solid waste & recycling dec/jan 2009

Solid Waste& RecyclingSolid Waste& RecyclingCanada’s magazine on collection, hauling, processing and disposalDecember/January 2009 $10.00

CP

MP

No.

400

6924

0

A

n Ec

oLog

Gro

up P

ublic

atio

n

Our Annual Buyers Guide — pages 25-40

The Collapsed

Commodity Markets

— page 50

Ontario Discussion Paper Seeks Product Stewardship for Most Materials — Page 8

The End of Garbage?

swr dec-jan 09 cover pg 1.indd 1 01/11/10 3:04 PM

http://issuu.com/action/page?page=50



October 28 - 29, 2009 Vancouver Convention & Exhibition CentreToronto, ON Canada

Canada’s ONLY tradeshow serving the waste, recycling and public works markets

www.cwre.ca

For more detailsArnie Gess, Show ManagerCall: 403.638.4410 Toll-free 877.534.7285Email: [email protected]

Fresh Ideas. InnOvatIve sOlutIOns.

Reserve Your Exhibit Space Today!

swr dec-jan 09 pg 2 AD.indd 2 01/11/10 3:04 PM

mailto:[email protected]


http://www.cwre.ca

December/January 2009 www.solidwastemag.com 3

C O N T E N T S

Solid Waste & RecyclingCanada’s magazine on collection, hauling, processing & disposal

December/January 2009Volume 13, Number 6

Biomass, pg 48 Markets & Materials, pg. 50Show Report, pg. 46

COVER STORY

The End of Garbage? 8Ontario Environment Minister Gerretsen’s discussion paper “Toward a Zero Waste Future” has led to public consultations about introducing Extended Producer Responsibility for most materials in the waste stream. We explore the implications.by Guy Crittenden

DEPARTMENTSEditorial 4

Up Front 6

Producer Responsibility 19

Composting Matters 24

Show Report 46

Waste Business 53

IC&I Waste 54

Regulation Roundup 56

News 58

Ad Index 61

Blog 62

NEXT EDITIONSUPPLEMENTS: Hauling/Transportation & Materials Handling EquipmentComposting court case. Pelletization. User-pay systems. Construction and demolition waste. Shredder technology.Space closing: January 22; Artwork required: January 29Advertisers, contact Publisher Brad O’Brien at 1-888-702-1111 ext. 2.

Cov

er a

rt b

y C

harle

s Ja

ffé

FEATURES

PRODUCT STEWARDSHIP: DEPOSITSAlberta raises deposits and adds milk containers.by Clarissa Morawski 21

DIVERSION: PHARMACEUTICAL WASTECanada needs a less chaotic pharma waste system..by John Newell 42

WASTE-TO-ENERGY: BIOMASSCellulosic ethanol as a renewable fuel.by Gordon Quaiattini 48

RECYCLING: MARKETS & MATERIALSCollapsed commodity prices and problem materials.by Phil Zigby 50

Our Annual

BUYERS’ GUIDEWaste and recycling products and services

pages 25-40

swr dec-jan 09 cont pg 3.indd 3 01/11/10 3:06 PM

http://www.solidwastemag.com





















“The polystyrene and film plastic that Toronto has added

to its recycling program are the most expensive materials

in the blue box.

by Guy CrittendenE D I T O R I A L

Simple Problems, Complex Solutions

4 www.solidwastemag.com December/January 2009

The busiest industry rep in Canada during November had to be Cathy Cirko, VP of the Environment and Plastics Industry Council (EPIC), whose members found themselves in the crosshairs of a

City of Toronto staff report released November 4, 2008 that called upon retailers to reduce in-store packaging. The report recommended that the city use newly-acquired legal powers to force retailers to reduce single-use hot drink cups, plastic shopping bags and plastic food packaging. It also proposed banning the sale of bottled water at city civic centers by the end of 2011.

It wasn’t a good day for plastics.Release of the report triggered a flurry of meetings, phone calls and

news releases at the end of which some of the plastics industry’s object-ives were realized. The outcomes offer insights for any jurisdiction that plans to tackle these materials; the issues are more complex than they might at first appear.

Toronto staff propose that retail-ers be made to offer discounts be-tween 10 and 20 cents for purchases made with refillable packaging, such as a travel mug. The obvious target here is coffee shops. (Tim Hortons already offers such a discount.) The report also recommends banning cups that aren’t compatible with the city’s recycling program, which is not equipped to separate paper cups from plastic lids. (See article, pages 50-52.)

By December 31, 2010, food ser-vice retailers in Toronto must develop a reusable or refillable takeout food container, or takeout food service protocol, the report recommends, with fines ranging between $100 and $400. The plastics and restaurant indus-tries quickly pointed out the serious health issue that trumps environ-mental concerns. In the end, restaurants and the in-store food service counters of supermarkets (e.g., where you buy your BBQ chicken) were given a couple of years’ reprieve to come up with a solution.

Industry succeeded in getting Toronto to agree to add polystyrene (foam) packaging and film plastic (shopping bags) to its curbside recyc-ling program (effective December 8, 2008). Cirko says there are “strong markets” for these materials. However, this may not be an inexpensive decision. A Stewardship Ontario spreadsheet of activity-based costing data shows the full net costs of collecting and processing blue box ma-terials. Province-wide, 59,213 of film plastic is generated, of which only 417 tonnes (1.6 per cent) is collected and recycled at an average net cost of $1,691/tonne. About 21,971 tonnes of polystyrene is generated, of

which only 4,222 tonnes (4.3 per cent) is recycled for $2,090/tonne. Perhaps with its economies of scale Toronto can reduce these costs, but they’re still sobering. Return-to-retail would yield a better quality ma-terial and, some might argue, keep costs where they belong in the private sector.

The outcome regarding plastic shopping bags was interesting. In-stead of adopting staff’s rather cumbersome recommendation that shop-pers who bring their own reusable bags be given a small refund, Mayor David Miller negotiated a side-deal with the grocers via which they agreed to charge five cents for each plastic bag requested. In a surprising amendment passed by council, retailers will be required to provide al-ternatives for free to customers, interpreted as including reusable bags, cardboard boxes, carry-out totes, and paper bags. (Some grocers already

do this.)The positive side is obvious:

people are being given a price signal to choose reusable bags or bins to lug their groceries and other merchan-dise home. Reuse is higher up the waste management hierarchy, so this is (so far) good. By not banning plas-tic bags, people still have the option to choose plastic bags if they want, but the “polluter pays.”

But Cathy Cirko points out that in Toronto (as elsewhere) 69 per cent of the carry-out bags are reused as either a kitchen catcher or a liner bag for organics containers. So, if people choose reuseable bags they may have to buy bags for garbage or organics

bins, at a cost of around 14 cents a bag.

This is one of several arguments that EPIC offers in favour of plastic shopping bags that you can read for yourself at www.myplasticbags.ca Some are valid, but I think the five cent charge is a reasonable middle-ground. Fewer plastic bags overall will reduce the not-inconsiderable costs of recycling them. Many people will likely adopt a logical compromise strategy: they’ll bring reusable bags for most of their groceries, and pay five cents for enough bags to meet their kitchen-catcher needs and thereby avoid paying the higher cost of purpose-made garbage bags.

We hope Toronto monitors the results and costs of its new blue box additions and allows for future adjustments as needed. Once you’ve added them to a program, it’s hard to take them out.

Guy Crittenden is editor of this magazine. Contact Guy at [email protected]@ARTICLECATEGORY:793; 2243;

At the November meeting of Zero Waste Simcoe, results were reported of the group’s successful local campaign that encourages shoppers to

remember their reusable bags.

swr dec-jan 09 edit pg 4.indd 4 01/11/10 3:07 PM


http://www.myplasticbags.ca


Continental Biomass Industries, Inc.

•

22 Whittier Street, Newton, NH 03858

•

© 2008. All rights reserved.

Fuel the Future™

WITH BIOMASS & REFUSE-DERIVED FUEL (RDF)

In the past 20 years, Continental Biomass Industries, Inc. (CBI) has designed and installed hundreds of purpose-built stationary machines and systems for customers all over the World. From outdoor plants for mulch and fuel production to entire processing systems turning C&D and MSW into recyclables and RDF. This includes simple stand-alone Grizzly Mills® as well as, horizontal grinders and complete multi-dimensional systems — featuring combinations of slow speed primary shredders, screeners, conveyors, picking stations, magnetic separators, water tanks, and secondary and tertiary grinders to assure specific product size. Our superior equipment, engineering and experience ensure your success. We Guarantee It.

For more information visit us online www.cbi-inc.com or call us at 603.382.0556.

New England Recycling Co., Inc., Taunton, MA

Thomson Brothers Inc (TBI), N. Andover, MA

S.B. Cox, Inc., Richmond, VA

Designed and Built by CBI



swr dec-jan 09 pg 5 AD.indd 5 01/11/10 3:07 PM

http://www.cbi-inc.com

U P F R O N T


Guy Crittenden [email protected]

Brad O’Brien [email protected]

Jamie Ross AccountManagerSheila Wilson ArtDirectorKim Collins MarketProductionMary Garufi CirculationManagerCarol Bell-Lenoury MgrEcoLogGroupBruce Creighton President

BusinessInformationGroupContributing Editors

MichaelCant,AdamChamberlain,MariaKelleher,ClarissaMorawski,UsmanValiante,PaulvanderWerf

Award-winning magazine

Solid Waste & Recycling magazine is published six times a year by EcoLog Information Resources Group, a division of BIG Magazines L.P., a leading Canadian businesstobusiness information services company that also publishes HazMat Management magazine and other information products. The magazine is printed in Canada.

Solid Waste & Recycling provides strategic information and perspectives on all aspects of Canadian solid waste collection, hauling, processing and disposal to waste managers, haulers, recycling coordinators, landfill and compost facility operators and other waste industry professionals.

Canadian Publications Mail ProductSales Agreement No. 40069240

Information contained in this publication has been compiled from sources believed to be reliable, thus Solid Waste & Recycling cannot be responsible for the absolute correctness or sufficiency of articles or editorial contained herein. Articles in this magazine are intended to convey information rather than give legal or other professional advice. Reprint and list rental services are arranged through the Publisher at (416) 5106798.

Return undeliverable Canadian addresses to:Circulation Department, Solid Waste & Recycling12 Concorde Pl, Ste 800, Toronto, ON M3C 4J2Call: (416) 4425600 Fax: (416) 5105148Email: [email protected]

From time to time we make our subscription list available to select companies and organizations whose product or service may interest you. If you do not wish your contact information to be made available, please contact us via one of the following methods:Phone: 18002687742 Fax: 4165105148EMail: [email protected] to: Privacy Officer Business Information Group 12 Concorde Pl, Ste 800 Toronto, ON Canada M3C 4J2

Solid Waste & Recycling, USPS 018886 is published bimonthly by Business Information Group. US office of publication: 2424 Niagara Falls Blvd, Niagara Falls, NY 143040357. Periodicals Postage Paid at Niagara Falls, NY. US postmaster: Send address changes to Solid Waste & Recycling, PO Box 1118, Niagara Falls, NY 14304.

We acknowledge the financial support of the Government of Canada through the Publications Assistance Program towards our mailing costs.

© 2008 All rights reserved. No part of this publication may be reproduced without priorconsent. ISSN14837714

PAP Registration No. 10991

Solid Waste & RecyclingSolid Waste & RecyclingCanada’s magazine on collection, hauling, processing & disposal

For over 20 years, the Association of Municipal Recycling Coordinators (AMRC) has been a key player in researching information on waste reduction programs, and bringing together its members from across Ontario to further municipal 3Rs programs. But its focus no longer

is only on “recycling” and its members are not only “municipal coordinators.” Its mandate has broadened to progress waste management as a whole in Ontario, advocating on behalf of a diverse group of waste management professionals. It has evolved to become the newly renamed “Municipal Waste Association” (MWA).

The origins of the AMRC were due to the efforts of a few dedicated municipal recycling co-ordinators. In 1987 a meeting was hosted by the Region of Peel and organized by Peel Region’s Linda Varangu, Claudia Marsales from Halton Region and Tim Michaels from (the then) Metro Toronto. The original agenda focused on programs for the industrial, commercial and institutional sectors (IC&I) but it soon became apparent — given the standing room only turnout — that there were dozens more municipalities and organizations anxious to discuss this new thing called the “blue box.”

Regular meetings were organized. Municipal coordinators shared information, experience and resources during these meetings and (as legend has it) afterwards some gathered over drinks to reflect on current events and issues, to draft plans and goals.

At first, dedicated volunteers organized mailing lists, meetings, and committees. Eventually staff was hired through the “On-site” program which placed EI-eligible qualified persons into en-

AMRC/MWA executives in front of the new logo at the MWA booth at the recent Canadian Waste & Recycling Expo in Toronto, Ontario. Left to right: Executive Director Vivian de Giovanni,

Chair Sherry Arcaro (County of Peterborough) and ViceChair Sue Campbell (Ottawa Valley Waste Recovery Centre).

Announcing the Municipal Waste

AssociationAMRC has a new name, same long history

swr dec-jan 09 Upfront pg 6-7.indd 6 01/11/10 3:08 PM







The 1992 AMRC executive members (and their affiliations then) and staff looking down from the Monora Pavilion balcony were, from left: Glenn Pleasance

(Durham Region), Mark Collins (Barrie), Jake Westerhof, (Haldimand-Norfolk), Linda Robinson (Mono), Rosanne Fritzsche (Simcoe County), Dick Buggeln

(Waterloo region), Linda Varangu (AMRC ED), Albert Shamess (Halton region), Beth Goodger (Hamilton-Wentworth Region), Kathy McAlpine (Metro Toronto),

Cynthia Hyland (AMRC) and Ben Bennett (Collingwood).

Cynthia Hyland, contractor to the AMRC, conducting HHW research in 1997.

vironment-related positions. Staff enabled the AMRC to better manage the demands and responsibilities inherent with a burgeoning membership.

Information was in short supply and desperately needed by those with fledgling residential programs including blue box, leaf composting, back-yard composter, and household hazardous waste, as well as for IC&I waste diversion initiatives. The AMRC filled this niche then and continues to do so 20 years later.

By the early 1990s, municipal membership in the AMRC had grown to well over 100. The Ministry of the Environment provided funding so the AMRC could expand its activities and services to members. This included workshops dedicated to specific waste diversion issues, studies, and program operation guides. The AMRC produced its first newsletter in the fall of 1990. For R Information, with Ben Bennett as editor, has proven to be an important way to link membership with timely information. In early 1991, the AMRC was incorporated as a not-for-profit organization. Later that year, the AMRC’s first executive director was hired and the AMRC cemented its role as the only municipal organization dedicated to waste diversion in the province.

With the end of provincial funding in the mid 1990s and monies everywhere in short supply during the late 1990s, the AMRC tightened its belt and looked to project-based funding as well as opportunities for corporate sponsorship of its increasingly popular and well-attended workshops.

The board of the AMRC continues to consist of municipal volunteers who offer their time and expertise to contribute to the continual effective-ness of the association. Board members are either elected by standing committees or by the municipal membership. Currently, there are ten board members and five standing committees: Finance, Household Haz-ardous Waste, Markets/Contracts, Organics, and Policy and Programs.

The early board members of the AMRC believed there would come a time when the learning curve on waste diversion in all its forms would flatten and there might no longer be a need for an AMRC. If anything, the curve is ever steeper and the demands placed on individual municipal-ities to deliver cost-effective waste diversion programs have never been greater. Members are still hungry for information and enjoy networking with long-time counterparts at AMRC conferences, workshops, and com-mittee meetings. The AMRC continue — as the Municipal Waste Associa-tion — to play a key role in the evolution of waste management.For more information about the MWA, its activities, committees, etc., contact the office at 516-823-1990 or visit www.amrc.ca@ARTICLECATEGORY:787;

swr dec-jan 09 Upfront pg 6-7.indd 7 01/11/10 3:08 PM


http://www.amrc.ca

“Is a sustainable economy simply one that diverts

more and more residential waste from disposal?”

by Guy Crittenden

The ideas in Ontario’s new Zero Waste discussion paper could reduce waste, change the way it’s managed and paid for, and alter the way the consumer society produces products and packaging. Wow!

It caught industry observers off-guard, and is still flying below the radar of the mainstream media and public.

In November 2008, Ontario Environment Minister John Ger-retsen released a discussion paper, Toward a Zero Waste Future: Review of Ontario’s Waste Diversion Act, 2002. In addition to (no

doubt) causing some “OMG!” moments among environmental activists and industry executives, release of the paper triggered a 90-day comment period that ends January 15, 2009.

It’s no overstatement to say the ideas in Toward a Zero Waste Fu-ture represent a radical potential change in Ontario with respect to waste management and related policy issues. Simply put, it appears that the minister and his staff recognize the not insignificant shortcomings of waste diversion — as a single approach — and are thinking through what would be entailed if they moved the economy toward true sustain-ability.

Public policy, like science, is a matter of asking the right questions. With its renowned blue box, Ontario is a leader in residential waste di-version via curbside collection. Industry “stewards” pay up to 50 per cent of the net costs of the program (something that’s unknown in other provinces or the United States). With many communities implementing

The End of

Garbage?

C O V E R S T O R Y


diversion programs for source-separated organics and multi-residential dwellings, the province will eventually achieve its stated 60 per cent diversion goal.

But is this the right answer to the wrong question? Is a sustainable economy simply one that diverts more and more residential waste from disposal? Or does the consumption of products and packaging designed to enter the waste stream in the first place need to be addressed? Experts say the upstream “externalities” of natural resource extraction, manu-facturing, distribution and actual use of products represent the majority of their energy and environmental impacts. End-of-life management of these materials is only a small part of a bigger equation.

The discussion paper asks new questions and contemplates moving the province beyond the blue box toward European-style producer re-sponsibility for products and packaging. Implementation of these ideas in the real world bears important implications for the “throwaway” so-ciety and a variety of stakeholders, including consumers (who will have to change their behavior), industry (which will have to redesign its prod-ucts and systems) and the waste management industry (which will have to re-process more materials and cart less off to disposal sites).

This could be the beginning of the “end of garbage” as we know it.

swr dec-jan 09 cvr sty pg 8-18.indd 8 01/11/10 3:10 PM



“Ministry staff are aware of the

Product Stewardship Councils that

have popped up in other

jurisdictions.”

C O V E R S T O R Y

The five-year reviewToward a Zero Waste Future is part of a mandatory five-year review of the Waste Diversion Act that, among other things, created Waste Diversion Ontario (WDO) — the agency that pre-sides over policy development in this area. The WDO oversees the Blue Box Program Plan (BBPP) via which industry stewards and municipalities split the net cost of curbside recycling.The WDO has been asked on a separate track to report back next spring on how the BBPP could be revised to incorpor-ate the ideas in the discussion paper. The WDO also oversees product stewardship program development. So far, it has de-veloped programs for house-hold hazardous waste (HHW) and waste electronics (to be implemented in 2009). The government rejected WDO-de-signed programs for used oil and scrap tires (although it’s asked the WDO to revisit the latter).

With the five-year review, industry observers might have expected the minister to simply tweak the existing Waste Diversion Act. Instead, the minister’s discussion paper outlines a Zero Waste policy based on four key principles:ii(i) The framework should be founded on Extender Producer Respon-

sibility (EPR);i(ii) A greater focus on waste reduction and reuse, not just recycling

(i.e., restoration of the waste management hierarchy;(iii) Increasing reduction and diversion of waste from the industrial, com-

mercial a n d i n s t i -

t u t i o n a l IC&I sector

(which is double the size of the residential waste stream); and

(iv) Greater clarity around roles, responsibilities and ac-

countability.The WDA discussion paper discusses producer

versus shared responsibility, the economic implications of individual producer responsibility versus collective pro-

ducer action on waste diversion, the tough issue of stewardship costs manifesting themselves as “visible fees” applied over and

above the price of products, and the impact of stewardship program design on competition in waste service markets.

Specifically, in addition to a greater focus on the first and second of the 3Rs (waste reduction and reuse) the discussion paper proposes a framework built upon the foundation of EPR including:

— The concept that, “… waste diversion programs should shift more financial responsibility onto producers,” while allowing, “… producers to discharge responsibility for their products and packaging in the way that best suits their needs, has the fairest impact on existing markets and meets the public’s demand for successful diversion activities that strive for zero waste and foster a green economy.”

— The concept of differentiating between producers’ products based on the environmental profile of those products (including waste and non-waste factors such as energy efficiency, toxics reduction, greenhouse gas emissions profile, etc.);

— A prohibition on “visible fees”;— Application of stewardship fees to materials that are not currently

recyclable;... continues on page 12




C O V E R S T O R Y

METRO redefines the word ‘waste’

METRO Waste Paper Recovery Inc. is Canada’s largest collector, processor and marketer of recyclable materials.

