once interested participants are confirmed.

Please contact Callum Warner at [email protected] to register your interest.

DetailsDate to be confirmed.

UWA Boat Shed


Sailing BeginnersGrab your mates and set sail on the stunning water of the Swan River.

Take to the water and learn the basics of yachting with theoretical and practical instruction by trained coaches. By the end of the course you will know the most important aspects of a boat, basic direction/on water navigation, tacking and jibing of the vessel and vessel/water safety.

All equipment is provided however please bring clothes suitable for wear on the water and enclosed footwear. Participants must be able to swim 50 metres.

Begins Sat 9 Mar

DetailsSat 8:30 - 10:30amUWA Boat Shed6 weeks


Shape UpStart achieving your health and fitness goals today with Shape Up, a boot camp-style exercise program!

The course will include a myriad of training methods from outdoor bootcamp-style bodyweight exercises to indoor activities, cardiovascular interval training and resistance training circuits.

Encompassing free weights, machine weights and bodyweight exercises, this course is designed to challenge the entire body and build fitness. Core strength training and ample stretching also form part of the training. All fitness levels are welcome.

Begins Tue 5 Mar

DetailsTue 7:15 - 8:15pmUWA Recreation & Fitness Centre7 weeks


WindsurfingGear up for some fun on the water!

This course is designed to teach you the basics to becoming a windsurfer. Participants will learn the parts of the board, rigging, orientation and basic handling skills.

All equipment is provided. Please bring clothes suitable for wear on the water.

Participants must be able to swim 50 metres.Begins Sat 9 Mar

DetailsSat 8:30 - 10:30amUWA Boat Shed6 weeks


UWA OutdoorLeadership & DevelopmentWeekIn 2013 UWA will be offering first year students the opportunity to engage in a week long leadership and development course prior to the start of semester in different outdoor activities.

Students will engage with qualified instructors for intensive training sessions, focused on increasing their skill sets in a variety of activities, and in creating pathways to further develop the students as outdoor leaders.

Activities included: mountain biking, paddling, vertical challenges (abseiling and rock climbing), trekking, and sailing.

Following the course, students are encouraged to participate with UWA Recreate® courses and other programs throughout the year as leaders and assistants.

CONTACTFor UWA students who would like to participate, please contact:

Callum Warner

(08) 6488 2306

[email protected]

where will your

ADVENTURESlead?

25

Premium Membership for only $20 per week.

UWA Staff& Alumni Fitness

Start living the healthy, active life at UWA and get into UWA Staff & Alumni Fitness. The Watersports & Leadership Centre gym is available exclusively to UWA Staff Fitness & Alumni Premium members, offering stunning views over Matilda Bay, state-of-the-art equipment, personal training, and a private workout atmosphere. Take advantage of the salary packaging benefit option for increased discounts.

UWA Staff & Alumni Premium Members enjoy a wide range of benefits: Unlimited access to the UWA Recreation & Fitness Centre gym facilities and group fitness classes, premium small-group classes running at the UWA Watersports & Leadership Centre, free court hire (1 hour/day) as well as 20 half-hour personal training sessions annually.

You can also opt for a regular fitness membership by purchasing a 12 Month Membership to the UWA Recreation & Fitness Centre.

Get more out of your Premium Fitness Membership.

Small-group premium classes run at the UWA Watersports & Leadership Centre and are open to all UWA staff & alumni. Pricing levels are tailored towards current Premium Fitness Members, regular Fitness Members, and general UWA staff & alumni who are not currently fitness members of UWA Sports.

Premium Classes

26

COME & TRY - PADDLINGBranch out and expand your fitness potential with Come & Try Paddling; the easiest way to get started with kayaking.

Enjoy the Swan River sunset from a very unique position; a kayak! Escape the hustle and bustle of University and enjoy the aquatic environment right on our doorstep. You may even see dolphins!

This come and try session features basic kayaking instruction. All gear supplied. Registration required, numbers limited.

DetailsFri 19 Apr4:15 - 5:45pmUWA Watersports & Leadership Centre1 session

COME & TRY - SAILINGTake to the water with elegance and style, and learn the art of sailing with this laid back come & try opportunity.

What a way to end your working week! Get your work mates together and join us at the UWA Watersports & Leadership Centre adjacent to Matilda Bay foreshore on the Swan River for a spot of sailing.

Run by Sunsmart Sailing Centre, this come and try session will introduce you to the basics of dinghy sailing. Equipment supplied. Registration required, numbers limited.

DetailsFri 12 Apr4:15 - 5:45pmUWA Watersports & Leadership Centre1 session

$45 $60$40

$12 $16freeREGULAR FITNESS MEMBER other staff & alumniPREMIUM FITNESS member

REGULAR FITNESS MEMBER other staff & alumniPREMIUM FITNESS member

Fitness

BEGINNER FITNESSEmbark on your own personal fitness journey!

Designed for UWA staff and alumni, sessions involve small group activities in our private Premium Fitness Gym at the UWA Watersports and Leadership Centre featuring a stunning view of the Swan River.

Participants receive an orientation to electronic fitness equipment and will be introduced to a variety of fitness activities and briefed on correct exercise technique.

Everyone is encouraged to work at their own pace - no pressure!

Begins Tue 5 Mar

DetailsTue 6:30 - 7:30pmUWA Watersports & Leadership Centre7 Weeks

$70 $100FREEREGULAR FITNESS MEMBER other staff & alumniPREMIUM FITNESS member

uwa staff & alumni

only

uwa staff & alumni

only

uwa staff & alumni

only

Mixed indoor volleyballServe up a healthy dose of fun this semester!

If you enjoyed participating in the Staff Sports Fun Day here’s your chance to enter your staff team in a fun, friendly, non-contact UWA staff sport competition. Get your work mates together to compete against other departments and faculties in our 10 week indoor volleyball competition at the UWA Sport & Recreation Centre.

Flexible game times and increased team sizes allow for you to ensure you will have a team on the court each week.

There is a $45 upfront nomination fee, then an additional $45 per week ($7.50 per player for a team of 6).

DetailsSun 6 Jan10:00am - 3:00pmUWA School of Sport Science1 session

Nominations open from 4 - 15 Mar

League starts Thu 21 Mar

Details Thu 12noon - 12:45pmUWA Recreation & Fitness Centre10 weeks

$45staff & alumni

Stretch & ToneGet your body toned, slim, limber, and beautiful.

The 45 minute Stretch & Tone class will take you through a combintation of toning and core strength exercises incorporating resistance tubing and abdominal work.

The class finishes off with with Vinyasa flow moves aimed at improving flexibility, so you get toned and stretched in the same session!

Begins Wed 6 Mar

DetailsWed 7:30 - 8:15amUWA Watersports & Leadership Centre7 weeks

FREEREGULAR FITNESS MEMBER other staff & alumniPREMIUM FITNESS member

/week

FLEX & FLOWReady to get bendy? Stretch your body and soothe your mind with Flex & Flow.

UWA Sports’ 45 minute Flex & Flow class aims to develop balance and flexibility through yoga and pilates based exercises, incorporating breathing and relaxation techniques.

Enjoy a soothing break to your work day, enhance your concentration, and relieve stress in a low intensity environment. No sweat!Begins Tue 5 Mar

DetailsTue 12:30 - 1:15pmUWA Watersports & Leadership Centre7 weeks

$70 $100FREEREGULAR FITNESS MEMBER other staff & alumniPREMIUM FITNESS member

uwa staff & alumni

only

uwa staff & alumni

only

uwa staff & alumni

only

$70 $100

YogaJoin other UWA staff & alumni for our “UWA staff-and-alumni-only” morning yoga class at our riverside Watersports & Leadership Centre, offering stunning views across Matilday Bay.

Based on the principles of Iyengar yoga, this class focuses on posture and alignment incorporating methods of technique, timing, sequencing, and repetition that will leave you feeling stretched, relaxed, and ready to meet your working day.

Mats, blankets, and props supplied and shower/changing facilities are available.