Serving Industrial, Commercial, Municipal and Graphics markets across Canada and the US for over 30 years.

Toronto Office: (416) 231.2525 • Toll Free: 1.877.226.6608www.metrowaste.com

• Byfocusingontherecoveryofrecyclablematerialsbeforereachingthewastestream

• Maximizingthevalueoftherecyclablematerials• Identifyingefficiencies• Developingnewmarketsfornewmaterials

Together,wecanredefinetheword‘waste’andbecomeGreen…by Nature.

AD VERSION 4

MAKE THE PLANET AND YOUR BOSS HAPPY

WWW.SCHUYLERRUBBER.COM

The Schuyler Rubber cutting edge not only outperforms the competition, it’s also

planet-friendly. Each standard-sized cutting edge we make diverts 16 truck tires

from the landfill. That saves 220 gallons of imported oil and keeps 5,250 pounds

of carbon-dioxide emissions out of the atmosphere.

Call 1-800-426-3917to find out how you can save money with our cutting edge.

OUR CUTTING EDGE USES 100% RECYCLED RUBBER

AD SIZE : 4" X 5"

The Distraction of DiversionWhy BC needs a new waste goal

In the dictionary, the word “diversion” has an ironic double meaning. The first is to deflect, which is what we mean by avoiding waste disposal. But the second meaning is even more

relevant today. To distract. As in, “create a diversion.” Both senses of the word apply to waste politics in BC.

BC’s diversion goal dates back to 1989 when it pledged to cut the amount of garbage disposed per person by 50 per cent by 2000. Province-wide diversion peaked in 1998, at 25 per cent, where it has stayed ever since.

Of the regional districts that met their 50 per cent goal, many moved on to adopt Zero Waste. Interpretations of Zero Waste range from the Regional District of Kootenay Boundary’s goal of 100 per cent diversion by 2020, to Metro Vancouver’s Zero Waste Challenge of getting there “eventually.” All of them intend to work towards zero by setting higher diversion goals.

Metro Vancouver is pledging to boost diversion from 52 per cent to 70 per cent by 2015, which it will hold until 2035. Metro also announced it’s prepared to spend $3 billion on high-tech dis-posal. The question that now dominates BC’s collective imagina-tion is, “What to do with the remaining 30 per cent?”

BC is electric with potential answers. Garbage is being re-branded as a clean, green, carbon-saving, renewable fuel by the province (Ministry of Energy, Mines and Petroleum, BC Climate

Action Secretariat, BC Hydro), as well as Metro Vancouver, other local governments, and, of course, the disposal industry.

The question that no one’s asking is, “Will 70 per cent really get us closer to zero?”

The problem with diversion is that it’s prone to a little fudging. Many regional districts calculate it like a recycling rate, relying on private MRFs to provide estimates that they’re not obligated to track accurately. The formulas also usually include guesses for reduction and reuse. Diversion rates simply aren’t accurate.

Still, there’s a bigger, often overlooked problem. Just because you increase diversion doesn’t mean you’ll decrease disposal at the same rate. That’s because diversion is a relative measure, tied to population growth, consumption, and annual generation rates, and says nothing about absolute disposal.

We need a new kind of goal, one that closes the door on disposal, closes the loop on the economy, and gets us past the “landfill versus thermal technology” debate.

Oakland, CaliforniaCan this be done? Oakland, California, says “yes.” In 2006, the City of Oakland (pop. 400,000), set the boldest, and arguably the truest, Zero Waste goal — to shrink annual waste disposal from

by Monica Kosmak“It would be a shame

if BC’s environment ministry accepted Metro’s artificially

low goal.”



http://www.metrowaste.com

http://www.schuylerrubber.com


C O V E R S T O R Y

AET Consultants forged a merger with EcoServices, Eco2 Systems and

Integrated Green Building Concepts (IGBC) to form the AET Group. The

merger completes the first step towards a collaborative effort to establish

a solutions-based multi-discipilinary environmental consulting company

and professional team recognized as a leading-expert in waste, ecology,

building sciences, energy, and environmental management.

This partnership allows the AET Group of companies to provide a diverse

range of sustainable environmental solutions that will greatly enhance the

resources and technical expertise available to our clients while maintaining

the high quality service that they have come to expect from each of the

member companies.

.

More information about AET Consultants and the member companies (under

the Affiliates web link) can be found at This website will

be updated in the near future to reflect the newly formed AET Group

www.aet-group.com.

Eco erv cess i

IGBCINTEGRATED GREEN BUILDING CONCEPTS

ECO2

SYSTEMS INC.

Sustainable Environmental Solutions

Expertise converge

400,000 short tons per year to 40,000 tons per year by 2020. That’s an absolute reduction of 90 per cent. (Download the entire strategy at www.zerowasteoakland.com.)

Becky Dowdican, Oakland’s Solid Waste & Recycling Program Supervisor, says the city changed directions when it realized that, although it was meeting the state of California’s 50 per cent diver-sion target, garbage wasn’t going down.

“When diversion is high, we all love to brag about it,” says Dowdican. “But it’s hard not to be cynical when we see that gar-bage is the same. So we said, let’s cut through the smoke and mir-rors. Let’s just say Zero Waste really means zero [to disposal].”

As for results, in 2007 Oakland’s total waste disposal dropped by five per cent to 380,000 tons, including residential, commer-cial and C&D streams.

And population growth? Dowdican’s answer is simple. “We disallowed that as an excuse.”

For argument’s sake, let’s say Metro Vancouver adopted an absolute reduction goal of 90 per cent less waste disposed by 2035. Figure 1 shows how this compares to Metro’s proposed 70 per cent diversion, which it intends to achieve by 2015 and hold to 2035. By then, Metro assumes that population will grow from two to three million, and waste generation (3Rs plus disposal) will climb to roughly 4.5 million tonnes.

The red line shows that, if Metro achieves 70 per cent by 2015 holds steady as planned until 2035, total disposal would climb back up to the 1.5 million tonnes — just six percent less than what’s disposed today. (This is the same trend line presented in Metro’s consultation document, Strategy to Update the Solid Waste Management Plan, March 15, 2008 Update.)

The green line shows 90 per cent disposal reduction from 1.6 million to 160,000 tonnes by 2035. That’s less than four per cent reduction a year.

It would be a shame if BC’s environment ministry accepted Metro’s artificially low goal. The ministry has said that EPR will eventually cover all products. BC’s track record of industry-led EPR, with stewards like the brewers recovering more than 90 per cent of their products and covering 100 per cent of the costs, we’re even better positioned than Oakland to go for absolute zero.

Monica Kosmak is a freelance writer and environmental policy analyst based in Port Moody, BC. Contact Monica at [email protected]@ARTICLECATEGORY:2243;



http://www.aet-group.com

http://www.zerowasteoakland.com



C O V E R S T O R Y

Head office:R.R. #5 GuelphON Canada N1H 6J2Tel (519) 824-8520Fax (519) 824-5651

70 3 Ave. N.E. Box 1790Carman, ManitobaCanada R0G 0J0Tel (204) 745-2951Fax (204) 745-6309

rd 6960 Hammond Ave. S.E.Caledonia, MI.USA 49316Tel (800) 466-1197Fax (616) 656-9550

N O W O N L I N E !

Recycler

Recycl ing and renderingaround the world!

www.walinga.com

Walinga VC2336 6/11/07 2:36 PM Page 1

— A more flexible approach to allowing pro-ducers to discharge their existing or future stew-ardship obligations through individually crafted approaches such as pre-existing schemes, or individual producer-run programs.

In regard to increasing reduction and diver-sion of waste from IC&I sector, alternatives include revising the existing 3Rs regulations, extending responsibility for IC&I wastes to producers, or designating IC&I wastes on a material-by-material basis.

The Ministry has posted Toward a Zero Waste Future on the Environmental Bill of Rights Registry at www.ebr.gov.on.ca (Regis-try Number 010-4676).

The implications of all this for consumers and retailers, producers (manufacturers and importers), and managers in the municipal and

commercial waste industry are enormous.

Understanding EPR/IPRThe term Extended Produ-cer Responsibility is used almost interchangeably with “product stewardship” but a different definition is emerging for each. The term “product stewardship” is appropriate for programs whose objective is to simply divert specific waste materials (e.g., used oil) from disposal. Such programs usu-ally charge consumers an Advance Recycling Fee (ARF or “eco fee”) in a system of collec-tion points, haulers and processors approved by a collective Industry Funding Organization

(IFO). Such programs may achieve the diver-sion goal and may be appropriate for rela-tively homogeneous materials like tires.

EPR goes beyond mere waste diversion to make producers truly responsible for

the end-of-life man-agement of their products and packaging, on the assumption that this creates an incentive for them to redesign for the most eco-efficient “cradle to cradle” system over the products’ whole lifecycle. Because the producer can’t fob off its responsibility to an IFO/ARF collective, the systems are sometimes called “Individual

... continued from page 9



http://www.walinga.com

http://www.ebr.gov.on.ca


Call Timothy England : 416-804-9636e-mail : [email protected]

www.emfcontainers.com

Durable

Fibreglass

Lightweight

Long-Lasting

EnvironmentallyFriendly

Compared to Steel, EMF Containers will ...Last Twice as long and Cut Total Cost of Ownership in Half!

Call EMF Containers and Start Saving Today!

EMF a 12/12/08 10:48 AM Page 1

C O V E R S T O R Y

... continues on page 15

Producer Responsibility” (IPR). In this high-tech era of RFID tags and GPS systems, some envision the possibility of specifically tracking and charging producers for each item that re-quires end-of-life management. Short of that, waste composition studies can often determine the approximate fair share of each company’s waste (as electronics manufacturers currently do).

IPR is considered most appropriate for prod-uct and material streams where (a) the brand owners can be identified, (b) the materials are heterogeneous, and (c) the products lend them-selves to redesign. Perhaps the best example is waste electronics and electrical equipment (WEEE) — computers, laptops, cell phones and other devices — for which design for the environment (DfE) opportunities abound. Hewlett-Packard, for example, has redesigned its laptops to facilitate ease of dismantling and recycling, and to include fewer screws and few-er different metals and plastics. Sony has inked a deal with recycler GEEP that encourages customers to return its products to stores and special depots, recognizing the opportunity to establish a customer relationship over the entire product lifecycle. (See article, page 19.)

But it would be wrong to assume that EPR only suits complicated gadgets. EPR/IPR makes can trigger dynamic change for simple packaging types such as the containers used for soft drinks and other beverages.

Ontario (ironically) is home to two very dif-ferent leading systems for the management of used beverage containers (UBCs). The blue box manages non-alcohol UBCs in what’s called the “shared cost” model (municipalities and indus-try split the costs) and also the “basket of goods” (wherein high-value materials such as aluminum cross-subsidize less valuable materials such as mixed plastic). In good times, when commodity prices are high (as they’ve been until recently) the “basket of goods” looks like a winner. But when prices crash, municipal partners are re-minded that the system can be expensive. More importantly (from an EPR perspective), a lot of containers (50 per cent or more) are still sent for disposal (in part because single-serve drinks are often consumed away from the home). UBC recovery rates stalled years ago, and now even the Aluminum Association is supportive of de-posit-refund systems. (See news item, page 60 and article, page 21.)

The other system in Ontario is the one op-

erated by The Beer Store that recovers the brew-ers’ UBCs and packaging. This may be one of the world’s best examples of true EPR; the system recovers 97 per cent of bottles and 83

per cent of cans. Better yet, local producers pre-dominantly use standardized bottles that are re-filled, an approach that’s higher up in the waste




http://www.emfcontainers.com

Brave New WorldWhat would a Zero Waste society look like?

It’s ironic that private industry, in seeking to externalize the cost of its products and packaging onto ratepayers (and the environment) turned to a central-planning model represented by the blue box as its solution.

Now that the limits of this solution are becoming evident, industry will no doubt complain if it’s forced to re-internalize certain costs. However, an EPR economy doesn’t have to be a return to the Stone Age. Perhaps it would look like the society of our grandparents, with a modern techno-logical twist. Think “steam punk” here — you know, the kind of Neo-Victorian trend that’s popped up recently and was celebrated in the film The Golden Compass. (If you didn’t see it, it marries things like dirigibles and Victorian clothing with iPod-era gadgetry. Who says a sustainable economy can’t look cool?) Here are a few ideas of what might occur in the society envisioned in the discussion paper Toward a Zero Waste Future.Disposal bans: No good will come from making industry 100 per cent responsible for end-of-life management of product and packaging waste if the option exists to simply cart it to a landfill or waste-to-energy incineration plant. Ontario’s de-clining permitted landfill space is no secret, and has been described in painful detail in this very magazine. The situation will become more dire with closure of the US border to waste export. Any serious reduction in waste will help.

Zero Waste poses more of a challenge to in-cineration proponents; any municipality seriously considering construction of a large purpose-built waste incinerator must now consider that the anticipated waste fuel may decline precipitously during the operating lifespan of the project. En-vironmentalists certainly hope so. Ontario is in a policy quandary on this at the moment. The Liberal government made an election pledge to close the province’s old coal-fired power plants and has been scrambling to find replacement sources of “calories” for the grid ever since, including “green energy” from wind farms, heat exchange systems and waste-to-energy projects. If the government goes full tilt with waste re-duction, WTE megaprojects may not be viable, but (to be non-ideological) thermal applications may be appropriate for certain niche applications (e.g., autoclave for medical waste, cement kilns or gasifiers for certain wastes).

Simply put, there wouldn’t be a lot of landfills or incinerators in a Zero Waste society, but there would be lots of recycling and composting plants (or a few large ones).Government procurement: After years of talking about it, it’s ridicu-lous how little the government (at all levels) has done to implement green procurement policies. Consultants have identified numerous significant op-portunities for the government (a huge buyer) to “lead by example” and reduce waste and duplication, reuse items and buy recycled products, and require high post-consumer recycled content in office paper and countless other materials. A sustainable Ontario government would stop talking and take action on this.Materials regulated by application: Ontario could establish a for-mal policy task force to link with British Columbia and emulate the ap-proach taken there, which regulates waste diversion by application rather than simply by material. For example, BC is establishing a product stew-ardship program for used detergent containers. This has the advantage that the government can work with one industry group led by a small number of companies whose packaging constitutes the vast majority of waste materials in that sector. The packages generally use the same kind of plastic resin. In this instance, having the detergent companies design and

implement a product stewardship program for their containers makes more sense than, say, implementing product stewardship broadly for a particu-lar kind of plastic. Ontario and BC (and other provinces such as Nova Scotia and Quebec) could cooperate in rolling out a series of programs to deal with various materials/applications, and this would benefit brand owners who sell their products nationally. It’s difficult to imagine “laggard” provinces not following suit once such programs are established. Perhaps the fast food industry could be next? Or pharmaceuticals?Market-based systems: The government could establish an authority in the province similar to the Dualles system in Germany. At the recent AMRC fall conference in Niagara-on-the-Lake, consultant Usman Valiante (a contributing editor to this magazine) outlined a well-received scheme in which Stewardship Ontario would be tasked with responsibility for the ma-terials managed in the blue box. Something like this makes sense, given the “bench strength” within Stewardship Ontario in understanding waste and

recycling issues. No doubt various safeguards would have to be put in place to make sure that anti-competitive “combines”-type activities do not occur or become institutionalized. In a sustainable economy, government would eschew central planning and command-and-control legis-lation and (alongside a clear set of rules) let the market figure out the most eco-efficient ways to achieve “clean production” and closed-loop sys-tems. Call it “the free market” meets “industrial ecology.”Alternative distribution systems: It wasn’t long ago when people’s milk was delivered door-to-door in glass bottles. They took refillable

soft drink containers back to the store to recover their deposit. Although the containers might be made from new-age plastics (and the deposits would be adjusted higher for inflation), a sustainable future would likely see the return of these kinds of distribution and container recovery systems. This might not benefit the market share of the major soft drink brands and their central filling and distribution hubs, but it would certainly be a boost to any number of small “mom and pop” producers who could compete in smaller localize markets (where recovering one’s bottle “float” is paramount.) Or perhaps the free market would favour the major soft drink brands. (Coca-Cola won major market share in Germany by being the first to build a high-tech system for refillable PET containers once it realized the govern-ment was serious.) We needn’t be concerned with who the winners and losers will be in the new economy — only that pollution is prevented and subsidies are ended (including the municipal subsidy wherein local gov-ernments cart away the growing mountain of stuff foisted on consumers).Retooled waste jobs: The job of “sanitation engineer” was invented in the era when waste haulage was a matter of public hygiene and cholera epidemics rampaged in crowded inner cities. While today’s waste man-agers might fear unemployment in a Zero Waste economy, they should consider the boom in alternative next-generation jobs that will spring up when industry has to redesign its systems to eliminate waste, and recycle the tons and tons of material it currently ships to landfill at relatively low cost. Like the workers in smokestack industries who traded in their shovels for laptops, savvy haulers and waste processors will re-envision their jobs for the high-tech future (heck, with its optical sorters and star screen filters, the waste industry is already high tech!).

Perhaps the “garbage truck” of the future will look more like a courier taxi of today.


Steam punk laptop




C O V E R S T O R Y

hallco_solid_waste_magazin.pdf 1hallco_solid_waste_magazin.pdf 1 2/12/07 10:06:29 AM2/12/07 10:06:29 AM

management hierarchy. The Beer Store recently agreed to also accept all the province’s wine and liquor UBCs for recycling, after these were also placed on deposit. Best of all, containers man-aged in this industry-run system are kept (for the most part) out of municipal programs.

The minister’s discussion paper, simply put, envisions extending this kind of system to as many products and packaging types as possible.

It’s difficult not to imagine that used soft drink containers will also eventually be placed on deposit, given the success of The Beer Store system. This would make Ontario’s sys-tem more harmonious with the other Canadian provinces, most of which already have deposits

in place. Indeed, the industry might embrace deposits voluntarily if and when it has to pay the full cost of managing not only its discarded containers collected in the blue box but also those that end up in landfill (as the discussion paper contemplates). The question remains whether or not the government will go to the next step and insist that all (or some portion) of soft drinks be sold in refillable containers (as was the case only a few decades ago). This controversial move would subject the gov-ernment to lobbying from some deep-pocket corporations and their trade associations, yet high-speed sterilization and refilling plants in Germany (and elsewhere) demonstrate that refillable glass and PET containers are a vi-

able alternative; soft drink containers could be managed in an EPR system similar to that of the brewers.

Affected partiesIt’s likely that those industries whose pack-aging materials are currently managed in the blue box will lobby to maintain the status quo, at least initially. And it’s likely that companies would contract with municipalities to collect certain materials going forward, even in an EPR economy. After all, they have the trucks and infrastructure in place.

Barbara McConnell, spokesperson for Stewardship Ontario (the IFO for the blue box






http://www.hallcomfg.com



C O V E R S I D E B A R

Samuel Strapping SystemsThe Samuel Series Balers & Compactors

www.samuelstrapping.com [email protected] 1-800-607-8727

Providing Worry Free Recycling Solutions

Don’t forget that our recycling equipment is complimentedby our complete range of baling wire products and services!

· Single loop, Double loop· Black Annealed Boxed and Stem Wire· Assorted Galvanized Stem Wire· Cut & Straight Wire, Merchant Wire· Custom Packaged, Specialty Wire and much more

Call us today or visit us online at www.samuelstrapping.comto learn more about our recycling equipment and how ourequipment can help manage your waste into pro�table discards.

Samuel Strapping Systems o�ers a complete range of products and consumables designed to provide you e�cient and cost e�ective solutions to your waste recycling requirements. We provide a complete line of vertical balers and compactors engineered to operate under any conditions and for a variety of applications.

Our equipment is fully customizable with a comprehensive options selection to ensure your requirements are met with complete satisfaction. Our machines are found in all industry segments including manufacturing, retail, distribution centers, property management facilities and construction sites.

See our websites for more info:www.brightbeltpress.com

www.xtractorvideo.comwww.densifiervideo.com

At 16 to 20 lbs. per cubic foot, a truckload of

densified foam can weigh 40,000 lbs.

Reduce harmful emissions processing 300 to 1,200 lbs.

of EPS or EPP per hour

269-793-7183 Phone 269-793-8793 Fax

Recycle full containers, PET, Aluminum, Aseptik and more

Recycle your foam and turn waste into profits!