Begins Thu 7 Mar

DetailsThu 7:00 - 8:00amUWA Watersports & Leadership Centre7 weeks

FREEREGULAR FITNESS MEMBER other staff & alumniPREMIUM FITNESS member

Total ConditioningGive your body all the work it needs, and then some!

Total Conditioning is a 45 minute class aimed at improving overall fitness by burning caloires, reducing fat, and strengthening and toning muscle. Workouts utilise electronic cardio equipment, light free weights, and dynamic resistance exercises.

Begins Mon 4 Mar

DetailsMon 7:00 - 7:45am / 5:30 - 6:15pmTue 7:00 - 7:45am / 5:30 - 6:15pmWed 7:00 - 7:45am / 5:30 - 6:15pmThu 7:00 - 7:45am / 5:30 - 6:15pmUWA Watersports & Leadership Centre7 weeks

Twilight SailFor the best view of the Swan River sunset, you can’t beat Twilight Sailing.

Get your friends together and join us at the Royal Perth Yacht Club for a delightful twilight sail down the Swan River on board the ‘UWA Centennial’ Foundation 36 Yacht. Sit back and enjoy the sail or try your hand at ‘trimming the sails’.

No experience necessary, skipper provided. BBQ facilities available at the Club following the sail*. Early registration recommended, numbers limited.

*at own cost at Royal Perth Yacht Club.

DetailsThu 21 Mar5:30 - 8:00pmRoyal Perth Yacht Club1 session

FREE

$45 $60REGULAR FITNESS MEMBER other staff & alumni

$40PREMIUM FITNESS member

REGULAR FITNESS MEMBER other staff & alumniPREMIUM FITNESS member

uwa staff & alumni

only

uwa staff & alumni

only

uwa staff & alumni

only

$70 $100

$70 $100

UWA Sports Club & TEAM ContactsReady to play? Represent UWA by joining a sports club or team, and create your own university experience.

UWA sports clubs and teams are open to all UWA students, staff, alumni, and community members.

Choose from over 30 different sports on offer, get involved, and start living the experience with UWA Sports.

UWA Athletics ClubThe UWA Athletics is one of Western Australia’s oldest athletics clubs and has been growing in popularity amongst UWA students over the past few years.

The main event for the club is the Australian University Games where the success of the team has been growing in leaps and bounds placing 4th overall in 2012 with victories on the track and in the field. The athletics program has grown to include community members and an expanding Little Athletics program.

Training: Mon and Wed evenings at UWA Sport and Research Parkwww.uwaac.com | [email protected]

UWA Aikido ClubAikido is a modern, non-violent Japanese martial art, training the student to take control of the opponent not through physical strength but through efficiency of movement.

Aikido uses physical training and practice to perfect techniques that respond to the movements and momentum of an attacker and is more defensive rather than offensive. Training is conducted at the UWA International Martial Arts Centre by Sensei Brett Nener.

Training: Mon and Wed 6:30pm, Sat 10:30amwww.aikido.uwamartialartsclub.org | [email protected]

UWA Baseball & Softball ClubUWA’s Baseball and Softball Club (also known as the UWA Whips) have men’s and women’s teams in both the Baseball and Softball competitions. The club caters for all levels of experience and com-petitiveness, from social comps to the more serious WA Baseball and Softball Leagues. With the growing number of participants an extensive off field or social calendar has been developed so everyone can get into the team spirit.

Training: Tue and Thu evenings at UWA Sport and Research Parkwww.uwabaseball.com.au | [email protected]

UWA Badminton ClubThe Badminton Club at UWA has grown in strength, participation and achievement over the past few years.

In 2011 the Badminton team took home the silver medal at the Aus-tralian University Games and the Men’s team won the Gold and the Women’s team the Silver medal in the Tertiary Sports WA competition.

Training: Wed 7:30-10:30pm at UWA Recreation and Fitness [email protected] | [email protected]

30

UWA Fencing ClubTake up the art of fencing and learn not only how to outwit an op-ponent but you will also gain fitness, speed, flexibility, coordination and friends for life.

No need to worry about the equipment as the UWA Fencing Club is able to provide the basics so you can start learning the fundamentals.

Training: Wed 7:30-9:30pm at UWA International Martial Arts Centrewww.uwafencing.org | [email protected]

UWA Boat ClubUWA Rowing is open to all students and the general public no matter what your skill level might be. There are three distinct levels within the club, Novice, Open and Masters (over 27 years old). Each level has men’s and women’s crews and plenty of coaching.

The rowing season runs from February right through until the State Championships in early October. The club also hosts learn to row courses and social rowing programs.

www.uwarowing.org.au | [email protected]

UWA Cricket ClubWith the popularity of cricket growing in Australia through the T20 Big Bash and success of the Australian One Day and Test sides now is the time to join UWA’s Cricket Club. All levels of experience are catered for, so whether you want to be the next Shane Warne or just want to have a social time on and off the field, there is a team for you.

Training: Tue and Thu evenings at James Oval, UWA Crawley Campuswww.ucc.org.au | [email protected]

UWA Football Club (AFL)Get involved in one of Australia’s most popular sports, Football (AFL). UWA Football Club wants you to play in the Western Australian Ama-teur Football League, to train hard, play fair and enjoy the numerous social activities planned throughout 2013.

This club is largely made up of UWA students, so you will be with likeminded sports fans with the pre-season off field activities always a highlight. Check the website for training schedules.

Training: Tue and Thu from 6pm at UWA Sport and Research Parkwww.unifootyclub.com | [email protected]

UWA GolfGolf might be a considered a social game, but the UWA Golf team enjoys winning. However, if it is the social side of the game that interests you, they have that covered too.

UWA Golf competes in the Tertiary Sports WA competition and also the Australian University Games.

[email protected]

UWA Handball ClubUWA Handball Club won the 2012 TWSA Handball Championship. Beach Handball has recently been added to the list of competitions the club competes in during the summer season, so why not give this sport a try or check out the social scene on the club’s Facebook page.

Training: Wed 6:00-7:30pm at UWA Recreation and Fitness Centre

www.facebook.com/uwahandball | [email protected]

31

UWA Karate ClubKarate is one of the traditional forms of Japanese martial arts and is a form of hand to hand combat using punching, kicking, knee strikes, elbow strikes and open hand techniques.

The training at UWA Karate Club focuses heavily on the basics and involves practicing katas, kumite and various sets of fitness training. Beginners are offered a 2 week trial.

Training: Mon and Wed 7pm at UWA Recreation and Fitness Centrewww.karate-uwa.com.au | [email protected]

UWA Hockey ClubThe UWA Hockey Club is one of the most successful and progressive hockey clubs in Australia with continuous contributions to the State and National teams and club teams at all levels reaching finals.

There is a team to suit every level and the social calendar is “stuff of legend”.

Training: Tue and Thu 6pm at UWA Sport and Research Parkwww.uwahockey.org.au | [email protected]

UWA Judo ClubThe Olympic sport of Judo was developed from a combination of martial arts however modified techniques to be safer on opponents and not inflict pain or injury. The aim of Judo is to throw your opponent to the ground and control them there using both physical prowess and mental discipline.

This UWA Judo Club runs many international programs from training tour to Japan as well as international tournaments.

Training: Sat 3:30-5:30pm at UWA International Martial Arts Centrewww.judouwa.com.au | [email protected]

UWA Kobudo ClubKobudo is the study of ancient Japanese weapons, many of which were originally farming tools however also involves hand to hand styles similar to Karate.

This sport is not for the faint hearted and requires a certain level of discipline. UWA’s Kobudo Club is interested in new members and increasing current member numbers with senior level belts.

Training: Wed 5:30pm and Sat 2pm at UWA Recreation and Fitness Centrewww.kobudo.uwamartialartsclub.org | [email protected]

UWA Lawn BowlsThe UWA Lawn Bowls is known for knocking off highly skilled professional teams from other universities. Whether you are a first time/barefoot bowler or are on your way to becoming the next Lawn Bowls champion of Australia, you will find fun and a social group in the team.