Are We Ready?Recent developments suggest municipalities the general public

may be ready to endorse full EPR. Indications include the fol-lowing:Shopping bags: Ontario grocers recently agreed to charge cus-tomers five cents for each single-use plastic grocery bag. (See news item, page 60) This will encourage people to purchase reusable shopping bags. Such bags have been made available at a nom-inal price (e.g., around one dollar) by major retailers for several years. Examples include Loblaws, Wal-Mart and Canadian Tire (among others). This is a true “win-win” situation since the provi-sion of plastic bags can represent a significant ongoing expense to retailers, sometimes tens of thousands of dollars per store annually. The agreement neatly sidesteps any need to “ban” plastic bags. Simply put, if someone wants a plastic bag, they can have it, but “the polluter pays.” Some chains (e.g., Loblaws) have announced they’ll expand the bag fee program nationally; others (e.g., some Wal-Mart stores) have agreed to take back plastic bags for recyc-ling (including bags from other merchants).Plastic water bottles: Plastic water bottles have become a kind of “poster child” for the throwaway society, and citizens and local governments are starting to take action. Toronto, for example, is considering a ban on plastic water bottles in its own buildings, and the province could eventually ban or limit them altogether. (See news item, page 60.) Yes, the bottles are recyclable, but people recognize that tap water is less expensive to distribute and con-sume, is at least of similar quality to bottled water. The energy and environmental profile of shipping tiny water bottles all over the place is not favorable from a lifecycle perspective.Coffee cups:Tim Hortons and other fast food or grocery establish-ments recently got sideswiped by the City of Toronto when a staff report demanded such businesses encourage and reward people financially for using refillable cups (to keep paper cups with plastic lids attached out of municipal recycling plants) and also discontinue in-store packaging (like the plastic clam shells in which your pre-cooked BBQ chicken is packaged). Toronto staff even went so far as to suggest fast food chains use standard washable plates and cutlery, or allow customers to bring their own reusable packages. Industry reps quickly pointed out the health hazards this would pose, and the city’s ideas on this front may not lead to a quick solution. But more sabre rattling of this kind from municipalities is occurring, the public is hungry for solutions, and ready-serve res-taurateurs would be wise to come up with safe, eco-friendlier pack-aging solutions soon. (Biodegradable/compostable “PLA” plastics might be the solution, but everyone agrees a way must be found to keep them from contaminating recyclable resin streams that look highly similar. Maybe they could be colored deep green…)Sorting fatigue: As residents in more and more communities are forced to pay for waste services on a fee-for-service basis (e.g., bag tags) and sort their recyclables into one or more boxes or carts, and also set out their kitchen organics in green bins, it’s not difficult to imagine they’re getting fatigued. But this could be converted into their also awakening to the consequences of the consumer society. The public viewed the introduction of deposits for wine and alcohol containers very favorably, even though this requires more sorting and trips to The Beer Store. It’s likely they’ll respond favorably to similar programs for HHW, WEEE, batteries and any number of other products.



http://www.brightbeltpress.com

http://www.xtractorvideo.com

http://www.densifiervideo.com

Samuel Strapping SystemsThe Samuel Series Balers & Compactors

www.samuelstrapping.com [email protected] 1-800-607-8727

Providing Worry Free Recycling Solutions

Don’t forget that our recycling equipment is complimentedby our complete range of baling wire products and services!

· Single loop, Double loop· Black Annealed Boxed and Stem Wire· Assorted Galvanized Stem Wire· Cut & Straight Wire, Merchant Wire· Custom Packaged, Specialty Wire and much more

Call us today or visit us online at www.samuelstrapping.comto learn more about our recycling equipment and how ourequipment can help manage your waste into pro�table discards.

Samuel Strapping Systems o�ers a complete range of products and consumables designed to provide you e�cient and cost e�ective solutions to your waste recycling requirements. We provide a complete line of vertical balers and compactors engineered to operate under any conditions and for a variety of applications.

Our equipment is fully customizable with a comprehensive options selection to ensure your requirements are met with complete satisfaction. Our machines are found in all industry segments including manufacturing, retail, distribution centers, property management facilities and construction sites.



http://www.samuelstrapping.com



How do you transform garbage into a resource?

Ask Golder.

We see solutions where others don’t. Effective waste management today requires innovation and good planning. With more than 40 years in the waste business, Golder’s comprehensive consultancy can help. We work with you to develop solutions affording the right balance between social, economic and environmental sustainability. That means state-of-the-art landfill services, including landfill gas systems; but it also means innovations like waste planning, alternative treatment technologies, renewable energies, carbon management, sustainability consultation, management consulting, program management and data management and analysis tools. A World of Capabilities Delivered Locally.

[email protected] www.golder.com/waste

North America + 1 800 275 3281

© 2

008,

GAC

C O V E R S I D E B A R

program), was quoted in an article by Mark Saborin in our affiliate EcoCompliance.ca news letter saying, “We believe that the shared responsibility model is, of course, a really ef-fective way of ensuring that both parties have a shared commitment to the process and mak-ing sure that blue box programs are efficiently operated.”

Municipalities represented by the Associa-tion of Ontario Municipalities (AMO) and the Association of Municipal Recycling Coordin-ators (AMRC, now renamed [see article, page 6.]) have been calling for 100 per cent industry funding for years. However, some municipal-ities may be reluctant to “let go” and realize that if industry is paying the whole bill, it morally has the right to choose whatever system it likes, as long as it meets the minister’s objectives.

Some municipalities may balk at the dis-cussion paper’s mention of “manufacturer’s

networks” and other alternatives, but these are really just different names for product stew-ardship or EPR programs. Municipal staff shouldn’t fret about losing their jobs any time soon; industry will still need their services, although who they report to might change. There will likely be some rationalization of material recovery facilities (MRFs) and other infrastructure, but local governments will still be involved in running depots for household hazardous waste, WEEE and other yet-to-be designated materials. And they’ll probably still be responsible for organic waste collection. Landfills, already short of capacity, will enjoy a reprieve as volumes sent for disposal will de-cline over time.

Ministry staff are aware of the Product Stewardship Councils that have popped up in BC, California, Oregon and Washington, plus more recently in a half-dozen other jurisdic-

tions (e.g., Vermont). These councils endorse the concepts promoted by Bill Sheehan’s Prod-uct Policy Institute (PPI) that envisions EPR for all “product waste” and municipalities pri-marily managing organic wastes.

That such a vision could become reality would’ve been hard to imagine only a few years ago, but the ministry recognizes that the public may be ready for it. And the recent collapse of prices for recycled commodities may have created a “useful crisis” to push the agenda ahead.

We will watch developments in the year ahead and report back to readers about wheth-er and how events unfold as Ontario considers Toward a Zero Waste Future.

Guy Crittenden is editor of this magazine. Contact Guy at [email protected]@ARTICLECATEGORY:2243; 2247;





http://www.golder.com/waste



by Bruce ParkerP R O D U C E R R E S P O N S I B I L I T Y

E-Waste StewardshipGEEP’s “e-colleX” program and Sony

One of the major issues facing the electronics recycling industry in North America is the cost of transporting electronic waste to recycling processors. Distances between large metropolitan

areas incur logistics and transportation costs impacting the profitability in recycling electronic waste.

In April 2008 Global Electric Electronic Processing (GEEP) based in Barrie, Ontario launched e-colleX — a unique national electronic waste collection program to complement and augment existing and planned provincial stewardship programs across Canada. The e-colleX program accepts all consumer electronics including portable appliances, electron-ic games and battery operated devices. Sony was the initial partner in the program as e-colleX provided the opportunity to expand its recycling efforts in collecting all Sony branded products including larger items like televisions and stereos for end-of-life processing. The goal of the

e-colleX program is to make electronics recycling more accessible to Canadians.

All of the collected electronic devices are processed at GEEP facili-ties through a closed loop procedure. In-house processes and proprietary technology ensures that the e-waste is recycled in an environmentally responsible manner, resulting in maximum resource recovery with a zero landfill objective. This provides manufacturers, business customers and consumers with peace of mind in knowing their used electronics have been recycled with security in an environmentally safe manner. As an example, mixed-plastic fractions that would normally go to landfill are processed utilizing GEEP’s proprietary Nano Fuel Technology to prod-uce pure diesel fuel (to drive generators creating electricity to run the Barrie plant).

Currently the e-colleX program manages 29 sites including 14

groundworks/MC7564/SWR 12/5/08 10:23 AM Page 1

“The program can provide a significant incentive to trade old

TVs for the new HD models.”

swr dec-jan 09 PRes pp 19-20.indd 19 02/11/10 8:56 AM


http://www.groundworx.ca


Sony authorized service centres (which only receive Sony brand-ed products). All Sony products are collected at no charge to the customer; all other brands are re-ceived for a nominal processing fee. The objective is to expand the program in 2009 with an additional 25 collection sites and establish a series of collection events work-ing with local businesses. It’s anticipated that other manufacturers will participate in the e-colleX program to augment in-house branded recycling programs. Manufacturer-driven Take Back and Trade In programs are readily facili-tated within the e-colleX program providing a vehicle to stimulate sales and increase retail traffic. As a marketing tool for manufacturers of HD and large screen televisions, the e-col-

P R O D U C E R R E S P O N S I B I L I T Y

Safety is our

#1 Priority

REMEDIATION SERVICEMicroenfractionatorTM

Twister Buckets

• Lease Site Construction• Bio-Cell & Pond Construction• Composting Services

• Demolition• Contaminated Soil Treatment• Soil Hauling Services

1-800-801-3740 • Acadia Valley, AB • www.iwkuhn.ab.ca

3R’sRECLAMATIONLease Site & Pipeline

RESTORATIONOil, Gas & Mining

ENVIRONMENTAL LTD.“Solutions for all your equipment needs.”

IW_Kuhn_sum_fall04.indd 1 3/16/05 4:12:25 PM

IW_Kuhn_WinSpr06.pdf 1IW_Kuhn_WinSpr06.pdf 1 8/19/06 7:16:33 PM8/19/06 7:16:33 PM

leX program , which accepts all televisions and monitors, can provide a significant incentive to trade old TVs for the new HD models.

The WEEE initiative in the European Com-mon Market has shown that the easier it is for a consumer to drop off an electronic device for recycling, the more successful the collection process will be. The addition of a “trade in in-centive” addressing the perceived value of the old electronic device can trigger the decision to move the used product into the recycling stream.

The e-colleX program assures the consumer and the manufac-turer that their old electronics will be processed safely and securely with the knowledge that a unique-ly Canadian solution has been pro-

vided by GEEP in their quest to change the en-tire electronic waste recycling market in North America. GEEP offers the complete range of equipment and systems for mechanically de-stroying electronic waste as well as wide ran-ging recycling services for WEEE materials.

Bruce Parker is Vice President of TechProtect International in Barrie, Ontario. Contact Bruce at [email protected]@ARTICLECATEGORY:793; 2243;

“The easier it is for a consumer to drop off an electronic device

for recycling, the more successful the collection

process will be.”

swr dec-jan 09 PRes pp 19-20.indd 20 02/11/10 8:56 AM


http://www.iwkuhn.ab.ca



“All dairy beverage containers will carry a

deposit of 10 or 25 cents – a first in North America.”

by Clarissa MorawskiP R O D U C T S T E W A R D S H I P

Milk’n the systemAlberta raises deposits and places milk on deposit

Once again, the Province of Alberta has taken the lead in improv-ing the collection and recovery of beverage containers. Last summer the province undertook an extensive regulation review

process for its existing deposit-refund program, which covered all bev-erage containers (both refillable and non-refillable) but excluded milk and any dairy-based beverages. The consultation, led by an all-party committee of the legislature, recommended a series of system improve-ments, most notably increasing the deposit levels and adding dairy bev-erage containers to the existing program.

On October 22, 2008 Alberta Environment and the Beverage Con-tainer Management Board (BCMB) announced that part its Too Good to Waste strategy would include a new beverage container recycling goal of 85 per cent, up from the existing 75 per cent. Under the new pro-gram, deposits will increase from 5 to 10 cents and 20 to 25 cents as of November 1, 2008, and all dairy beverage containers will be placed on deposit by June 1, 2009. For the most part, BCMB reports that Albertans are supportive of these changes, based on over 300 calls received after the announcement.

Higher depositsEnvironmental advocates throughout North America have been calling for increased deposits in programs with deposits of just five cents for many years. They argue that the declining value of the nickel (see fig-ure next page) plays a role in declining recovery rates. Most deposit refund systems were established in the late 1970s and early 1980s and had a five cent refund on containers. The refund levels have not changed significantly within the last few decades and, as the value of the refund has declined over time, accordingly so has the impact of the economic instrument.

In the study Evaluating the Relationship Between Refund Val-ues and Beverage Container Recovery prepared for the BCMB in 2003 by CM Consulting, the findings state:

“A strong, positive relationship exists between higher refund levels and corresponding recovery rates in Canada (r2 = .82) and internation-ally (r2 = 0.80), supporting the hypothesis that the level of the economic incentive to return containers (“the refund”) is a key driver of recovery rates; and data indicates 10-cent refund levels (~86.2 per cent) result in

CompuWeigh™

LandfillsTransfer Stations

RecyclingMRF

RoutingContainer Tracking

DispatchingCall us for a FREE internet demo at (410) 329 1300 or download it

from our website at:ParadigmSoftware.com

Setting the standardin Solid WasteSoftware...

THE

SYSTEMoffers Superior Software

and Service for:

Avery Weigh-Tronix Call: 800.561.9461 or 514.695.0380 www.averyweigh-tronix.ca

Leave the guesswork in your scrap material collection behind with a rugged, reliable Avery Weigh-Tronix Truck Scale and the versatile E1110 indicator.

• High accuracy weighing

• Repeatable, reliable performance

• Dependability, even in challenging conditions

• Application-designed functionality

• Optimized pro� t margins

With over two decades of truck scale experience, Avery Weigh-Tronix ensures you get the most scrap for your money. No guesswork required.

GET ACCURATE WEIGHTS. EVERY TIME.

WTC-101C_79-1008-01 Profi t Guesswork Ad Solid Waste & Recycling

swr dec-jan 09 PStew pp 21-23.indd 21 02/11/10 8:57 AM


http://www.averyweigh-tronix.ca

http://www.paradigmsoftware.com


higher recovery rates than 5-cent levels (~75.1 per cent), and the system for refillable beer (~97.2 per cent) engenders still higher recovery values in Canada due to the high perceived refund associated with the returns of multi-container packs.”

In the Alberta system, unredeemed de posits and material revenue are used directly to off-set system costs. If the recovery rate on bever-

P R O D U C T S T E W A R D S H I P

Li’l FELLA

Waste Container Delivery UnitFina

llyThe Weight is Over ... the rear axle!

For delivery and retrieval of standard

side-pocket bins up to 8 cubic yards in size and 6,000 pounds in

weight.

1-888-262-4076

www.Lil-Fella.com

age containers increases by 10 per cent, then the pool of unredeemed deposits will increase as well. While the number of unredeemed con-tainers will decline, the value of unredeemed containers will double, which means that the revenue from unredeemed de posits will increase, along with material revenue from increased collection. This would seem to be a “win-win” for everyone, except those consumers who choose to discard their container and lose10 cents instead of just 5 cents — a more aggressive penalty for polluters.

In spite of supportive science and the possibility of a more sustain-able financing system, some industries continue to fight higher deposits. In its submission to the standing committee, Refreshments Canada suggested that, “Raising deposit levels would likely amount to nothing more than a ‘cash grab’ out of consumers pockets, with virtually no real improvement to overall diversion in Alberta.”

This sentiment seems to get closer to the real issue that most of the beverage industry has with the concept on increasing deposit levels: the impact on sales. Talk to any beverage company and most believe that a 5-cent increase in deposit levels will have a negative impact on sales.

Truth is, several factors can impact sales of beverage containers like seasonal temperatures, economic climate, etc. As such, it’s difficult to ac-curately measure the economic impact of a deposit increase on sales. To date, no research is available that attributes a direct decline in sales as a result of a new deposit, or an increased deposit. However, it’s worth iden-tifying the impact on sales from front-end fees like container recycling fees (CRF) in BC and Alberta, new deposits, or deposit increases, which



http://www.lil-fella.com


P R O D U C T S T E W A R D S H I P

can be examined by analyzing sales before and after implementation.

According to Alberta sales history, there was no impact on the upward sales trend of beverage sales after implementation of a CRF. According to Encorp Pacific there was also no impact on beverage sales after such a fee was implemented in BC in 1999.

Deposits were increased in California in 1989 from one to two cents; in 1993 from two to 2.5 cents; and in 2004 from 2.5 cents to four cents. More recently, in January 2007 the de-posit was further increased from four to five cents (for small units) and to 20 cents (for large units). Sales figures show no impact as a result of increased deposit values.

Hawaii tracked sales of beverage contain-ers pre- and post-introduction of a deposit-re-fund program there, which charges a five cent deposit, plus a one cent container recycling fee. Again, there was no downward impact on sales. Bottom line: there’s no evidence that de-posits or recycling fees on beverage containers impact sales.

Milk’n the systemThe dairy industry in Alberta resisted being forc-ed into the existing deposit-refund program for many years with a first memorandum of under-standing (MOU) signed in 1998 that stipulated a voluntary goal for milk jugs of 75 per cent. More recently (2007), a new MOU was signed between the ministry and the dairy industry for one year that includes targets of 62 per cent and 55 per cent for HDPE jugs and carton respect-ively, with an “ultimate” goal of 75 per cent.

The Plastic Milk Jug Recycling Program was launched in 1999 for milk jugs and ex-panded to include milk cartons or polycoat containers in 2002. The program is an industry stewardship initiative through which Alberta’s dairy industry supports the voluntary collec-tion and recycling of milk jugs and cartons.

Milk jugs and carton recovery by muni-cipal authorities are financed partially by the dairy industry. More specifically, a guaranteed market value of $400 per tonne for jugs and $225 per tonne for cartons is provided by the industry directly to municipalities, plus a $40 per tonne transportation subsidy for some mu-nicipalities.

Compared to other Canadian provinces, Alberta’s voluntary program was the most successful with recovery rates of 60 per cent for jugs and 23 per cent for cartons. Failure to meet the lowered goals set out in the new MOU prompted the standing committee to recommend that these containers finally be

included in the deposit-refund program. Starting June 1, 2009 all dairy beverage containers will carry a deposit of 10 or 25 cents redeemable at provincial depots. This will be a first in North America.

Performance rates in Alberta over the next couple of years will establish if program changes are successful. Other provinces,

especially British Columbia, will monitor the achievements closely and may well follow Alberta’s lead.

Clarissa Morawski is principal of CM Consulting based in Peterborough, Ontario. Contact Clarissa at [email protected]@ARTICLECATEGORY:2243;





http://www.norsemanenviro.com

http://www.earthmachine.com

http://www.earthmachine.com

“The odour molecules are decomposed to their non-

odourous element forms such as carbon,

hydrogen and nitrogen atoms.”

by Paul van der Werf

Closing the GapThe column “The Capacity to Succeed” (February/March edition)

highlighted the gap between source separated organics (SSO) col-lected and processing capacity in the Ontario. I provided an esti-

mate of current SSO capture, estimated future SSO capture and esti-mated SSO processing capacity in the province.

As highlighted in the Waste Diversion Ontario 2006 and 2007 data-call information, SSO capture continues to increase in Ontario, although the rate of increase is lower than was predicted.

In 2006 there was a 38 per cent increase in households that had ac-cess to green bin collection and a pretty incredible 71 per cent increase in SSO collected. This increase in SSO collected is in part due to ma-turing organics programs as well as a full year of data from green bin programs initiated in 2005. On average, the 1.2 million households with access to the green bin program diverted about 160 kg/year each.

In 2007 there was a 33 per cent increase in households that had ac-cess to green bin collection and a 28 per cent increase in SSO collected. On average the 1.65 million households that had access to the green bin program by that point diverted about 150 kg/year.

Processing capacity has increased significantly since 2007. Some of the composting facilities have developed their full capacity potential and a number of new facilities have come online. More facilities are planned for 2009.

Estimating capacities is an imperfect science, to say the least. In round numbers it’s estimated that in 2008 there’s about 325,000 tonnes of annualized SSO processing capacity. It’s likely that SSO processing capacity will approach 400,000 tonnes in 2009. This includes estimates for the capacities of fully operating facilities and part capacities for those facilities starting operations in 2008. It’s likely that this figure is an overestimate because in many cases rated facility capacity also includes any carbonaceous amendment that must be added to SSO. Furthermore, rated facility capacity does not assume that a facility is running at full capacity. Finally, spare capacity in one facility is not necessarily always used as merchant capacity for SSO outside of the facility’s jurisdiction.

The significant gap in Ontario’s SSO processing capacity is starting to be filled. It’s clear given the continued movement of some SSO out of Ontario that this has not been fully resolved. However, the processing gap is clearly narrowing and could potentially be fully closed within the next two years, and certainly within five years. It seems there’s a mind-set to establish local processing capacity to the extent possible.

Notwithstanding that, there are a number of potentially large new programs to the east (Kingston, Ottawa) and the west (Region of Waterloo and possibly City of London) that could require additional processing capacity. In the east this processing capacity is planned if not under construction. In the west this is less so.

Universal Resource RecoveryThe Region of Niagara is undergoing a transformation with regard to available SSO processing capacity with two new facilities being de-veloped. Universal Resource Recovery Inc. (URRI) is an example of a company that’s developing new SSO composting capacity. It has re-cently developed a new composting (and C&D waste) facility, near Wel-land, Ontario.

They’ve taken the second “R” (reuse) to heart and it forms an in-tegral part of their facility. Unfortunately the province is littered with old manufacturing facilities that have been shuttered for one reason or another. It’s heartening when one of these old facilities is converted to a new use; an efficient reuse of resources.

URRI, an environmental recycling company, purchased the old Welland Pipe site in May, 2006. The site has a staggering 350,000 square feet of building space and the whole site is on about 60 acres. Permitting was received for the use and operation of a waste processing site to be simultaneously used for composting and the mechanical separation of construction and demolition materials. The facility will serve southern Ontario and is set to operate 24/7.

The facility will accept approximately 62,500 tonnes of compostable materials and 105,000 tonnes of C&D materials annually.

Composting occurs under an approximately 160,000 sq ft building. The facility includes receiving areas for SSO, food waste, yard wastes and wood. The various feedstocks are mixed in a substrate preparation area. The feedstocks are composted in channels (Transform Compost System) with the compost cured in a dedicated area. The facility also has a dedicated screening and product storage areas.

C O M P O S T I N G M A T T E R S

Universal Resource Recovery Inc. (URRI) is a company that’s developing new SSO composting capacity. It has recently developed a new composting (and C&D waste) facility, near Welland, Ontario.


swr dec-jan 09 CMat pg 24,41.indd 24 02/11/10 9:00 AM

Solid Waste & Recycling

2009Buyers’ Guide

Canada’s magazine on collection, hauling, processing and disposal

swr dec-jan 09 BG Cover pg 25.indd 25 02/11/10 11:11 AM

BALERS

Al-jon Manufacturing LLCAllegheny PaperApplied Radio TechnologiesBaleforce Recycling EquipmentBalemasterBilt-RiteBruce MooneyCheningtonDurabac DurapacEcotainer & AnexFastco EquipmentHarmony EnterprisesHarris Waste Management Group,High Strength PlatesHJA InternationalIPS Balers,Kernic SystemsLogemann BrothersLubo USAMachinexMachinex Recycling ServicesNexgen BalersMarathon Equipment / NEXGEN

Baling SystemsMetro CompactorMetro Compactor WestPacific Metals RecyclingReaction DistRecycling Equipment Company of

CanadaRotobale Compaction SolutionsSamuel Strapping SystemsSecurity EngineeredSierra Intl MachinerySolid WasteSP IndustriesSummit EquipVan Dyk BalerVarsek TradingWastequip

BATTERY COLLECTION & RECYCLING

The Battery BrokerBattery CouncilFluorescent Lamp RecyclersIntl MarineRBRC (Canada)

BUILDING SYSTEMS

A-Z TechnicalFuture SteelOMI Industries

COLLECTION/HAULING/ DISPOSAL SERVICES

Aevitas IncB.J. BearThe Battery BrokerBFI CanadaBIN THERECallahan HoistsDEL HydraulicsENVIROSORTFluorescent Lamp RecyclersGreen Lane Environmental Group LPHotz Environmental Services


Holly ServicesI-CORP InternationalJacques WhitfordKubota Canada LtdLeak LocationMarshall MacklinNorditradeOCETAParadigm SoftwareRDC GroupR.J. Burnside & Associates LimitedRWDI AIRScarfoSenes ConsultantsTotten Sims HubickiVisionQuest Environmental

StrategiesWaste DiversionWCI Environmental SolutionsWorleyParsons – Div.

Infrastructure & Environment

CONTAINERS (BINS, BAGS, CARTS)

Bear NecessitiesBilt-RiteBioBag CanadaBomac CartsBulk-PackBusch Systems IntlCasemaker Inc.Chevy Lane FabricationsClorox CompanyDrader Manufacturing IndustriesDurabac DurapacDyna PakEcotainer & AnexFibrex GroupHaul-All EquipmentHQN Industrial FabricsHydraline SaniquipIPLIndaco ManufacturingLaurin Inc.LoradayMcClure IndustriesMetro CompactorMidpoint IntlMolok North AmericaMulti BagNorseman PlasticsPerkins ManufacturingEnvironmental PackagingPremier TruckRIN EntRotobale Compaction SolutionsSoudure J.M.SSI Schaefer SystemsThunderbird PlasticsTulip CorporationUniversal Handling EquipmentVisionsQuest/McGuire

promotional ProductsW. RalstonWest Can Mktg

CONVEYORS/BELTS

Allegheny PaperAndela ProductsApache Hose

S.E.L Recycling Services Inc.Walker Environmental Group

COMPOSTING SYSTEMS/ COMPONENTS

All Treat FarmsAllu GroupAtkinson & AssocBioBag CanadaBrown BearCasemaker Inc.Coastal BioAgresearchCompostex CompostDouble T EquipmentDuraTech IndustriesFeconHCL MachineEcolo Odor ControlIPLInternational Bio RecoveryMachinexMcLanaham CorpReotemp InstrumentsResource Recovery Systems

International, Inc.– KWScarab MfgSciCorp SystemsSignature Marketing, LLCSupreme InternationalTransform CompostVecoplanVermeer CanadaW. RalstonWCI Environmental SolutionsWildcat Manufacturing

CONSTRUCTION & DEMOLITION RECYCLING

AET ConsultantsAllu GroupAssinckBIN THEREBulk Handling Systems (BHS)Cardinal DistributionErin RecyclingThe GroundworxHogZilla-CW Mill Equipment Co.,McCloskey InternationalSherbrooke O.E.MVermeer Canada

CONSULTING/ENGINEERING

2cgA-Z TechnicalActive ScaleAET ConsultantsAir EarthAll Treat FarmsAssoc of Municipal RecyAtlas PolytechCoastal BioAgresearchConestoga-Rovers & AssociatesEcoLog ERIS / Environmental Risk

InformationEn-Pro InternationalEnviroplast IncFalcon Ridge GroupGTC Ventures Inc.Golder Assoc

solid waste & recycling — 2009 buyer’s guide

J & M TireLafleche EnvironmentalMetro Waste Paper RecoveryMolok North AmericaRIN EntRothsay – Maple Leaf FoodsS.E.L Recycling Services Inc.Sandhill Disposal & RecyclingWalker Environmental GroupWaste Serv (CA)WastecoWessuc Inc

COMPACTORS/CRUSHERS

A & M Process EquipAmerican CompactorApplied Radio TechnologiesBeacon Engineering Co.Bilt-RiteBomag (Canada),Briquetting SystemsCP ManufacturingDurabac DurapacExcel MachineryFastco EquipmentGlass Aggregate SystemsHarmony EnterprisesHJA InternationalK.R. KomarekLaurin Inc.Laurin Inc.Logemann BrothersMachinexMachinex Recycling ServicesNexgen BalersMarathon Equipment / NEXGEN

Baling SystemsMarcel EquipmentMetro CompactorMetro Compactor WestMultitekNorthern Cast Parts ComapnyPendpacPrecision MachineryReaction DistRecycling Equip MfgRotobale Compaction SolutionsSamuel Strapping SystemsSebright ProductsShu-Pak EquipSolid WasteSP IndustriesSSI Shredding SystemsSummit EquipTee MarkTMS SolutionsUniversal EngineeringUniversal Handling EquipmentVarsek TradingVoghel Enviroquip IncWastequipWilliams Patent

COMPOSTING SITE

All Treat FarmsCardinal DistributionGSI Environnement inc.Lafleche EnvironmentalR.J. Burnside & Associates

Limited

swr d-j 09 BG prods pgs 26-29.indd 26 02/11/10 9:41 AM



Baleforce Recycling EquipmentBruce MooneyBulk Handling Systems (BHS)CP ManufacturingC.S. BellEriez MagneticsErin RecyclingExcel MachineryFlexcoGlass Aggregate SystemsHJA InternationalIndustrial MagneticsIPS Balers,MWE BeltingMachinexMachinex Recycling ServicesNexgen BalersMarathon Equipment / NEXGEN

Baling SystemsMcCloskey InternationalPrecision HuskyRecycling Equip MfgSherbrooke O.E.MSummit EquipTitan IndustriesVan Dyk BalerVecoplan

ELECTRONICS RECYCLING & DESTRUCTION

Artech Reduction TechnologiesECOSYS/ RIDERGlobal Electric Electronic

Processing (GEEP)Intl MarineLubo USAMetech InternationalSecurity Engineered

EVENTS (TRADESHOWS/ CONFERENCES/SEMINARS)

Battery CouncilCCSPACdn Waste/Recy Messe Frankfurtdmg world mediaEco/Log WeekKoelnmesse Inc.Falcon Ridge GroupMarketing StrategiesMunich IntlPollutecRecycling CouncilRecycling CouncilReseau EnvrWastExpo

GLASS RECYCLING

Andela ProductsFluorescent Lamp RecyclersGlass Aggregate SystemsHarvey EnterpriseMSSMcLanaham Corp

GPS TRACKING SYSTEMS

Abbott EnterprisesShaw TrackingSo. Cal Soft-Pak

WAM Software

HEAVY EQUIPMENT/ ATTACHMENTS/PARTS

Allu GroupAtkinson & AssocAtlas PolarBODINE MFGValon Kone BrunetteCaterpillardColumbia CorpContinental Biomass Industries,Crane EquipmentDEL Hydraulics,FeconFuture SteelGroeneveldHarper Power ProductsHercules BulldogHigh Strength PlatesHydraline SaniquipJ & M TireBountyLiebherr-CanadaMaxon IndMGM BrakesNew WastePalfinger North AmericaQuadco EquipmentRotobec IncS.E.S.SETCO SolidSMS Equipment – Eastern RegionSuperior Tire & RubberVulcan On-Board Scales

HOUSEHOLD HAZARDOUS WASTE (HHW)

Aevitas IncENVIROSORTHotz Environmental Services

IC & I WASTE

BioBag CanadaEMF CONTAINERSGreen Lane Environmental Group

LPWalker Environmental Group

INCINERATION / THERMAL (EFW) SYSTEMS

Action EquipmentEco WasteGTC Ventures Inc.RGF EnvironmentalWater MazeWillms & Shier

INDUSTRY ASSOCIATIONS

Battery CouncilCARICCSPAComposting CouncilMunicipal Waste IntegrationReseau Envr

INDUSTRY INFORMATION/ TECHNICAL RESOURCES/ PUBLISHING, ETC.

aboutREMEDIATION.comAtlas PolytechDatabase PublishingEcoLog InfoEcolog LegislativeEco/Log WeekEn-Pro InternationalFalcon Ridge GroupGeosynthetica.netMunicipal Waste IntegrationOCETAPenwortham GroupRecycling CouncilSK Waste ReductionScarfo

INFORMATION TECHNOLOGY RECOVERY

ECOSYS/ RIDER

INSTRUMENTATION/CONTROL/ SAMPLING/MONITORING EQUIPMENT

Abbott EnterprisesAggressor AutoApplied Radio TechnologiesAvery Weigh-Tronix CanadaBascom-TurnerCanadian ScaleEPG CompaniesGlobal SensorJ. McGale Industries Inc.

– Clarion Surround SightMGM BrakesQEL QuatrosenseReotemp InstrumentsSpectrum Technologies

INSURANCE

EcoLog ERIS / Environmental Risk Information

LABORATORY TESTING SERVICES

Active ScaleCRIQDyna PakEriez MagneticsI-CORP InternationalK.R. Komarek

LANDFILL MANAGEMENT SYSTEMS (CAPS, DAILY COVER, LINERS, GAS/LEACHATE COLLECTION & TREATMENT

Agru AmericaAmCon EnvironmentalConestoga-Rovers & AssociatesEPG CompaniesGeosynthetica.netGolder AssocGSI Environnement inc.Ecolo Odor ControlHQN Industrial Fabrics

I-CORP InternationalLandsaver EnvironmentalLayfield GeosyntheticsLeak LocationMadvacMercer Motor WorksNew WasteNilex Inc.North American GreenEnvironmental PackagingQEL QuatrosenseReef IndustriesR.J. Burnside & Associates

LimitedRusmar IncSciCorp SystemsSolmax InternationalStanmech TechTex-NetTotten Sims Hubicki

LANDFILL OPERATORS

BFI CanadaEssex- Windsor Solid WasteGreen Lane Environmental Group LPLafleche EnvironmentalWalker Environmental GroupWaste Serv (CA)

LAWYERS/LEGAL SERVICES

Cassels Brock & Blackwell LLPEcoLog ERIS / Environmental Risk

InformationEcoLog InfoEcolog LegislativeMcCarthy TétraultMiller Thomson LLPWillms & Shier

MATERIALS HANDLING EQUIPMENT

Allied-GatorApache HoseAtlas PolarBayne Premium Lift SystemsBomac CartsB and C BodyCallahan HoistsCarrier VibratingCasemaker Inc.CaterpillardDouble T EquipmentHallco MfgHarris Waste Management Group,Hercules BulldogIndustrial MagneticsKubota CanadaBountyLiebherr-CanadaLoradayMWE BeltingMcClure IndustriesMetro CompactorMetro Compactor WestMultitekStearns MagneticsPacific Metals RecyclingPalfinger North AmericaPolymer Recovery

solid waste & recycling — 2009 buyers’ guide



CP ManufacturingC.S. BellCarrier VibratingContinental Biomass Industries,Crane EquipmentCRIQDings CompanyEnviroplast IncEriez of CanadaEriez MagneticsErin RecyclingExcel MachineryECOSYS/ RIDERGranutech-SaturnHarmony EnterprisesHaycore CanadaHercules BulldogHosokawa Polymer SystemsIPLInternational Bio RecoveryJ.F. ComerJoe JohnsonK.R. KomarekKeith ManufacturingKernic SystemsLiebherr-CanadaLogemann BrothersLubo USAMSSMWE BeltingMachinexMachinex Recycling ServicesMagnetics Div GlobalMetso MineralsMid City GroupMidpoint IntlNational RecoveryNorditradeOhio Magnetics, Inc.- Div. StearnsStearns MagneticsOliver ManufacturingPolymer RecoveryRecycling Equipment Company of

CanadaRecycling Equip MfgRotobec IncScarab MfgSebright ProductsSherbrooke O.E.MShred-TechSierra Intl MachinerySolid WasteSteinert US, LLCSupreme InternationalT&T TechnologyTee MarkThunderbird PlasticsTryco/UnthaUniversal EngineeringVan Dyk BalerVoghel Enviroquip IncWalinga Inc.Walker MagneticsWalking FloorWest Can MktgWildcat ManufacturingWilkens Industries


Roll-Rite, LLCS.E.S.Samuel Strapping SystemsSennebogen LLCSETCO SolidSMS Equipment – Eastern RegionStellar IndustriesThunderbird PlasticsTitan IndustriesWalker MagneticsWastequip

MOVING FLOOR SYSTEMS

Columbia CorpEast ManufacturingHale Trailer BrakeHallco MfgJ&J Truck BodiesKeith ManufacturingMachinexMachinex Recycling ServicesTitan TrailersWalking FloorWilkens Industries

NON-GOVERNMENT ORGANIZATIONS

aboutREMEDIATION.comAlberta Dairy CouncilAssoc of Municipal RecyCCSPAComposting CouncilFCM’s Green Municipal FundRBRC (Canada)Recycling CouncilRecycling CouncilReseau EnvrWaste Diversion

ODOUR CONTROL SYSTEMS

A.C. Carbone Canada Inc.BIOREM TechnologiesCBI Howe-Baker EngineersFogmaster CorporationEcolo Odor ControlInternational Bio RecoveryMetro CompactorNew WasteOdor ControlOMI IndustriesRGF EnvironmentalReaction DistRusmar IncRWDI AIRScarab MfgSciCorp Systems

PAINT CAN CRUSHERS

Tee Mark

PAPER / FIBRE RECYCLING/COLLECTION

Alberta Dairy CouncilAllied Paper SaversArtech Reduction TechnologiesBalemasterBFI CanadaBusch Systems Intl

Enterprise CodeWorksEssex- Windsor Solid WasteMSSMadvacMetro Waste Paper RecoveryMulti BagR.A.R.E. Recyclage AlexandriaRIN EntShred-TechSP IndustriesTulip CorporationWalinga Inc.Waste Serv (CA)Wasteco

PLASTICS RECYCLING/ COLLECTION

Alberta Dairy CouncilBusch Systems IntlCheningtonEnviroplast IncEssex- Windsor Solid WasteFibrex GroupECOSYS/ RIDERGranutech-SaturnHaul-All EquipmentHaycore CanadaHosokawa Polymer SystemsIndustrial MagneticsMadvacMetro Waste Paper RecoveryMulti BagPolymer RecoveryR.A.R.E. Recyclage AlexandriaRIN EntTemperature CorpTulip CorporationVarsek TradingWalinga Inc.

PRODUCT STEWARDSHIP/ EPR PROGRAMS

VisionQuest Environmental Strategies

PUMPS/VALVES/METERS

Blackhawk TechnologyDEL Hydraulics,EPG CompaniesHydraline SaniquipJ.F. ComerOMI Industries

RECYCLING SORTING & SEPARATION EQUIPMENT

A & A Magnetics,Action EquipmentAllied-GatorAmerican PulverizerAndela ProductsAssinckBDR MachineryThe Battery BrokerBeacon Engineering Co.BM&M ScreeningBomac CartsBruce MooneyBulk Handling Systems (BHS)

SCALES/WEIGHING SYSTEMS

Active ScaleActive ScaleAggressor AutoAir-Weigh ScalesAvery Weigh-Tronix CanadaB and C BodyCanadian ScaleEnterprise CodeWorksFairbanks ScalesFastco EquipmentMETTLER TOLEDO CanadaParadigm SoftwareSo. Cal Soft-PakTMS SolutionsTrouble-Shooting ServicesVulcan On-Board Scales

SCRAP METAL RECYCLING

Allied-GatorAmerican PulverizerBaleforce Recycling EquipmentBIN THEREBODINE MFGBriquetting SystemsCommercial MetalsEriez of CanadaGlobal Electric Electronic

Processing (GEEP)Harris Waste Management Group,Hotz Environmental ServicesIntl MarineIPS Balers,J & M TireJ.F. ComerMetech InternationalMetso MineralsOhio Magnetics, Inc.- Div. StearnsStearns MagneticsOliver ManufacturingPacific Metals RecyclingRIN EntShred-TechSierra Intl MachinerySuperior Tire & RubberWalker Magnetics

SHREDDERS/TIRE RECYCLING

A & M Process EquipAllegheny PaperAmerican PulverizerArtech Reduction TechnologiesBDR MachineryBalemasterBrown BearC.S. BellCheningtonColumbus McKinnonContinental Biomass Industries,Ecotainer & AnexGranutech-SaturnThe GroundworxHigh Strength PlatesHosokawa Polymer SystemsKernic SystemsMachinexMachinex Recycling ServicesMagnetics Div GlobalRecycling Equipment Company of





CanadaSecurity EngineeredShred-TechSSI Shredding SystemsTemperature CorpTryco/UnthaVecoplanWeimaWilliams Patent

SLUDGE FILTRATION/ DEWATERING/DREDGING

Brown BearBulk-PackCRIQLabrie EquipLayfield GeosyntheticsM E C CompanyMaxon IndEnvironmental PackagingSebright ProductsSuperior Tire & RubberWessuc Inc

SOFTWARE/CD-ROM/ INTERNET MULTIMEDIA

Aggressor AutoCanadian ScaleClear ComputingDiscerning SystemsEcoLog InfoEco/Log WeekEnterprise CodeWorksGeosynthetica.netSo. Cal Soft-PakTMS SolutionsTRUX RouteWAM Software

SPECIAL WASTE

EMF CONTAINERSWorleyParsons – Div.


TRAILERS MANUFACTURING & SERVICES (TRANSFER, ETC.)

Columbia CorpEast ManufacturingFort Garry IndGreat LakesHale Trailer BrakeHallco MfgJ&J Truck BodiesKeith ManufacturingKNL HoldingsManacMid City Group

Inovex IndustriesSoudure J.M.Titan TrailersTravis Body & TrailerUniversal Handling EquipmentWalking FloorWilkens Industries

TRAINING & CONTINUING EDUCATION

aboutREMEDIATION.comAssoc of Municipal RecyCoastal BioAgresearchEcolog LegislativeHaycore CanadaMarshall MacklinMunicipal Waste IntegrationOCETARDC GroupRobotronicsSK Waste ReductionScarfoSenes ConsultantsTRUX Route

TRANSPORTATION/ FLEET MAINTENANCE

B.J. BearFort Garry IndGlobal SensorGroeneveldHarper Power ProductsHolly ServicesIntec VideoJoe JohnsonLoradayRGF EnvironmentalInovex IndustriesWalker Environmental Group

TRUCKS/HAULING & EQUIPMENT (FRONTLOADERS, ROLL-OFFS, LUGGERS, HOOK LIFT, ETC.)