Training: Fri evenings at Dalkeith/Nedlands Bowling [email protected]

UWA Netball ClubUWA Netball Club is an all-female sports club consisting predomi-nantly of UWA students.

The club participates in the Perth Netball Association competition and has been building on previous successes. All levels of experience are welcome to join.

Training: Wed evening at UWA Recreation and Fitness Centre courtsuwanetballclub.myclub.org.au | [email protected]

32

UWA SailingThe UWA Sailing Team knows how to take advantage of some of Perth’s best attributes; wind, waterways and sun.

Since the inclusion of sailing in the Australian Uni Games the UWA Team has grown in strength and success and even boasts several international medal holders and exchange opportunities.

[email protected]

UWA Outdoor ClubWhy not try and get outdoors and see the real Western Australia. The Outdoor Club provides opportunities such as adventure racing, climb-ing, cycling, hiking, paddling and windsurfing.

All this outside fun culminates in the thermal ball, the event that no one should miss. Not to worry if you don’t like fresh air or have never been fond of water, all experience levels can be provided for.

www.outdoorclub.com.au | [email protected]

UWA Rugby ClubUWA’s Rugby Club has proven to be a formidable opponent on the rugby field after winning the Club Championship in 2012. With 9 men’s teams ranging from Premier and Reserve Grade, Colts (U18’s) and through to 4th Grade (seriously social) there is a team that will suit you.

Training: Tue and Thu from 6pm at UWA Sport and Research Parkwww.uwarugby.com.au | [email protected]

UWA Savate ClubSavate is a multi-discipline and improvisation approach to personal combat involving blending traditional boxing styles of hitting and grap-pling with kicking/feet elements.

Shoes are often worn in matches, a tradition which dates back to its French street fighting origins. The Savate Club at UWA encourages students to join and learn self-defence techniques or for the competi-tive aspect of the sport.

Training: Thu 7pm at UWA Recreation and Fitness Centrewww.bridgemansavate.com | [email protected]

UWA Nedlands Football Club (Soccer)In the newly amalgamated UWA-Nedlands Football Club all levels of experience, skills and competitiveness are catered for.

Student and social teams specifically for both male and female UWA students, compete in local Sunday competition as well as the TSWA competition and the Australian University Games.

Training: Tue and Thu 6pm (competitive), Wed (social) at UWA Sport and Research Park www.uwanfc.com.au | [email protected]

UWA SwimmingThe UWA Swimming is predominantly a community group with a large junior base that caters for experienced and high achieving UWA student swimmers.

However the social side of swimming, such as Open Water swim ses-sions/competitions and club nights should entice some of you to join the team and compete for your uni at the AUG and other University competitions.

Training: Tue and Thu 7:30-8:30amwww.uwauniswim.asn.au | [email protected]

33

34

UWA Ten Pin BowlingThe UWA Ten Pin Bowling mixes the competitiveness aspect of competition with the social and fun side of this team sport and accommodates the serious players through to those who just want to have fun and meet new people.

[email protected]

UWA Table Tennis ClubThe UWA Table Tennis Club is happy to welcome anyone with any level of ability or skill. All equipment is provided.

Training: Thu and Sat from 4pm at UWA Recreation and Fitness [email protected]

UWA Taekwon-Do ClubThe martial art of Taekwon-Do was developed as a form of self-de-fence and will not only improve your fitness but will also give you skills and techniques for better self-discipline and self-defence.

The club has training and courses for all skill levels including begin-ners as well as State and International Championships and Australian University competitions.

Training: Wed 5:30pm and Sat 4:30pm at UWA International Martial Arts Centrewww.tkd.sport.uwa.edu.au | [email protected]

UWA Tennis ClubWith some of the best tennis facilities in Perth, and as one of the longest running affiliated clubs, UWA Tennis is growing through social and competitive membership both in the student and community population.

With 14 clay courts, 6 grass courts and modern club rooms, every level of competitor from State League and Division 1 teams through to social members are welcome.