B.J. BearBayne Premium Lift SystemsB and C BodyCallahan HoistsFort Garry IndFuture SteelGlobal SensorHarper Power ProductsHaul-All EquipmentHeil EnvironmentalHQN Industrial FabricsHydraline SaniquipIntec VideoJ&J Truck BodiesJoe Johnson

Labrie EquipLaurin Inc.Mailhot IndustriesMarcel EquipmentMarrelMid City GroupOntario AutocarPalfinger North AmericaPendpacPerkins ManufacturingPremier TruckInovex IndustriesRoll-Rite, LLCRotobec IncSETCO SolidShu-Pak EquipSims Cab DepotSMS Equipment – Eastern RegionSoudure J.M.Stellar IndustriesTitan TrailersUniversal Handling EquipmentVulcan On-Board ScalesWalinga Inc.Wessuc Inc

TUB GRINDERS – SALES & SERVICE

Atkinson & AssocBandit IndustriesContinental Biomass Industries,Doran MfgDuraTech IndustriesHogZilla-CW Mill Equipment Co.,PetersonPrecision HuskyRotochopper,S.E.L Recycling Services Inc.Supreme International

WASTE AUDITING/ ENVIRONMENTAL MANAGEMENT

2cgAET ConsultantsBIOREM TechnologiesConestoga-Rovers & AssociatesDeisterEn-Pro InternationalENVIROSORTGolder AssocHolly ServicesJacques WhitfordKubota Canada LtdMetro Waste Paper RecoveryMarshall MacklinOCETARDC Group

RWDI AIRSK Waste ReductionSenes ConsultantsSpectrum TechnologiesTotten Sims HubickiVisionQuest Environmental

StrategiesWaste DiversionWastecoWillms & ShierWorleyParsons – Div.


WASTE TO ENERGY TECHNOLOGY

Valon Kone BrunetteContinental Biomass Industries,Double T EquipmentDuraTech IndustriesGTC Ventures Inc.SSI Shredding SystemsWeima

WOOD RECYCLING EQUIPMENT/ PARTS (DELIMBERS, DEBARKERS, TROMMEL SCREENS, CHIPPERS, ETC.)

A & M Process EquipAction EquipmentAssinckBDR MachineryBandit IndustriesBODINE MFGValon Kone BrunetteCardinal DistributionContinental Biomass Industries,Doran MfgFeconHogZilla-CW Mill Equipment Co.,MachinexMachinex Recycling ServicesMagnetics Div GlobalMarcel EquipmentMcCloskey InternationalMcLanaham CorpMultitekNorthern Cast Parts ComapnyOliver ManufacturingPetersonPrecision HuskyRotochopper,Tryco/UnthaVermeer CanadaVoghel Enviroquip IncWeimaWest Salem MachineryWilliams Patent






2cg Inc.451 Ferndale AveLondon ON N6C 3X7519 645-7733 Fax: 519 645-0337.Pres Paul Van Der WerfWaste auditing for residential sectorWaste auditing for IC&I sectorWaste management planningWaste diversion strategy developmentComposting expertiseRecycling expertiseWaste brokering.

A & A Magnetics, Inc.PO Box 1427Woodstock IL 60098-1427Location: 520 Magnet Way815 338-6054 Fax: 815 338-8590.Toll-Free: 888 605-6054Sls Chris Klute

A & M Process Equipment Ltd.487 Westney Rd S, Unit 1Ajax ON L1S 6W7905 619-8001 Fax: 905 619-8816.Pres John Lang

A.C. Carbone Canada Inc.300 rue BrosseauSt-Jean-Richelieu QC J3B 2E9450 348-1807 Fax: 450 348-3311.Gen Mgr Karl Mertn Jr

A-Z Technical Bldg. Systems Inc.299 Mill Rd, Unit 1510Toronto ON M9C 4V9416 626-1794 Fax: 416 626-5512.Toll-Free: 877 743-5888Pres Wally M Loucks

Abbott Enterprises, Inc.PO Box 9026Pine Bluff AR 71611870 535-4973 Fax: 870 535-4970.Toll-Free: 800 643-5973Dir-Mktg John T Ware II

aboutREMEDIATION.com2070 Hadwen Rd, Unit 201AMississauga ON L5K 2C9905 822-4133 Fax: 905 822-3558.Proj Eng Wayne Coutinho

Action Equipment Company, Inc.PO Box 3100Newberg OR 97132-5100Location: 2800 Hayes St503 537-1111 Fax: 503 537-1117.Parts/Serv Brian Bonham

Active Scale Manufacturing Inc.PO Box 2145 Stn MainBrantford ON N3T 5Y6Location: 6 York Rd519 752-3701 Fax: 519 756-0267.Toll-Free: 866 284-2223

Active Scale Manufacturing Inc.PO Box 2145Brantford ON N3T 5Y6

Location: 6 York Rd519 752-3701 Fax: 519 756-0267.Toll-Free: 866 284-2223Pres Mark Nielsen

AET Consultants, A Divison of AET Group Inc.3-504-133 Weber Street NorthWaterloo ON N2J 3G9Location: 531 Wellington St NKitchener ON N2H 5L6519 576-9723 Fax: 519 570-9589.Principal/Sr Consultant-AET Group Inc. Scott FreiburgerBranches:Eco2 Systems204 Herbert StWaterloo ON N2J 1T8Integrated Green Building Concepts, Waterloo, ONConsultants in waste, building sci-ences, ecology, energy and environ-mental management. Services include waste composition audits; wste char-acterization; waste reduction pro-grams; operation assessments and optimizations; IC&I and C&D waste management; comprehensive munic-ipal waste studies; waste receiver assessments; building retrofits; LEED design and facilitation; environmen-tal impact studies; biological assess-ments and surveys; ecological model-ling; natural systems planning and management; ecological design and restoration; energy audits; energy fea-sibility studies; regulatory compliance; environmental management systems; government consultation; ewmedial specialized communication and pro-gram management; and environmen-tal health & safety.

Aevitas inc.75 Wanlass CrtAyr ON N0B 1E0519 740-1333 Fax: 519 740-2320.Toll-Free: 800 324-8997Sls Mgr Tom maxwellAevitas Inc is an industry leader in pro viding environmentally responsible and cost effective solutions for unique waste treatment and disposal streams. It is our company objective to pro-vide safe and permanent treament of a wide range of PCB materials; the only commercial mercury waste treat-ment system in Canada; transformer oil draining, removal, treatment and recycling; pioneered mobile treatment of PCB ballasts; drummed wste pack-aging and removal; and an in-house analytical laboratory testing service with trace organic capabilities.

Aggressor Automation9061 Airport RdMount Hope ON L0R 1W0905 679-6397 Fax: 905 679-3131.VP Paula Harley

Agru America Inc.500 Garrison RdGeorgetown SC 29440843 546-0600 Fax: 843 527-2738.Sls/Mktg Dee Strong

Air Earth & Water Environmental Consultants Ltd.423 Ireland RdSimcoe ON N3Y 5J1519 426-7019 Fax: 519 426-5035.Pres Robert Lovegrove

Air-Weigh On-Board Scales1730 Willow Creek CirEugene OR 97402541 343-7884 Fax: 541 431-3121.Toll-Free: 888 459-3444Sls Mgr-Refuse Div Michael Ferguson

Al-jon Manufacturing LLC14599 2nd AveOttumwa IA 52501641 455-5635 Fax: 641 682-6294.Toll-Free: 888 255-6681Pres Kendig K Kneen

Alberta Dairy Council, Milk Container Recycling Program12 Wordsworth PlSt. Albert AB T8N 3P4780 418-1400 Fax: 780 418-1600.Toll-Free: 877 414-5847Prog Coord Roberta Windrum

All Treat Farms Ltd.7963 Wellington Rd 109Arthur ON N0G 1A0519 848-3145 Fax: 519 848-2598.Compost Site Mgr Bruce Voisin

Allegheny Paper Shredders CorporationPO Box 80Delmont PA 15626-0080Location: Old William Penn Hwy E724 468-4300 Fax: 724 468-5919.Toll-Free: 800 245-2497Sls Mgr Evelyn Jefferson

Allied-Gator, Inc.2100 Poland AveYoungstown OH 44502330 744-0808 Fax: 330 744-3218.Toll-Free: 800 624-2867Sls/Mktg Mike Ramun

Allied Paper Savers Inc.16820 129 Ave NWEdmonton AB T5V 1L1780 447-1648 Fax: 780 447-1737.Toll-Free: 888 680-1648Bus Mgr Brent McIntosh

Allu Group700 Huyler StTeterboro NJ 07608-1131201 288-2236 Fax: 201 288-4479.Toll-Free: 800 939-2558Pres Mardi Ohanessian

Alternative Plastic Products Mfg. Inc.1610 Lakeside Rd SLethbridge AB T1K 3G8403 329-1713 Fax: 403 329-1512.Pres Grant Harrington

AmCon Environmental Co, Inc.PO Box 1516Somerset KY 42502606 679-7929 Fax: 606 678-6580.Pres/CEO Bill N Cody

American Compactor, Inc.PO Box 1303Mansfield OH 44901419 522-9550 Fax: 419 522-1807.CEO David Shook

American Pulverizer Company1319 Macklind AveSt. Louis MO 63110-1853314 781-6100 Fax: 314 781-9209.VP-Sls/Serv Skip Anthony

Andela Products, Ltd.493 State Rte 28Richfield Springs NY 13439315 858-0055 Fax: 315 858-2669.Pres Cynthia Andela

Apache Hose & Belting Co. Inc.4805 Bowling St SWCedar Rapids IA 52404319 365-0471 Fax: 319 365-2522.Toll-Free: 800 553-5455Pres/CEO Steve Crain

Applied Radio Technologies Corporation388 Speers Rd, Floor 2Oakville ON L6K 2G2905 825-8240 Fax: 905 338-7885.Toll-Free: 888 278-7343Toll-Free Fax: 866 894-4329VP-Sls/Mktg Bob Carroll

Artech Reduction Technologies1218 South Service Rd WOakville ON L6L 5T7905 829-1350 Fax: 905 829-1535.Bus Dev Mgr Gary Klowak

Assinck Limited9577 Hwy 48 NMarkham ON L3P 3J3888 801-4700 Fax: 888 801-4900.VP George Baker

Association of Municipal Recycling Coordinators127 Wyndham St NSuite 100Guelph ON N1H 4E9519 823-1990 Fax: 519 823-0084.Project/Commun Mgr Ben Bennett

Atkinson & Assoc.PO Box 22 Stn MainAmherst NS B4H 3Y6902 667-9985 Fax: 902 667-0485.Owner John R Atkinson

Atlas Polar Company Limited60 Northline RdToronto ON M4B 3E5

swr dec-jan 09 pg 30-40.indd 30 03/11/10 8:12 AM




Toll-Free: 800 498-4215Pres Peter J Anderson

Busch Systems International Inc.343 Saunders RdBarrie ON L4N 9A3705 722-0806 Fax: 705 722-8972.Toll-Free: 800 565-9931Commun Coord Genevieve Dupont

CP Manufacturing Inc.1300 Wilson AveNational City CA 91950619 477-3175 Fax: 619 477-2215.Toll-Free: 800 462-5311Sls Mgr Dirk Kantak

The C.S. Bell Co.PO Box 291Tiffin OH 44883-0291419 448-0791 Fax: 419 448-1203.Adv Mgr/Pres Ronald F White

Callahan 5th Wheel HoistsPO Box 205Royal City WA 99357509 346-2208 Fax: 509 346-9203.Pres Nancy Callahan

Canadian Association of Recycling Industries3 Clay StAlmonte ON K0A 1A0613 256-8533 Fax: 613 256-8534.

Canadian Consumer Specialty Products Association130 Albert StSuite 800Ottawa ON K1P 5G4613 232-6616 Ext. 12 Fax: 613 233-6350.

Canadian Scale Company Limited305 Horner AveToronto ON M8W 1Z4416 259-1111 Fax: 416 259-1959.Toll-Free: 800 461-0634

Canadian Waste & Recycling Expo1600 Parkwood CirSuite 615Atlanta GA 30339403 638-4410 Fax: 403 638-4413.Toll-Free: 877 534-7285Show Mgr Arnie Gess

Cardinal Distribution Inc.7 Cheminot StAngliers QC J0Z 1A0819 949-2281 Fax: 819 949-4141.Toll-Free: 800 463-4862Admn Mgr Karie Berneche

Carrier Vibrating Equipment CanadaPO Box 759Aurora ON L4G 4J9905 727-3185 Fax: 905 727-3187.Gen Mgr Mike Doucette

Bomac Carts, LLC201 Badger PkyDarien WI 53114262 882-5000 Fax: 262 882-3389.Toll-Free: 800 909-1147VP-Sls/Mktg Cindy Lapidakis

Bomag (Canada) Inc.1300 Aerowood DrMississauga ON L4W 1B7905 625-6611 Fax: 905 625-9570.Toll-Free: 800 263-0814Cdn Sls Mgr Dan Church

Briquetting Systems101-1001 Broadway WVancouver BC V6H 4E4604 818-0287 Fax: 604 874-7103.Pres Wayne Winkler

Brown Bear CorporationPO Box 29Corning IA 50841-0029641 322-4220 Fax: 641 322-3527.Pres Stan Brown

Bruce Mooney Associates Inc.PO Box 749Marlton NJ 08053856 797-9164 Fax: 856 797-9165.Toll-Free: 800 454-2686Treas Eric Mooney

Brunette Industries Ltd.330 Edworthy WayNew Westminster BC V3L 5G5604 522-3977 Fax: 604 522-6806.

BTE Body Compny, Inc.PO Box 569040Dallas TX 75356-9040Location: 3611 Irving BlvdDallas TX 75247 Fax: 214 630-0852.Toll-Free: 800 299-6225 Ext. 236Gen Mgr Arlyn D Campbell

Bulk Handling Systems (BHS)1040 ArrowsmithEugene OR 97402-9121541 485-0999 Fax: 541 485-6341.Toll-Free: 866 688-2066Sls/Mktg Asst Donna WaltersBulk Handling Systems (BHS) is an innovative, worldwide leader in the design, manufacturing and installa-tion of material sorting and handling systems for the solid waste and recy-cling industries. Companies around the world choose BHS because of our experience and dedication, cutting-edge technology, quality construction and unmatched customer service. Our customized systems reduce labor costs and increase material through-put and recovery rates, creating both efficient and economical operations.

Bulk-Pack Inc.1025 9th St NMonroe LA 71201318 387-3260 Fax: 318 387-6362.

Beacon Engineering Co. Inc.PO Box 129Jasper GA 30143706 692-6411 Fax: 706 692-3227.Sec-Treas Susie Shields

Bear Necessities Waste & Food Storage Inc.210 Lady MacDonald DrCanmore AB T1W 1H3403 678-6304 Fax: 403 451-1465.Pres/CEO Lori Hogarth

BFI Canada Inc.135 Queens Plate DrSuite 300Toronto ON M9W 6V1416 401-7725 Fax: 416 741-4565.Pres/CEO Keith Carrigan

Bilt-Rite Disposal Equipment Ltd.143 Industrial RdBolton ON L7E 1K5905 857-0330 Fax: 905 857-7669.Toll-Free: 866 245-8634Pres Sal Chiera

Bin-There Inc.561 Brant StSuite 8501Burlington ON L7R 2G6905 634-0777 Fax: 905 333-1562.Toll-Free: 866 562-3246Pres Henry Kwasniak

BioBag Canada Inc.103-1687 W BroadwayVancouver BC V6J 1X2604 876-5100 Fax: 604 876-5107.Toll-Free: 866 976-5100Pres Greg Beresford

BIOREM Technologies Inc.7496 Wellington Rd 34RR 3Guelph ON N1H 6H9519 767-9100 Ext. 240 Fax: 519 767-1824.Toll-Free: 800 353-2087Dir-Tech/Emerging Mktg Derek S Webb

Blackhawk Technology Company21W161 Hill AveGlen Ellyn IL 60137630 469-4916 Fax: 630 469-4896.Sls Rep Mark Bertane

BM&M Screening Solutions9377 193 StSurrey BC V4N 4E7604 888-8400 Fax: 604 888-8404.Toll-Free: 800 663-0323Exec Asst Maureen Goosen

Bodine Mfg.Industrial ParkPO Box 269Smithville ON L0R 2A0Location: 2276 London Rd905 957-2961 Fax: 905 957-4631.Toll-Free: 800 269-0257Slsmn Scott Fletcher

416 751-7740 Fax: 416 751-6475.Toll-Free: 888 799-4422Ontario Sls Mgr Peter Scott

Atlas Polytech Inc.400 boul Marie-VictorinBoucherville QC J4B 1W2450 449-4041 Fax: 450 449-7454.Pres M Scholler

Avery Weigh-Tronix Canada217 boul BrunswickPointe Claire QC H9R 4R7514 695-0380 Fax: 514 695-6820.Toll-Free: 800 561-9461Sls Mgr Joe Stark

BDR Machinery Ltd.4580 Eastgate PkyMississauga ON L4W 4K4905 625-9236 Fax: 905 625-6437.Pres Christer Eyram

B.J. Bear25 Earl Martin DrElmira ON N3B 2L4519 669-1750 Fax: 519 669-3818.Toll-Free: 888 545-2736Pres Warren Jack

Baleforce Recycling Equipment27-1300 King St ESuite 187Oshawa ON L1H 8J4905 725-1900 Fax: 905 725-2948.Toll-Free: 888 874-1692Sls Mgr Jim Guest

Balemaster980 Crown CrtCrown Point IN 46307219 663-4525 Fax: 219 663-4591.Reg Mgr Western Cda John Peirick

Bandit Industries, Inc.6750 Millbrook RdRemus MI 49340989 561-2270 Fax: 989 561-2273.Toll-Free: 800 952-0178

Bascom-Turner Instruments, Inc.111 Downey StNorwood MA 02062781 769-9660 Fax: 781 769-2099.Toll-Free: 800 225-3298Mktg Mgr Dennis N Crouse

The Battery Broker Environmental Services Inc.11 Tupper AveToronto ON M8Z 5H5416 255-3321 Fax: 416 255-7707.Pres Ron Bebee

Battery Council International401 North Michigan AveChicago IL 60611-4267312 644-6610 Fax: 312 527-6640.VP Maurice Desmarais

Bayne Premium Lift Systems910 Fork Shoals RdGreenville SC 29605864 288-3877 Fax: 864 458-7519.Toll-Free: 800 535-2671Mktg Mgr Carmen Smothers





dmg world media (Canada) Inc.605-999 8th St SWCalgary AB T2R 1J5403 209-3562 Fax: 403 245-8649.Toll-Free: 888 799-2545 Ext. 562Toll-Free Fax: 866 245-8649

Doran ManufacturingPO Box 147Harlan IA 51537Location: 1230 870th St712 755-7980 Fax: 712 755-7877.Pres/Owner Randall Doran

Double T Equipment Manufacturing Ltd.PO Box 3637 Stn MainAirdrie AB T4B 2B8403 948-5618 Fax: 403 948-4780.Sls Rep Rey Rawlins

Drader Manufacturing Industries Ltd.5750 50 St NWEdmonton AB T6B 2Z8780 440-2231 Fax: 780 440-2244.Toll-Free: 800 661-4122Sls Mgr Bruce Lecky

Durabac Durapac22 Milton RdGranby QC J2G 8C8450 378-1723 Fax: 450 378-1720.Toll-Free: 800 565-1723Pres/Owner Patrick Charbonneau; Sls/Mktg Asst Brigitte Archambault

DuraTech IndustriesPO Box 1940Jamestown MD 58402-1940701 252-4601 Fax: 701 252-0502.VP-Sls Bob Strahm; Mktg Mgr Al Goehring

Dyna Pak112 Helton DrLawrenceburg TN 38464931 762-4016 Fax: 931 766-1514.VP-Sls Dale Miklich

EPG Companies Inc.19900 County Rd 81Maple Grove MN 55311763 424-2613 Fax: 763 493-4812.Toll-Free: 800 443-7426Pres John Hasslen

East Manufacturing Corporation1871 State Rte 44Randolph OH 44625330 325-9921 Fax: 330 325-7851.Toll-Free: 888 405-3278Dir-Sls Mark J Sabol

Eco Waste Solutions5195 Harvester RdUnit 14Burlington ON L7L 6E9905 634-7022 Fax: 905 634-0831.Toll-Free: 866 326-2876CEO Steve Meldrum

EcoLog Information Resources Group12 Concorde PlSuite 800

Continental Biomass Industries, Inc.22 Whittier StNewton NH 03858603 382-0556 Fax: 603 382-0557.Gen Sls Mgr Ed DonovanContinental Biomass Industries, Inc. manufactures a complete line of Grinders, Shredders and Chippers for the biomass recovery industries. Products include Grizzly Mill(r) wood waste hogs, Magnum Force(r) Horizontal Grinders and Chippers, Annihilator Shredders, Screeners, and Stump Shears. CBI also designs and builds complete stationary systems for processing and recycling C&D and MSW. These include combinations of primary shredders, screeners, conveyors, picking stations, magnetic separators, water tanks, secondary and tertiary grinders to assure specific product size.

Crane Equipment Mfg. Corp.33740 Seavey LoopEugene OR 97405541 746-9681 Fax: 541 746-8928.Mktg Mgr Carol Roberts

CRIQ8475 Christophe-ColumbMontreal QC H2M 2N9514 383-3254 Fax: 514 383-3221.Toll-Free: 800 667-4570Pres Georges Archambault

Database PublishingPO Box 378Campbellford ON K0L 1L0705 653-1112 Fax: 705 653-1113.Editor Mark Sabourin

Deister Electronics Inc.1099 Kingston RdSuite 212Pickering ON L1V 1B7905 837-5666 Fax: 905 837-0777.Gen Mgr Rikk Boldy

DEL Hydraulics, Inc.571 Howard StBuffalo NY 14206716 853-7996 Fax: 716 853-8003.Gen Mgr Mark Zawadzki

Dings Company4740 W Electric AveMilwaukee WI 53219414 672-7830 Fax: 414 672-5354.Sls Mgr Harold Bolstad

Discerning Systems Inc.105-8557 Government StBurnaby BC V3N 4S9604 298-3748 Fax: 604 298-3648.Toll-Free: 877 374-7744Pres Dave Patterson

Columbus McKinnon Corporation1920 Whitfield AveSarasota FL 34243941 755-2621 Fax: 941 753-2308.Toll-Free: 800 848-1071Sls Mgr Richard P Colyar

Commercial Metals Company6565 N. MacArthur BlvdSuite 800Irving TX 75039214 689-4300 Fax: 214 689-5886.Sr VP-Mktg Bob Melendi

Compostex Compost Covers245 Ten Stones CirCharlotte VT 05445802 425-5556Owner Steven Wisbaum

The Composting Council of Canada16 Northumberland StToronto ON M6H 1P7416 535-0240 Fax: 416 536-9892.Exec Dir Susan Antler

Computation Ltd.280 Jane StToronto ON M6S 3Z2416 629-5667

Conestoga-Rovers & Associates651 Colby DrWaterloo ON N2V 1C2514 884-0510 Fax: 519 884-0525.Toll-Free: 800 265-6102Bus Dev Mgr Bruce McConnellBranches:10551 Shellbridge WaySuite 121Richmond BC V6X 2W9604 2140510 Fax: 604 21405255920 1A St SWSuite 601Calgary AB T2H 0G3403 2712000 Fax: 403 2713013111 Brunel RdSuite 200Mississauga ON L4Z 1X3905 7120510 Fax: 905 71205154610 de la Cote-Vertu BlvdMontreal QC H4S 1C7514 3360510 Fax: 514 336943431 Gloster CrtDartmouth NS B3B 1X9902 4681248 Fax: 902 4682207CRA provides comprehensive engineering, environmental consulting, construction, and information technology (IT) services. CRA employs more than 2,900 people in 90 offices across North America, Argentina, Brazil and England. For over 30 years, CRA has provided clients with comprehensive services in the area of solid waste management. From initial facility siting/permitting, through to design, construction, operations, and closure, we have the expertise to assist. CRA is also active in greenhouse gas (GHG) reduction and carbon credits.

Casemaker Inc.33 Glen Cameron Rd, Unit 8Thornhill ON L3T 1N9905 889-5245 Fax: 905 889-4818.Pres Jack Pepall

Cassels Brock & Blackwell LLPScotia Plaza40 King St WSuite 2100Toronto ON M5H 3C2416 869-5300 Fax: 416 360-8877.Partner James Ayres

Caterpillar Inc.100 NE Adams StPeoria IL 61629-6335309 675-1000 Fax: 309 675-4757.Mktg Admin Sharon Holling

CBI Howe-Baker EngineersPO Box 956Tyler TX 75710903 510-5315 Fax: 903 581-6178.Mgr Curtis Nipp

Chenington Equipment Manufacturing & Sales Inc.6333 39 St SECalgary AB T2C 1N1403 329-1713 Fax: 403 329-1512.Pres Grant R Harrington

Chevy Lane Fabrications11100 Sodom RdNiagara Falls ON L2E 6S6905 295-7224 Fax: 905 295-8410.Owner Donna ChamberlainCustomized Public Place Recycling containers and solutions. Solutions for parks, arenas, city streets, shopping centres, schools, special events and more.

Clear Computing, Inc.106 Apple StSuite 302Tinton Falls NJ 07724732 747-0113 Fax: 732 741-3359.Toll-Free: 888 332-5327Dir-Mktg Walt Levine

The Clorox Company of Canada Ltd.150 Biscayne CresBrampton ON L6W 4V3416 570-4379 Fax: 905 454-6670.Env Consul Dave Douglas

Coastal BioAgresearch Ltd.268 Boutiliers Point RdBoutiliers Point NS B3Z 1V1902 826-2931Pres P R Warman

Columbia Industries, LLC5775 NW Wagon WayHillsboro OR 97124-8531503 531-0600 Fax: 503 531-0601.Mktg Mgr Jeff Van Raden





GTC Ventures Inc.PO Box 42033 RPOVictoria BC V8R 6T4Location: 2200 Oak Bay250 208-3402 Fax: 250 386-4656.

GEEP Ecosys Inc.1615 55e AvDorval QC H9P 2W3514 636-9625 Fax: 514 636-3131.Toll-Free: 888 326-7972VP-Bus Dev Bruce Hartley

Geosynthetica.net6072 N Ocean BlvdOcean Ridge FL 33435561 655-2060 Fax: 561 655-9922.Content Mgr Lara D Peggs

Glass Aggregate SystemsPO Box 464Faribault MN 55021Location: 1100 Cannon Circle507 334-6437 Fax: 507 334-6438.Pres Tom Kubes

Global Electric Electronic Processing (GEEP) Inc.220 John StBarrie ON L4N 2L2416 570-4379 Fax: 705 728-3788.Toll-Free: 866 288-8016VP Wallace MacKay

Global Sensor Systems Inc.400 Brunel RdMississauga ON L4Z 2C2905 507-0007 Fax: 905 507-4177.Gen Mgr Ray H Glenn

Golder Associates Ltd.2390 Argentia RdMississauga ON L5N 5Z7905 567-4444 Fax: 905 567-6561.Toll-Free: 800 414-8314Mktg Mgr Suzie Williams

Granutech-Saturn Systems Corporation201 E Shady Grove RdGrand Prairie TX 75050972 790-7800 Fax: 972 790-8733.Toll-Free: 877 582-7800

Great Lakes Mfg. Inc.8450 County RdSuring WI 54174920 842-2012 Fax: 920 842-2497.Toll-Free: 877 248-5677Pres Craig French

Green Lane Environmental Group LPPO Box 790 Stn LambethLondon ON N6P 1R7519 652-9284 Fax: 519 652-9447.Toll-Free: 800 265-6036Pres Bob McCaig

Groeneveld8450 Lawson RdUnit 5Milton ON L9T 0J8905 875-1017 Fax: 905 875-2125.Toll-Free: 800 263-1760Mktg Coord Beth Gorman

403 638-4410 Fax: 403 638-4413.Toll-Free: 877 534-7285Pres Arnie Gess

Fastco Equipment CorporationPO Box 161 Stn UEtobicoke ON M8Z 5P1905 562-1547 Fax: 905 562-1589.Toll-Free: 800 366-1325Pres Duane Fast

FCM’s Green Municipal Fund24 Clarence StOttawa ON K7N 5P3613 241-5221 Fax: 613 244-1515.Outreach/Promo Off Magali LeblancFCM’s Green Municipal Fund (GMF) offers a range of resources and ser-vices that specifically address the sustainable community development needs of municipal governments. The Fund provides financing and knowl-edge to support the development of communities that are more environ-mentally, socially and economically sustainable.

Fecon, Inc.3460 Grant DrLebanon OH 45036513 696-4430 Fax: 513 696-4431.Toll-Free: 800 528-3113Pres John G Heekin

The Fibrex Group, Inc.Building 24165 Pruden BlvdSuffolk VA 23434757 925-1375 Fax: 757 925-1372.Toll-Free: 800 346-4458Toll-Free Fax: 800 444-8380Pres Ruben Leenders

Flexco2525 Wisconsin AveDowners Grove IL 60515630 971-0150 Fax: 630 971-1180.Adv Jayne Dore

Fogmaster Corporation1051 SW 30th AveDeerfield Beach FL 33442954 481-9975 Fax: 954 480-8563.Pres Thomas Latta

Fort Garry Ind. Ltd.PO Box 1848 Stn MainSaskatoon SK S7K 3S2Location: 3445 Miners AveSaskatoon SK S7K 7K9306 242-3465 Fax: 306 933-4850.Toll-Free: 800 772-4599Reg Mgr Barry Burton

Future Steel Buildings1405 Denison StMarkham ON L3R 5V2905 477-1894 Fax: 905 477-0029.Toll-Free: 800 668-5111Toll-Free Fax: 877 474-4445VP-Mktg Sean Keenan

En-Pro International Inc.174 Simcoe St NOshawa ON L1G 4S9905 686-6400 Fax: 905 686-6439.Toll-Free: 800 686-6449Cost Analyst Douglas J Leary

Enterprise CodeWorks Inc.671H Market HillVancouver BC V5Z 4B5604 876-6642 Fax: 604 876-6623.Toll-Free: 877 644-8677Gen Mgr Norris Phillippe

Entsorga-Enteco/Cologne Intl. Trade Fairs1 Dundas St W, Suite 2500Toronto ON M5G 1Z3416 598-3343 Fax: 416 598-9185.Sls Mgr Canada Barbara Hills

Enviroplast Inc.11060 PkyAnjou QC H1J 1N5514 352-6060 Fax: 514 352-9177.Project Mgr Rejean Arsenault

EnviroSort Inc.4415-39139 Hwy 2ARed Deer County AB T4S 2A8403 342-7823 Fax: 403 343-6287.Facilities Mgr Tom Kereluk

Eriez Magnetics2200 Asbury RdErie PA 16506814 835-6000 Fax: 814 833-3348.Toll-Free: 888 800-3743Cdn Sls Mgr Darrell Milton

Eriez Magnetics2200 Asbury RdErie PA 16506814 835-6000 Fax: 814 838-4960.Toll-Free: 800 345-4946

Erin Recycling1 Premier AveRiviere-du-Loup QC G5R 6C1418 868-8324 Fax: 418 862-6642.Toll-Free: 800 267-7574Sls Mgr Howard Fiedler

Essex- Windsor Solid Waste Authority360 Fairview Ave WSuite 211Essex ON N8M 3G4519 776-6441 Fax: 519 776-6370.Gen Mgr Todd Pepper

Excel Machinery Ltd.PO Box 31118Amarillo TX 79120806 335-1553 Fax: 806 335-3949.Sls Mgr Matt Garth

Fairbanks Scales821 Locust StKansas City MO 64106816 471-0231 Fax: 816 471-5951.Pres/COO Rick Norden

Falcon Ridge Group Inc.PO Box 398Sundre AB T0M 1X0

Toronto ON M3C 4J2416 510-5197 Fax: 416 510-5133.Toll-Free: 888 702-1111Gen Mgr Carol Bell LeNoury

EcoLog Legislative Services12 Concorde PlSuite 800North York ON M3C 4J2416 442-5600 Ext. 3570 Fax: 416 510-5133.Toll-Free: 888 702-1111 Ext. 8Editor/Pub Lidia Lubka

EcoLog ERIS / Environmental Risk Information Services12 Concorde PlSuite 800Toronto ON M3C 4J2416 510-6821 Fax: 416 510-5133.Toll-Free: 877 512-5204Acct Mgr Joan HagermanWelcome to EcoLog ERIS – Canada’s primary environmental risk informa-tion service. As the leading provider of current and historical environmen-tal risk information for real estate, ERIS delivers accurate, affordable, on-demand research services for property related data and reference materials. The ERIS service saves property buy-ers and environmental professionals time and money by alerting them to possible risks associated with a site and the neighbouring area. Whether you are doing a Phase 1, Phase 2, a remediation assessment, financial perspective or legal due diligence, the ERIS service is an invaluable resource to assist you in assessing environmen-tal risk. Browse our site, learn about the different reports we offer, and discover how ERIS can serve you! The ERIS System electronically accesses over 422 federal, provincial, private sector databases containing over 3.4 million current and historical envi-ronment records to identify potential environmental threats on Canadian properties.

EcoLog News12 Concorde PlSuite 800North York ON M3C 4J2416 442-5600 Ext. 3597 Fax: 416 510-5133.Editor Jennifer Holloway

Ecotainer Recycling Equipment2253 Harbourgreene DrSurrey BC V4A 5J3604 535-7293 Fax: 604 535-7967.Toll-Free: 800 561-6525Sls Mgr Tom Button

EMF CONTAINERS250 Queen’s Quay WSuite 407Toronto ON M5J 2N2416 804-9636 Fax: 416 591-6594.Contact Timothy England





905 835-1203 Fax: 905 835-6824.Toll-Free: 888 937-3382VP Richard Unyi

IPS Balers, Inc.PO Box 414Baxley GA 31513800 280-2313 Fax: 912 366-9460.Dir Reg Sls Ken Korney

J & M Tire International Inc.717 Drake StOshawa ON L1H 7R3905 723-3323 Fax: 905 721-9540.Toll-Free: 800 263-7823Pres Jim Michaud

J.F. Comer Inc.141 Reach StUnit 4Uxbridge ON L9P 1L3905 852-3370 Fax: 905 852-6557.

J. McGale Industries Inc. - Clarion Surround Sight & Sentinel Rearvision4242 Hartfield GroveSuite 101Mississauga ON L4W 4G9905 625-8375 Fax: 905 625-3356.Pres James McGale

J&J Truck Bodies & Trailers10558 Somerset PikeSomerset PA 15501800 777-2671 Fax: 814 443-2621.VP Jerry Johnson

Jacques Whitford7271 Warden AveMarkham ON L3R 5X5905 474-7700 Fax: 905 479-9326.Contact Didier Lapointe

Joe Johnson Equipment Inc.2521 Bowman StInnisfil ON L9S 3V6705 733-7700 Fax: 705 733-8800.Toll-Free: 800 263-1262Pres Joe Johnson Jr

K.R. Komarek, Inc.1825 Estes AveElk Grove Village IL 60007847 956-0060 Fax: 847 956-0157.Pres Richard K Komarek

Keith Manufacturing Co.PO Box 1Madras OR 97741Location: 401 NW Adler541 475-3802 Fax: 541 475-2169.Toll-Free: 800 547-6161Dir-Ops/Sls/Serv David Schertzberg

Kernic Systems, Inc.5230 South Service RdBurlington ON L7L 5K2905 632-0562 Fax: 905 632-0027.

Berlin CT 06037860 828-0541 Fax: 860 829-1313.VP-Sls/Mktg Jack Bowne

Hotz Environmental Services Inc.239 Lottridge StHamilton ON L8L 6W1905 545-2665 Fax: 905 545-7822.Toll-Free: 888 333-4680VP-Bus Dev Pamela McAuley

HQN Industrial Fabrics760 Chester StSarnia ON N7S 5N1519 344-9050 Fax: 519 344-5511.Toll-Free: 800 361-7068VP Mike Nottley

Hydraline Saniquip1 Daybar AveUnit 2Toronto ON M9W 3N8416 248-6141 Fax: 416 248-5158.Pres Doug Calder

I-CORP INTERNATIONAL, Inc.6072 N Ocean BlvdOcean Ridge FL 33435561 369-0795 Fax: 561 369-0895.Pres Ian D Peggs

IPL Inc.140 Commerciale StSt-Damien-de-Buckl QC G0R 2Y0418 789-3651 Ext. 559 Fax: 418 789-3388.Toll-Free: 800 463-0270 Ext. 559Acct Mgr W Cda/USA Elizabeth Bernier; Dir-Recycling & Waste handling Paul M Palazzo

Indaco Manufacturing Ltd.813 Brock RdUnit 11Pickering ON L1W 3L8905 839-0422 Fax: 416 839-0200.Toll-Free: 800 433-7334Pres Peter Wehrle

Industrial Magnetics Inc.1385 M-75 SBoyne City MI 49712231 582-3100 Fax: 231 582-0622.Toll-Free: 800 662-4638Product Spec Rob Hutchison

Intec Video Systems, Inc.23301 Vista GrandeLaguna Hills CA 92653949 859-3800 Fax: 949 859-3178.Toll-Free: 800 468-3222

International Bio Recovery Corp.52 Riverside DrNorth Vancouver BC V7H 1T4604 924-1023 Fax: 604 924-1043.Pres/CEO Henry J Bow

International Marine Salvage IncPO Box 6Port Colborne ON L3K 5V7Location: 17 Invertose Dr

Harvey EnterprisePO Box 23132 RPO MissionCalgary AB T2S 3B1403 660-4518 Fax: 403 244-9964.Mgr Dennis Brucker

Haul-All Equipment Ltd.4115 18 Ave NLethbridge AB T1H 5G1403 328-7719 Fax: 403 328-9956.Toll-Free: 888 428-5255Pres Dennis Neufeldt; Mktg/Sls Twyla Gurr

Haycore Canada Inc.3144 Gregoire StRussell ON K4R 1E5613 445-3610 Fax: 613 445-0247.Coord-Sup Chain Nathalie Gareau

Heil Environmental5751 Cornelison RdChattanooga TN 37411 Fax: 423 855-3478.Toll-Free: 866 367-4345Sls/Ops Mgr Jason Coleman

Hercules Bulldog Sealing Products Canada30 Saunders RdBarrie ON L4N 9A8705 739-6735 Fax: 705 739-6731.Toll-Free: 800 665-7325Toll-Free Fax: 800 565-6990Gen Mgr Russ Petrie

High Strength Plates & Profiles Inc.7464 Tranmere DrMississauga ON L5S 1K4905 673-5770 Fax: 905 673-1139.Toll-Free: 800 387-4981Inside Sls Rep Norm Banton

HJA InternationalPO Box 658Orchard Park NY 14127-0658Location: 88 Beacon StBuffalo NY 14220716 332-7061 Fax: 716 332-6059.Toll-Free: 800 836-2253Pres Peter Hurd

HLS Ecolo59 Penn DrToronto ON M9L 2A6416 740-3900 Fax: 416 740-3800.Toll-Free: 800 667-6355Pres/COO Paul Chappel

HogZilla-CW Mill Equipment Co., Inc.14 Commerce DrSabetha KS 66534785 284-3454 Fax: 785 284-3601.Toll-Free: 800 743-3491Sls Mgr Tim Wenger

Holly Services3 Hillside DrTillsonburg ON N4G 2E4519 842-9455 Fax: 519 842-5046.Pres Michael Holly

Hosokawa Polymer Systems63 Fuller Way

The Groundworx Co.1316 77 AveEdmonton AB T6P 1M2780 463-7077 Fax: 780 463-7040.Toll-Free: 888 222-2670Contact Grant KergenThe Groundworx Co is the Canadian dealer for Hammel shredders. These machines will shred C+D, wood, con-crete, metal & municipal solid waste. An onboard belt magnet reclaims metal from material. The Hammel shredder will reduce volume by 65%+, cutting handling, trucking and disposal costs. They come diesel/electric and track or stationary.