Training: Mon and Wed 6:30pm, Sat 10:30am at UWA Sport and Research Parkwww.uwatennis.com.au | [email protected]

UWA TouchUWA Touch is a fun and competitive environment, hosting teams (mens, womens and mixed) that compete in the Evening Social Sports competition. Teams cater for all ability and experience levels.

Training: Tue 6-10pm at James Oval, UWA Crawley [email protected]

UWA Triathlon ClubThe UWA Triathlon Club is open to all students, staff and members of the community with a focus on participation over competition. Through its close ties with the School of Sport Science, Exercise and Health the club is able to offer superior training, coaching and facilities.

Training: Training times and venue can varywww.uwatriathlonclub.com | [email protected]

35

UWA Volleyball ClubUWA Volleyball Club is the largest university based volleyball club in WA and compete in the Perth Volleyball League, Tertiary Sport WA competition and also the annual Australian University Games.

Competition is both indoor and beach volleyball for men, women and mixed teams.

Training: Tue and Thu from 6pm at UWA Recreation and Fitness Centrewww.uwavc.com.au | [email protected]

UWA Ultimate ClubUltimate (Frisbee®) is a fun, fast-paced team sport played with a flying disc. It combines elements of netball, touch football, and grid-iron into a non-contact, self-umpired sport that requires minimal equipment and can be enjoyed by all levels of skill.

Competition can be fierce with Uni pride up for grabs at the Austral-ian University Games. The social calendar is pretty important to the camaraderie of this sport too.

Training: Mon 4-6pm at James Oval, UWA Crawley Campushttp://uwa.waultimate.com | [email protected]

UWA Underwater ClubThe Underwater Club of UWA originated to allow students, staff and community members to combine resources and participate in dives and underwater exploration.

For those who are not a qualified diver there are plenty of beginner courses and programs to get you diving in no time. Experienced and qualified divers have opportunities to go on dive trips to Rottnest Island and various shipwrecks along the WA coastline.

Training: Training times can vary at UWA Sport and Research Park

www.uwauc.org.au | [email protected]

UWA Waterpolo (UWA Torpedoes)The Torpedoes are the elite teams covering men’s, women’s and junior teams. The UWA Water Polo has a highly competitive presence nationwide in the National Water Polo league.

Training: Mon 7:15am at UWA Aquatic & Rehabilitation Centre

www.uwatorpedoeswpc.com.au | [email protected]

The 2012 UWA Australian Uni Games Team

The UWA Recreation and Fitness Centre is the fitness and social hub on campus. Memberships and casual rates are available to students, staff, alumni and community individuals. The centre provides UWA and its neighbouring community with high quality, affordable services and facilities.

The Centre is home to• A state-of-the-art fitness centre including• Over 60 cardio machines• Over 62 resistance weight machines• Range of cable stations including 2 Technogym®

Kinesis machines• Interactive rowing zone• Cycle room• Circuit room• High performance room including Life Fitness® plate

loaded equipment• More than 60 group fitness and training classes per

week• Recreate® courses• Outdoor Tennis and Netball courts• Indoor courts for Basketball, Volleyball, Badminton,

Squash, Futsal (indoor soccer) and Table Tennis

MembershipsFor membership information please refer to page 7 in this magazine.

Court HireAll courts are available to hire, with UWA Recreation and Fitness Centre members allowed 1 hour free court hire per day. For bookings and pricing please call reception or visit us online.

Want more from your University? Get up to date with UWA Sports facilities, and catch up on sport, fitness, and recreational activites all year long.

UWA RECREATION & FITNESS CENTRE

University of Western AustraliaCarpark 1, CrawleyPhone (08) 6488 2286Fax (08) 6488 4725Email [email protected]

Opening Hours (as of 25th February 2013)CourtsMonday-Friday 6:00am-11:00pmSaturday-Sunday 6:00am-9:00pm

Fitness CentreMonday-Sunday 6:00am-9:00pm

36

The Watersports and Leadership Centre is situated on the banks of the famous Swan River and boasts sweeping views of the city skyline, Matilda Bay and is only a stone’s throw from Perth’s iconic Kings Park.

The Centre is home to• UWA Leadership & Development Program

(www.sport.uwa.edu.au/leadership)• Recreate® courses• Staff & Alumni Premium gym including Premium

fitness classes• Function facilities• Sunsmart State Sailing Centre

Facility HireThe centre has three function rooms available for hire to UWA Sport and Recreation members only and preference will be given to UWA students, departments and faculty.

For function hire and booking information please contact reception on 6488 3077 or visit us online.

University of Western AustraliaCarpark 23, CrawleyPhone (08) 6488 3077Fax (08) 6488 4725Emai: [email protected]

UWA WATERSPORTS & LEADERSHIP CENTRE

37

UWA Sport and Research Park boasts 33 hectares of sporting facilities and playing fields, only a few minutes drive from the UWA Crawley Campus and the CBD. The grounds are adjacent to Challenge Stadium and the WA Institute of Sport and is fast becoming the premier sporting complex in Perth.

The Park is home to • UWA Tennis Centre offering adult and junior social

tennis, pennant competitions, coaching and social events

• Sporting ground hire for Tennis, Rugby, Hockey, AFL, Soccer, Baseball and Cricket

• Various UWA sports clubs• UWA Superturf Hockey Complex

UWA Sports & Research Park is available for hire, please contact us on [email protected] for details.

UWA SPORT & Research PARK

McGillivray RoadMt ClaremontPhone (08) 6488 7063Fax (08) 6488 1043Email [email protected]

UWA’s International Martial Arts Centre was the location of the 2007 and 2009 Indian Rim Asian University Games Judo competition and also played host to the State Judo Championships in 2008 and the 2010 Australian University Games. The centre is found on the UWA Claremont Campus on the corner of Goldsworthy and Princess roads in Claremont.

The Centre is home to• MartialArtsDojo• Indoorsportshallforvolleyballandbadminton• Performingartsstage• Grassoval

Cnr Princess and Goldsworth RdsMt ClaremontPhone: (08) 6488 7063Fax: (08) 6488 1043Email: [email protected]

UWA International Martial arts centre

38

The UWA Aquatic and Rehabilitation Centre is located in the School of Sport Science, Exercise and Health and can be found on the most southern tip of the Crawley Campus. The Centre features 3 swimming pools, with the most recent addition being the purpose built water polo pool.

Uniswim is the swimming program held at the UWA Aquatic and Rehabilitation Centre, where junior and adult learn to swim classes and squad training sessions are held for UWA students, staff, alumni and community members. The lap pool is also available for individual/private lap swimming at certain times. Aqua Aerobics classes are also held once a week.

University of Western AustraliaParkway (entrance number 3)School of Sport Science and Health, CrawleyPhone: (08) 6488 2277Fax: (08) 6488 1039Email: [email protected]

UWA aquatic & rehabilitation CENTREPublic Swimming SessionsMorning sessionsMonday, Wednesday and Friday at 6:00-7:45am

Afternoon sessionsMonday, Tuesday, Thursday and Friday at 11:30-2:00pm Wednesday, Saturday and Sunday at 12:00-2:00pm

Evening sessions (Summer Season)Monday, Tuesday, Wednesday, Thursday at 6:00-7:30 pm Available from 1 Nov to 1 May ONLY

Cost$4.00 per session $35.00 public swim card for 10 sessions $400 (Calendar Year Season Pass) or $200 (Pensioners)

A Triathlon program is also available for junior and opens triathlon training in conjunction with Challenge Stadium and UWA’s Sport and Research Park.

The Aquatic Centre is home to the UWA Torpedoes the elite junior, men and women’s Water Polo teams. These world class facilities allow top level water polo matches to be held on site.

Please visit www.uniswim.uwa.edu.au for more information on any of the training options or public swimming.

pool access

only $3extra

*/week

*when combined with a UWA Sports 12 Month Fitness Membership.39

photo by beau lefort photography

Achieving Sporting ExcellenceIn 2013, UWA celebrates its Centenary of excellence in teaching, learning, research, and sports. UWA Sports is proud to look back on a legacy of sporting highlights.

1913 - 2013 | celebrating 100 years of excellence

2013 semester 1 summer recreate

Documents