GSI Environnement inc.1501 boul Lionel-BouletVarennes QC J3X 1P7450 929-4949 Fax: 450 929-1659.Dir-Bus Dev Simon Naylor

HCL Machine Works15142 Merrill AveDos Palos CA 93620209 392-6103 Fax: 209 392-3000.Head-Sls Casey Campbell

Hale Trailer Brake & WheelPO Box 1400Voorhees NJ 08043856 768-1330 Fax: 856 768-7671.Toll-Free: 800 232-6535Toll-Free Fax: 856 768-7671Pres Barry Hale

HALLCO Industries, Inc.PO Box 505Tillamook OR 97141Location: 1600 Hallstrom Rd503 842-8746 Fax: 503 842-4866.Toll-Free: 888 412-5092Sls Mgr Charles Russell

Harmony Enterprises, Inc.704 Main Ave NHarmony MN 55939507 886-6666 Fax: 507 886-6706.VP-Sls/Mktg Chris Cremer

Harper Power Products Inc.10 Diesel DrToronto ON M8W 2T8416 259-3281 Fax: 416 259-4438.Toll-Free: 800 642-7737Allison Transmission Sls Rep Tina Caldwell; Mktg Commun Coord Scott Hosmer

Harris200 Clover Reach DrPeachtree City GA 30269770 631-7290 Fax: 770 631-7299.Toll-Free: 800 373-9131VP-Sls Bob Pfeffer





Manac6975 Kenderry GateMississauga ON L5T 2Y1905 696-9789 Fax: 905 678-2496.Toll-Free: 800 956-2622VP-Sls Roger Gendron; Gen Sls Mgr Tom Ramsden

Marathon Equipment Company/NEXGEN Baling SystemsPO Box 1798Vernon AL 35592 Fax: 205 695-8813.Toll-Free: 800 269-7237Sls Rep Renee Boman

Marathon Equipment / NEXGEN Baling SystemsPO Box 1798Vernon AL 35592800 269-7237 Fax: 205 695-8813.Mat Coord Stacy Clark

Marcel Equipment Limited1000 Progress DrLondon ON N6N 1B8519 686-1123 Fax: 519 686-9350.Toll-Free: 800 265-5747Sls Mgr John Stewart

Marketing Strategies & Solutions433 William StLondon ON N6B 3E1519 432-8327 Fax: 519 642-3372.Pres Robert B Adeland

Marrel Corp.3565 17 Mile Rd.Cedar Springs MI 49319616 696-1372 Fax: 616 696-4075.Toll-Free: 866 822-3580Mgr Andy Jansma

Maxon Industries Inc.3204 W Mill RdMilwaukee WI 53209414 351-4000 Fax: 414 351-9057.Pres William Maxon

McCarthy TetraultPO Box 48Toronto ON M5K 1E6Location: Toronto Dominion Bank TowerSuite 5300416 601-7512 Fax: 416 868-0673.Partner Doug Thomson

McCloskey International Ltd.1 McCloskey Rd, RR 7Peterborough ON K9J 6X8705 295-4925 Fax: 705 295-4777.Toll-Free: 877 876-6635Sls Don Smith

McClure Industries Inc.9051 SE 55 AvePortland OR 97206503 777-2821 Fax: 503 775-2828.Toll-Free: 800 752-2821Dir-Sls Thomas B MacLaren

McLanahan CorporationPO Box 229Holidaysburg PA 16648-0229

Madvac Inc.1690 rue EiffelBoucherville QC J4B 7W1450 616-8100 Fax: 450 616-8103.Toll-Free: 800 862-3822Dir-Mktg Andre Pollmueller

Machinex Industries Inc.2121 Olivier StPlessisville QC G6L 3G9819 362-3281 Fax: 819 362-2280.Toll-Free: 877 362-3281VP-Sls/Mktg Gaetan BolducBranches:Machinex Recycling Services817 Brock Rd, Unit 11Pickering ON L1W 3L9800 463-4298 Fax: 905 420-0319E-mail: [email protected]. Web: www.machinexrt.caSls Kathlyn SchoonMachinex offers complete engineer-ing design, fabrication and installa-tion of Material Recycling Facilities and Municipal Solid Waste equipment. Machinex provides turnkey proj-ect for the recycling industry: single stream, Construction & Demolition, front-end processing and waste han-dling. We specialize with conveyors. OCC Screens, Separators, Optical Sorter, Trommels and quality periph-eral equipment, for a complete system integration.

Machinex Recycling Services817 Brock Rd, Unit 11Pickering ON L1W 3L9905 420-0466 Fax: 905 420-0319.Toll-Free: 800 463-4298Sls Kathlyn SchoonBranches:12345 104 Ave, Unit CSurrey BC V3V 3H2225A Range RdCalgary AB T2P 2G6Machinex Technolgoies Inc.8770 W Bryn Mawr AveChicago IL 60631Machinex designs, fabricates and installs equipment for MRF and MSW, provides turnkey projects for the recy-cling industry: single stream, front-end processing, waste handling and C & D. Machinex maintains solid client rela-tions by stocking a large inventory of parts as well as providing a dedicated service department working on call 24 hours a day.

Magnetics Division, Global EquipmentPO Box 810483Boca Raton FL 33481-0483561 750-8662 Fax: 561 750-9507.Toll-Free: 866 750-8662Pres Marshall Gralnick

Mailhot Industries3330 boul des EnterprisesTerrebonne QC J6X 4J8450 477-6222 Fax: 450 477-0002.Toll-Free: 800 563-3663

8044.Toll-Free: 800 588-9223VP Construction Sean Simonpietri

Laurin Inc.240 MacDonald BlvdAlexandria ON K0C 1A0613 525-1627 Fax: 613 525-4385.Sls Rep Jay Arkison

Laurin Inc.487 rue PrincipaleLaval QC H7X 1C4450 689-1962 Fax: 450 689-2527.Sls Rep Jay Arkison

Layfield Geosynthetics & Industrial Fabrics Ltd.20 Staffern DrUnit 9Vaughan ON L4K 2Z7905 761-9123 Fax: 905 761-0035.Bus Dev Mgr Rene Laprade

Leak Location Services, Inc.16124 University OakSan Antonio TX 78249-4015210 408-1241 Fax: 210 408-1242.Pres Daren Laine

Liebherr-Canada Ltd.1015 Sutton DrBurlington ON L7L 5X8905 319-9222 Fax: 905 319-6622.Toll-Free: 800 387-3922Sls Mgr Rick Koen

Logemann Brothers Company3150 W Burleigh StMilwaukee WI 53210414 445-3005 Fax: 414 445-1460.Sls Mgr Robert T Plichta

Loraday Environmental Products40 Bell Farm RdUnit 2Barrie ON L4M 5G6705 733-3342 Fax: 705 733-3352.Toll-Free: 888 853-6600Pres Peter Lorimer

Lubo USA31 Wellington StOrangeville ON L9W 2L6519 940-4510 Fax: 519 940-9853.

M-E-C Company1400 W Main StNeodesha KS 66757-1679620 325-2673 Fax: 620 325-2678.Pres David M Parker

MSS Inc.3738 Keystone AveNashville TN 37211615 781-2669 Fax: 615 781-2923.Dir-Sls Felix Hottenstein

MWE Belting Company Ltd.3300 Mainway DrBurlington ON L7M 1A7905 336-7848 Fax: 905 336-7832.Toll-Free: 800 263-4261Pres Chris Elgar

Toll-Free: 800 678-9516Pres R Derek Simons

KNL Holdings, LLCPO Box 760Paragould AR 72451Location: 603 N 3rd Ave870 236-7753 Fax: 870 239-2130.Pres Fred Workman

Kubota Canada Ltd.5900 14th AveMarkham ON L3S 4K4905 294-7477 Fax: 905 472-6143.Mktg Spec Ray St AntoineThe leader in compact construction equipment in anada, Kubota Canada offers three number one selling wheel loaders under 60 hp. The R320, R420, and R520 models are 4-wheel drive and feature fully articulated steering, load-sensing transmissions, hydraulic shuttle shift, and deluxe suspension seat. With Kubota’s legendary clean, efficient diesel engines, these machines are an unbeat-able investment for your business.

La Bounty1538 Hwy 2Two Harbors MN 55616218 834-2123 Fax: 218 834-3879.Global Dir-Mktg Kelly Steck

Labrie Environmental Group175 rte du PontSaint-Nicolas QC G7A 2T3418 831-8250 Fax: 418 831-5255.Toll-Free: 800 463-6638Pres Claude Boivin

Lafleche Environmental Inc.17125 Lafleche RdMoose Creek ON K0C 1W0613 538-2776 Fax: 613 538-2779.Sls/Bus Dev Mgr Geoffroy LaflecheLafleche Environmental Inc. (LEI) is a privately held company committed to the protection of the environment to ensure we leave a legacy that we will be proud of for future genera-tions. LEI’s waste management facil-ity is located in Moose Creek serving Eastern Ontario. Presently LEI provides a Bio-reactor landfill for non-hazard-ous waste soil recycling for hydro-carbon-impacted soils, tire collection and recycling, waste water treatment, electronics waste and organics com-posting.

Landsaver Environmental2831 Cardwell RdRichmond VA 23234 Fax: 804 271-




http://www.machinexrt.ca



Pacific Metals Recycling International8360 Ontario StVancouver BC V5X 3E5604 327-1148 Fax: 604 327-3614.Pres/Gen Mgr Mark Lotzkar

Palfinger North AmericaPO Box 846Niagara Falls ON L2E 6V6Location: 7942 Dorchester Rd905 374-3363 Fax: 905 374-1203.Toll-Free: 800 567-1554Inside Sales Mgr Chris Thorne

Paradigm Software, L.L.C.10944 Beaver Dam RdSuite CHunt Valley MD 21030-2255410 329-1300 Fax: 410 329-1885.VP Jackie W Barlow II

Pendpac Inc.1700 N Main StFairview OK 73737602 476-2777 Fax: 580 227-3829.COO Robert Gnatovich

The Penwortham Group1173 Queen Victoria AveMississauga ON L5H 3H2705 891-2514 Fax: 705 891-3239.Man Dir Keith Davey

Perkins Manufacturing Co.737 Oakridge DrRomeoville IL 60446708 482-9500 Fax: 708 354-5878.Toll-Free: 800 882-5292Sr VP/COO Robert Mecchi

Peterson Pacific Corp.PO Box 40490Eugene OR 97404541 689-6520 Fax: 541 689-0804.Toll-Free: 800 269-6520VP-Sls/Mktg Michael Kvach; Mktg Mgr Dave BentonPeterson began producing specialized debarking and delimbing machines for the pulpwood market over twenty years ago. This was followed by the first full tree processor capable of pro-ducing high quality clean pulp chips. Later Peterson introduced a line of horizontal waste wood grinders to turn low value resources and waste prod-ucts into higheer value products. Most recently, Peterson has added a line of blower trucks to serve the landscaping and erosion control markets. Peterson machines are operating in over 20 countries in the world. For more details see www.petersoncorp.com.

Pollutec c/o Promosalons Canada20 Queen St W, Suite 2004Toronto ON M5H 3R3

416 489-8438 Fax: 416 489-4168.Pres Lars Henriksson

Norseman Plastics Ltd.39 Westmore DrRexdale ON M9V 3Y6416 745-6980 Fax: 905 450-2009.Toll-Free: 800 894-8397Gen Mgr Envr Prods Div Doug Hill

North American Green14649 Hwy 41 NEvansville IN 47725 Fax: 812 867-0247.Toll-Free: 800 772-2040Pres Tim Lancaster

Northern Cast Parts Comapny Inc.2185 Marine DrSuite 304Oakville ON L6L 5L6905 465-1773 Fax: 905 465-1775.Pres Peter Salmon

OCETA2070 Hadwen RdUnit 201AMississauga ON L5K 2C9905 822-4133 Ext. 232 Fax: 905 822-3558.Pres/CEO Kevin Jones

Odor Control Company, Inc.PO Box 14363Scottsdale AZ 85267480 488-2126 Fax: 480 488-9439.Toll-Free: 888 948-3956Toll-Free Fax: 877 948-1010Contact Michelle Lang

Ohio Magnetics, Inc.- Div. Stearns5400 Dunham RdMaple Heights OH 44137216 662-8484 Fax: 216 662-9526.Toll-Free: 800 486-6446Sls Mgr Ken Richendollar

Ohio / Stearns Magnetics, Inc.5400 Dunham RdMaple Hts OH 44137-3687216 662-8484 Fax: 216 662-9526.Toll-Free: 800 486-6446Gen Mgr John Wohlgemuth

Oliver Manufacturing Co. Inc.PO Box 512Rocky Ford CO 81067719 254-7813 Fax: 719 254-6371.Pres Brian Burney

OMI Industries18-6 E Dundee RdSuite 101Barrington IL 60010847 304-9111 Fax: 847 304-0989.Toll-Free: 800 662-6367Natl Sls Dir Thomas O Minett

Ontario Autocar Inc.4320 Harvester RdBurlington ON L7L 5S4905 333-0779 Fax: 905 632-4557.Toll-Free: 888 820-7335New Truck Sls Mgr John Murphy

Markham ON L3R 0C9905 415-6707 Fax: 905 415-6777.Assoc Counsel Rod McLeod

MMM Group Limited100 Commerce Valley Dr WThornhill ON L3T 0A1905 882-1100 Fax: 905 882-0055.Pres/CEO Bruce Bodden; Mktg Coord Emma Joslin

Molok North America Ltd.PO Box 693Mount Forest ON N0G 2L0Location: 179 Norpark AveUnit 19-21519 323-9909 Fax: 519 323-9910.Toll-Free: 877 558-5576Gen Mgr Mark Hillis

Multi Bag6525 boul Decariebureau 302Montreal QC H3W 3E3514 738-3961 Fax: 514 738-3676.Toll-Free: 888 862-0500Sls Mgr Renee Cohen

Multitek North America, LLCPO Box 170Prentice WI 54556-0170Location: 700 Main St715 428-2000 Fax: 715 428-2700.Toll-Free: 800 243-5438VP-Sls/Mktg Howard Heikkinen

Munich International Trade Fairs Canada (IFAT)2842 Bloor St WEtobicoke ON M8X 1B1416 237-9939 Fax: 416 237-9920.Pres/Owner Brigitte Mertens

Municipal Waste Integration NetworkPO Box 1116Ayr ON N0B 1E0Location: 704 Glen Morris Rd W519 620-9654 Fax: 519 620-9678.Exec Dir Maryanne E Hill

National Recovery Technologies, Inc.566 Mainstream DrNashville TN 37228615 734-6400 Fax: 615 734-6410.Toll-Free: 800 467-4678Application Eng/Sales John Thomsen

New Waste Concepts26624 Glenwood RdPerrysburg OH 43551419 872-2190 Fax: 419 872-2602.CEO Milton F Knight

Nilex Inc.9304 39 Ave NWEdmonton AB T6E 6L8780 463-9535 Fax: 780 463-1773.Toll-Free: 800 667-4811Toll-Free Fax: 866 645-3922Bus Dev Mgr Brian Williams

Norditrade Inc.132 Banff RdToronto ON M4P 2P5

Location: 200 Wall StHollidaysburg PA 16648-1637814 695-9807 Fax: 814 695-6684.Gen Mgr Mineral Div Bruce Daskivich; Reg Sls Mgr Claire Hayek

Mercer Motor WorksMercer MN 04957207 587-4534 Fax: 207 587-4534.Pres Terry Pitcher

Metech International150 Blackstone River RdSuite MWorcester MA 01607-1455508 795-1950 Fax: 508 459-5266.Toll-Free: 888 638-2761VP-Ops John Silvestri

Metro Compactor40 Bethride RdEtobicoke ON M9W 1N1416 743-8484 Fax: 416 740-8687.Toll-Free: 888 968-7491Sls Mgr Doug King

Metro Compactor WestBldg F2350 Beta AveBurnaby BC V5C 5M6604 291-8485 Fax: 604 291-8425.Toll-Free: 888 968-7491Ops Mgr Jean Mercure

Metro Waste Paper Recovery Inc.66 Shorncliffe RdToronto ON M8Z 5K1416 231-2525 Fax: 416 232-8820.Toll-Free: 877 226-6608

Metso Minerals Canada Inc.644 Imperial Rd NGuelph ON N1H 7M3519 821-7070 Fax: 519 821-4376.Prod Sales Mgr Steve Craig

METTLER TOLEDO Canada2915 Argentia RdUnit 6Mississauga ON L5N 8G6Toll-Free: 800 523-5123 Robert Van Duynhoven

MGM Brakes85 Wyman CresBradford ON L3Z 3J7416 904-8948 Fax: 905 775-4799.Cdn Sls Mgr Rick Deane

Mid City Group Inc.28 River RdWinnipeg MB R2M 3Y9204 977-1703 Fax: 204 977-1704.Pres Neil Oosterveen

Midpoint International Inc.189 Earl Stewart Dr, Unit 1Aurora ON L4G 6V5905 726-9658 Fax: 905 726-9659.Toll-Free: 888 646-4246Toll-Free Fax: 888 547-5411Pres Bruce Buchan

Miller Thomson LLP60 Columbia WaySuite 600



http://www.petersoncorp.com



Rotochopper, Inc.PO Box 295St. Martin MN 56376Location: 217 West St320 548-3586 Fax: 320 548-3372.Sls/Mktg Mgr Monte D HightRotochopper manufacturers a complete line of horizontal wood waste grind-ers, asphalt shingle grinders, wood chip processors, and mobile bagging systems. Offering 10 models that can simultaneously grind and colour wood waste, Rotochoper is known for its commitment to “Perfect In One Pass” finished product quality, allowing operators to produce high value bio-mass fuels, coloured mulch, RDF, and other end products in a single process. Rotochopper specializes in innovative equipment solutions, like the RG-1, the world’s only purpose-built asphalt shin-gle grinder, and the Go-Bagger 250, the only fully mobile, self-contained bagging plant on the market.

Rusmar Incorporated216 Garfield AveWest Chester PA 19380610 436-4314 Fax: 610 436-8436.Toll-Free: 800 733-3626Sls/Mktg Mgr Rebekah Gormish

RWDI AIR Inc.650 Woodlawn Rd WGuelph ON N1K 1B8519 823-1311 Fax: 519 823-1316.Pres Michael J Soligo

S.E.L Recycling Services Inc.PO Box 36Elmira ON N3B 2Z5 Fax: 519 669-5710.Toll-Free: 800 275-3339Pres Steven Sittler

S.E.S. Inc.1400 Powis RdWest Chicago IL 60185630 231-4840 Fax: 630 231-4945.Pres Stephen Martines

Samuel Strapping Systems737 Oval Crt, Floor 2Burlington ON L7L 6A9800 607-8727 Fax: 905 635-3173.Mktg/Product Mgr Adrian DemkiwSamuel Strapping Systems is a leading solutions provider within the packag-ing and waste management industry offering a comprehensive arrangement of vertical balers, compactors and bal-ing wire, not to mention several state of the art manufacturing facilities for equipment, steel and plastic strapping along with supplementary products for load securement for safe transporta-tion of product. Find out why Samuel Strapping Systems is your choice!.

703 421-9778 Fax: 703 421-1967.Toll-Free: 888 374-3366Pres Mark Farkhan

RIN Enterprises Ltd32 Jaffa DrBrampton ON L6S 4C5905 790-3266 Fax: 905 790-3268.Pres/CCO Asgar Ali Khatau

R.J. Burnside & Associates Limited15 TownlineOrangeville ON L9W 3R4519 941-5331 Fax: 519 941-8120.Mktg Mgr Sue Pennant

Robotronics1610 W 1600 SSpringville UT 84663801 489-4466 Fax: 801 489-8241.Dir-Sls/Mktg Paul Schwen

Roll-Rite, LLC2574 School RdAlger MI 48610989 345-3434 Fax: 989 345-7805.Toll-Free: 800 297-9905Natl Sls Mgr-Solid Waste/Recycling Erl Henry

Rothsay - Maple Leaf Foods Inc.PO Box 8270Dundas ON L9H 5G1905 628-2258 Fax: 905 628-8577.Toll-Free: 800 263-0302Raw Material Mgr Kevin DeBruyn

Rotobale Compaction Solutions Inc.PO Box 100Kenilworth ON N0G 2E0Location: 7232 Arthur Side Rd 5 W519 323-3673 Fax: 519 323-3816.Gen Mgr Steve Sequeira

Rotobec Inc.200 rue IndustrielleSte-Justine QC G0R 1Y0418 383-3002 Fax: 418 383-5334.Mktg Mgr Mark ShuklaRotobec manufactures extensive lines of hydraulic attachments for knuckle-boom loaders, excavators and material handlers. Our lines include solid waste grapples, orange peel, heavy-duty clam shell buckets, multi-purpose grapples, etc. Continuous rotation hydraulic attachments are Rotobec’s specialty. Rotobec also manufactures 3 models of Knuckleboom Loaders for truck self-loading. Its model 60 is a White Goods collection loader. The Elite XT is a heavy-duty A-Frame for storm clean-up. The 120 model is an extreme duty unit. The last two are also offered in stationary electric for transfer stations.

416 535-9210 Fax: 416 536-9892.Coord Susan Antler

Reaction Distributing44 Spiers CresAjax ON L1S 6Y7905 426-6442 Fax: 905 426-5925.Pres Larry Vine

Recycling Council of AlbertaPO Box 23Bluffton AB T0C 0M0403 843-6563 Fax: 403 843-4156.Exec Dir Christina Seidel

Recycling Council of BC10-119 Pender St WVancouver BC V6B 1S5604 683-6009 Fax: 604 683-7255.Exec Dir Brock Macdonald

Recycling Equipment Company of Canada Inc.100 Frobisher DrUnit 2Waterloo ON N2V 2A1519 746-0990 Fax: 519 746-8122.Owner Gary Barlow

Recycling Equipment Manufacturing, Inc.6512 N NapaSpokane WA 99217509 487-6966 Fax: 509 483-5259.VP-Sls/Eng Mike Farley

Reef Industries Inc.PO Box 750250Houston TX 77275713 507-4251 Fax: 713 507-4295.Toll-Free: 800 231-6074Sls Mgr Mike McElhany

Reotemp Instruments Corp.10656 Roselle StSan Diego CA 92121858 784-0710 Fax: 858 784-0720.Toll-Free: 800 648-7737Compost Product Mgr Nathan O’Connor

RESEAU environnement911 rue Jean-Talon ESuite 220Montreal QC H2R 1V5514 270-7110 Fax: 514 270-7154.Dir Josee Methot; Sls Rep Exhibit/Sponsorship Lyne Dubois

Resource Recovery Systems International, Inc. - KW Composters511 Pawnee DrSterling CO 80751970 522-0663 Fax: 970 522-3387.Pres Les Kuhlman

Ride-On Tire Protection System (TPS)45681 Oakbrook CrtSuite 102Sterling VA 20166-9215

416 929-2562 Fax: 416 929-2564.Toll-Free: 800 565-5443Mgr Anita Whyte

Polymer Recovery Systems, Inc.945 Short StEau Claire WI 54701715 835-3233 Fax: 715 833-2464.Pres John Ayres

Polytuf Brands, Inc. formely EPAC, Inc.PO Box 3079Cuyahoga Falls OH 44223330 773-0184 Ext. 423 Fax: 330 773-0390.Toll-Free: 888 765-9883 Ext. 423Prod Mgr Trish Righetti

Precision Husky CorporationPO Box Drawer 507Leeds AL 35094-0507205 640-5181 Fax: 205 640-1147.Pres Scott Smith

Precision Machinery Systems, Inc.633 Hay StYork PA 17403717 846-6800 Fax: 717 843-0529.Pres Barry Bosies

Premier Truck Sales, Inc.5800 W Canal RdValley View OH 44125 Fax: 216 901-8006.Toll-Free: 800 825-1255Mgr Victoria Lojek

QEL (Quatrosense Environmental Ltd.)PO Box 749Ottawa ON K0A 2Z0Location: 5935 Ottawa St613 838-4005 Fax: 613 838-4018.Cust Serv Mgr Simon Warland

Quadco Equipment951 Great StPrince George BC V2N 5R7250 563-8899 Fax: 250 563-6704.Toll-Free: 877 563-8899 Kevin Hodgins

R.A.R.E. Recyclage Alexandria Recycling265 Industrial BlvdAlexandria ON K0C 1A0613 525-5112 Fax: 613 525-5114.Mgr Rene Jeaurond

RDC Group1709 Hwy 7Brougham ON L0H 1A0905 427-0009 Fax: 905 428-8074.Pres Jack McGinnis

RGF Environmental Group, Inc.3875 Fiscal CrtWest Palm Beach FL 33404561 848-1826 Fax: 561 848-9454.VP Walter Ellis; Indus Sls Mgr William Svec

RBRC (Canada)16 Northumberland StToronto ON M6H 1P7





Steinert US, LLC13130 56th Court, Suite 605Clearwater FL 33760727 573-2482 Fax: 727 573-2527.Contact Dennis Ciccotelli

Stellar Industries Inc.PO Box 169Garner IA 50438Location: 190 State St641 923-3741 Fax: 641 923-2812.Toll-Free: 800 321-3741Sls Rep Keith Formanek

Summit Equipment, Inc.PO Box 1847Post Falls ID 83877-1847208 773-3885 Fax: 208 773-3799.Pres/Gen Mgr Skip Hissong

Superior Tire & Rubber Corp.PO Box 308Warren PA 16365814 723-2370 Fax: 814 726-0740.Toll-Free: 800 289-1456Prod Line Mgr Scott Holcomb

Supreme International Limited6010 47 StWetaskiwin AB T9A 2R3780 352-6061 Fax: 780 352-6056.Toll-Free: 800 563-2038Dir-Prod Support Joel Huberdeau

T&T Technology464 Wells St NChicago IL 60610312 266-7414Mktg Dev Mgr Suzy Hill

Tee Mark Corporation1132 Air Park DrAitkin MN 56431218 927-2200 Fax: 218 927-2333.Toll-Free: 800 428-9900Sls/Mktg Mgr Denny Rach

Temperature Corporation111 Esna Park DrUnit 7Markham ON L3R 1H2905 513-8310 Fax: 905 513-8358.Pres Roger Lamber

Tex-Net Inc.PO Box 127Roebling NJ 08554609 499-4545 Fax: 609 499-8227.Toll-Free: 800 541-1123Pres John Scarperia

Thunderbird Plastics Ltd.6969 Shirley AveBurnaby BC V5J 4R4604 433-5624 Fax: 604 433-6231.Pres Giuseppe Nucera

Titan Industries Inc.735 Industrial Loop Rd.New London WI 54961920 982-6600 Fax: 920 982-7750.Toll-Free: 800 558-3616Pres Dan Baumbach

Solid Waste Equipment Co., Inc.7630 L StOmaha NE 68127402 592-4200 Fax: 402 592-7492.Toll-Free: 800 701-7079Treas Amy Vance

Solmax International Inc.2801 Marie-Victorin BlvdVarennes QC J3X 1P7450 929-1234 Fax: 450 929-2547.Toll-Free: 800 571-3904Natl Sls Mgr Paul Payeur

Soudure J.M. Chantal Inc.1000 rue IndustrielleSaint-Agapit QC G0S 1Z0418 888-3444 Fax: 418 888-3950.Toll-Free: 866 881-3444Sls Mgr Jean St-Pierre

SP Industries Inc.2982 Jefferson RdHopkins MI 49328269 793-3232 Fax: 269 793-7451.Toll-Free: 800 592-5959Sls Mgr Gene Koelsch

Spectrum Technologies Inc.12360 South Industrial Dr EPlainfield IL 60585815 436-4440 Fax: 815 436-4460.Toll-Free: 800 248-8873Pres Mike Thurow; Mktg Mgr Rebecca Fry

SSI Schaefer Systems International140 Nugget CrtBrampton ON L6T 5H6905 458-5399 Fax: 905 458-7951.Toll-Free: 800 565-2409Mgr/Dir Cust Serv Maria Frizzell

SSI Shredding Systems9760 SW Freeman DrWilsonville OR 97070503 682-3633 Fax: 503 682-1704.Tech Sls David Wilson

STANMECH Technologies Inc.944 Zelco DrBurlington ON L7L 4Y3905 631-6161 Fax: 905 631-1852.Toll-Free: 888 438-6324Toll-Free Fax: 888 329-6324Pres Paul W SubjectBranches:Les Technologies STANMECH Inc.2187 rue des SarcellesVaudreuil-Dorion QC J7V 9N9450 455-1614STANMECH Technologies Inc. special-izes in the development of plastics joining, fabricating and forming solu-tions. We have particular expertise in providing wedge welding and extru-sion technology geomembrane appli-cations. We offer products including Extrusion Welders; Wedge Welders, Hot Air Tools & Tensile Testers; and we combine these various technologies to provide customized solutions for specific applications challenges.

Mississauga ON L5K 1Z8905 403-2020 Fax: 905 403-2022.Toll-Free: 800 478-9511Mktg Comm Mgr Lana Smith

Sherbrooke O.E.M Ltd.262 rue PepinSherbrooke QC J1L 2V8819 563-7374 Fax: 819 563-7556.Pres Alain Brasseur; Project Mgr Ian Levasseur

Shred-Tech295 Pinebush RdCambridge ON N1T 1B2519 621-3560 Fax: 519 621-4288.Toll-Free: 800 465-3214CEO Rob Glass

Shu-Pak Equipment Inc.176 McGovern DrRR 32Cambridge ON N3H 4R7519 653-2472 Fax: 519 653-2719.Pres David Tanner

Sierra International Machinery, Inc. Recycling & Solid Waste Division1674 Keller PkySuite 102Keller TX 76248817 337-7111 Fax: 817 337-5838.Mktg Asst Vicki Dunigan

Signature Marketing, LLC134 West StSimsbury CT 06070860 658-7172 Fax: 860 651-8376.Toll-Free: 877 658-7172CEO Evelyn M Golden

Sims Cab Depot Corp.200 Moulinette RdLong Sault ON K0C 1P0613 534-2289 Fax: 613 534-2182.Pres Chuck Crawford

SMS Equipment - Eastern Region1945 55e AvDorval QC H9P 1G9514 636-4950 Fax: 514 636-4979.Toll-Free: 800 881-9828VP-Sls/Mktg Alain Bedard

So. Cal Soft-Pak, Inc.208-3550 Camino Del Rio NorthSan Diego CA 92108619 283-2338 Fax: 619 283-6641.Toll-Free: 888 763-8725VP-Bus Dev Peter Shroyer

Sandhill Disposal & Recycling Inc.5728 Old School RdCaledon ON L7C 0W6905 843-2552 Fax: 905 843-3495.Toll-Free: 888 941-3345Pres John Devins

Saskatchewan Waste Reduction Council203-115 2 Ave NSaskatoon SK S7K 2B1306 931-3242 Fax: 306 665-2128.Exec Dir Joanne Fedyk

Scarab Manufacturing1475 County Rd WWhite Deer TX 79097806 883-7621 Fax: 806 883-6804.Plant Mgr Britt B Reid Jr

Scarfo1114 Osborne RdDowningtown PA 19335610 269-5406 Fax: 610 269-5406.Pres Carol Scarfo

SciCorp Systems Inc.- Biologic220 Bayview DrUnit 15Barrie ON L4N 4Y8705 733-2626 Fax: 705 733-2618.Toll-Free: 800 897-2053

Sebright Products Inc.PO Box 296Hopkins MI 49328Location: 127 N Water St616 793-7183 Fax: 616 793-4022.Dir-Mktg Jeannie Bolt

Security Engineered MachineryPO Box 1045Westboro MA 01581508 366-1488 Fax: 508 366-6814.Toll-Free: 800 225-9293Pres Peter Dempsey; Ntl Shred Serv Mgr Lisa Gauvin

SENES Consultants Limited121 Granton DrSuite 12Richmond Hill ON L4B 3N4905 764-9380 Fax: 905 764-9386.Pres D M Don Gorber

Sennebogen LLC2835 Jeff Adams DrCharlotte NC 28206704 347-4910 Fax: 704 347-8894.Pres Constantino Lannes

SETCO Solid TirePO Box 809Idabel OK 74745580 286-6531 Fax: 580 286-6743.Mktg Mgr Sharon Birdsong

Shaw Tracking2055 Flavelle Blvd





Camas WA 98607800 535-0941 Fax: 360 833-9200.Mktg Mgr Crismon Lewis

WCI Environmental Solutions Inc.129 Acacia AveOttawa ON K1M 0R2613 741-4242 Fax: 613 747-0510.

Weima America, Inc.3678 Centre CirFort Mill SC 29715803 802-7170 Fax: 803 802-7098.Toll-Free: 888 440-7170Inside Sls Coord Chad Ames

Wessuc Inc.973 Alberton Rd SJerseyville ON L0R 1R0519 752-0837 Fax: 519 752-0840.Toll-Free: 866 493-7782Sls/Mktg Mgr Hank Van Veen

West Can Marketing Corporation1610 Lakeside RdLethbridge AB T1K 3G8403 329-1713 Fax: 403 329-1512.Pres Grant Harrington

West Salem Machinery Co.PO Box 5288Salem OR 97304503 364-2213 Fax: 503 364-1398.Toll-Free: 800 722-3530Gen Mgr Bob DeSouza

Wildcat Manufacturing Co. Inc.PO Box 1100Freeman SD 57029Location: 420 S Hwy 81605 925-4512 Fax: 605 925-7536.Toll-Free: 800 627-3954Sls Mgr/VP Myron Holzwarth; Sls Rep Tim O’Hara

Wilkens Industries Inc.184 S County Rd 22Morris MN 56267320 589-1971 Fax: 320 589-1974.Toll-Free: 800 833-6045Sales Doug Storck

Williams Patent Crusher & Pulverizer Co., Inc.2701 N BroadwaySt Louis MO 63102314 621-3348 Fax: 314 436-2639.Sls Mgr Carl Rehmer

Willms & Shier Environmental Lawyers LLP4 King St WSuite 900Toronto ON M5H 1B6416 863-0711 Fax: 416 863-1938.Partner Donna S K Shier; Partner John Willms

WorleyParsons - Div. Infrastructure & Environment4500 16 Ave NWCalgary AB T3B 0M6403 247-0200 Fax: 403 247-4811.Toll-Free: 800 668-6772Mktg Mgr Bill Tompkins

905 791-3980 Ext. 227 Fax: 905 791-0587.Mktg Mgr Wayne Riviere

Walinga Inc. - Waste Equipment DivisionRR 5Guelph ON N1H 6J2519 824-8520 Fax: 519 824-5651.Toll-Free: 888 925-4642Reg Mgr Mark Williams

Walker Environmental GroupPO BoxThorold ON L2V 3Y8Location: 2800 Townline Rd905 680-3702 Fax: 905 680-1916.Toll-Free: 800 263-2526VP Mike Watt

Walker Magnetics National Ltd.901 Arvin AveStoney Creek ON L8E 5N9905 643-3338 Fax: 905 643-6111.Toll-Free: 800 267-4678VP/Gen Mgr Brian Thwaites

Walking Floor International Canada50 Roy BlvdUnits 1-3Brantford ON N3R 7K2519 756-9178 Fax: 519 756-0687.Toll-Free: 800 514-6085Dir-Ops/Sls David Schertzberg

WAM Software, Inc.280 California AveReno NV 89509800 926-4748 Fax: 775 322-1165.Dir-Sls Eric Mastic

Waste Diversion Toronto/Canada138 Garden AveToronto ON M6R 1H7416 535-9918Founder Rod Muir

Waste Services (CA) Inc.4090 Bellgreen Dr, Unit 6Ottawa ON K1G 3N2613 260-0451 Fax: 613 260-2784.VP Eastern Canada Robert Ross

Wasteco161 Bridgeland AveToronto ON M6A 1Z1416 787-5000 Ext. 231 Fax: 416 787-6210.

WasteExpo11 River Bend Dr SStamford CT 06907203 358-4314 Fax: 203 358-5815.Mktg Mgr Laura Magliola

Wastequip Accurate Canada3227 Clifford CrtInnisfil ON L9S 3V8705 431-5980 Fax: 705 431-5970.Toll-Free: 888 820-5016Sls Mgr Laurie McMillan

Water Maze Water Treatment Systems4275 NW Pacific Rim Blvd

Universal Handling Equipment Ltd.100 Burland CresHamilton ON L8H 7L5 Fax: 905 662-0603.Toll-Free: 877 843-1122Pres David Gerrard

Van Dyk Baler Corp.31 Wellington StOrangeville ON L9W 2L6519 940-3000 Fax: 519 940-9853.Cdn Sls Mgr Don Holliday

Varsek Trading Group Inc.6260 Mara CresRichmond BC V7C 2P9604 277-6255 Fax: 604 277-6239.Gen Mgr Peter V Varsek

Vecoplan, LLCPO Box 7224High Point NC 27264336 861-6070 Fax: 336 861-4329.Toll-Free: 877 738-3241Mktg Coord Michelle Zimmerman

Vermeer Canada Ltd.10 Indell LaneBrampton ON L6T 3Y3905 793-9339 Fax: 905 793-0241.Toll-Free: 800 668-9065Reg Sls Mgr Craig DruryBranches:Calgary AB; Edmonton AB; Grande Prairie AB; Winnipeg MB; Montreal QCVermeer Canada carries a wide variety of equipment across Canada for your recycling wood processing needs from brush chippers, grinders, compost turners, wildcat trommel screens.

VisionQuest Environmental Strategies Corp.15 Marsh HarbourAurora ON L4G 5Z2416 570-4379Pres Dave Douglas

VisionsQuest/McGuire promotional Products (VQenviro)5456 Tomken Rd, Unit 15Mississauga ON L4W 2Z5416 570-4379 Fax: 905 602-7589.Natl Sls Mgr Dave Douglas

Vulcan On-Board Scales11-1642 Langan AvePort Coquitlam BC V3C 1K5604 944-1481 Fax: 604 944-1482.Toll-Free: 800 663-0854Reg Mgr Bruce Taggart

W. Ralston (Canada) Inc.135 East DrBrampton ON L6T 1B5

Titan Trailers Inc.1129 Hwy #3Delhi ON N4B 2W6519 688-4826 Fax: 519 688-6453.Pres Mike Kloepfer; Cust Serv/Exec VP Sandy Kloepfer

TMS Solutions Ltd.1577 Ridge Rd WSuite 117Rochester NY 14615585 621-5825 Fax: 585 581-1098.Toll-Free: 888 301-4700Pres William J Brown

Totten Sims Hubicki Associates300 Water StWhitby ON L1N 9J2905 668-9363 Ext. 2207 Fax: 905 668-0221.Mgr-Env Mgmnt Group Kelly Dechert

Transform Compost Systems Ltd.3911 Mt Lehman RdAbbotsford BC V4X 2N1604 856-2722 Fax: 604 856-8444.Pres John Paul

Travis Body & Trailer, Inc.13955 FM 529Houston TX 77041713 466-5888 Fax: 713 466-3238.Toll-Free: 800 535-4372Pres C K Bud Hughes

Trouble-Shooting Services Ltd.PO Box 185Carlisle ON L0R 1H0905 659-1323 Fax: 905 659-1286.Toll-Free: 888 397-2253Pres Scott Beaumont; Serv/Parts/Office Mgr Mike Collins

TRUX Route Management Systems Inc.260 Holiday Inn DrUnit 34Cambridge ON N3C 4E8519 658-4322 Fax: 519 658-9762.Toll-Free: 866 879-8789Controller Alex Bell

Tryco/Untha InternationalPO Box 1277Decatur IL 62525217 864-4541 Fax: 217 864-6397.Pres Robert West

Tulip Corporation714 Keefe Ave EMilwaukee WI 53212414 963-3120 Fax: 414 962-1825.Sr Sls Rep Joy O’Hearn

Universal Engineering Corp.800 First Ave NWCedar Rapids IA 52405319 365-0441 Fax: 319 369-5440.Toll-Free: 800 366-2051Sls Coord Trudi Troendle



An exploration of extended producer responsibility as

a market mechanism towards zero waste

February 2nd and 3rd, 20099:00 am – 5:00 pm

Hart House, Great HallUniversity of Toronto

215 Huron Street, Toronto, Ontario Canada

WealthWithoutWast/AB/SW 12/12/08 2:47 PM Page 1


http://www.rco.on.ca


October/November 2008 www.solidwastemag.com 41

C O M P O S T I N G M A T T E R S

Screens

Complete C&D Systems

Mobile Screens

Compost Reactors

Glass Cleanup

Water-Bath Separator

LUBO Recover More, Landfill Less

NORTH AMERICAN & CANADIAN DISTRIBUTOR OF LUBO & TITECH RECYCLING EQUIPMENT 78 HALLOWEEN BLVD., STAMFORD, CT 06902

CORPORATE (203) 967 1140WEST (310) 378 5433MID WEST (630) 778 9780

CANADA (519) 940 4601SOUTH WEST (281) 489 3700EMAIL [email protected] Pantone 485 (RED)

CMYK Format:C 0M 100Y 100K 0

Pantone 653 (BLUE)CMYK Format:C 100M 60Y 0K 18

A sister company of Van Dyk Baler Corp.

www.lubousa.com

Willimantic, CT USA C&D System Non-fines recovery rate reaching 90%

The enclosed channel system reverts back to a technology that has lost some of its steam over the last few years. Feedstocks are placed at the input end of a channel and uncured compost is removed in four to eight weeks. The composting material is turned and mixed one to three times per week using a compost turner. Appropriate composting temperatures of 55 to 65°C are maintained by powerful blowers that aerate the composting material. The blow-ers are controlled by timers and/or temperature feedback. Temperature monitoring and blower controls can be effected via a computer.

A specialized odour control system is used at this facility. “Air Phaser” is a non-thermal

plasma technology and is designed to treat odourous air emissions by using electricity. In non-sciency terms think of it as a bug zapper for odour molecules. The odour molecules are decomposed to their non-odourous element forms such as carbon, hydrogen and nitrogen atoms. This technology is relatively new to Canada and for use at composting facilities.

It will be interesting to see how well this technology works and if it represents a viable alternative to biofiltration, the current industry standard for odour control.

This composting facility and others that are being developed are all steps in the right direction. The enthusiasm of residents to divert their SSO is starting to be matched

by Ontario’s growing composting industry. It is very satisfying to see Ontario’s SSO and quite frankly the revenue that comes with it stay at home — where it belongs.

Paul van der Werf is president of 2cg Inc. in London, Ontario. Contact Paul at www.2cg.ca@ARTICLECATEGORY:784;

,,, continued from page 24

swr dec-jan 09 CMat pg 24,41.indd 41 02/11/10 9:00 AM



http://www.lubousa.com

http://www.2cg.ca


D I V E R S I O N

Pharmaceutical WasteAccountability at the counter

As an interior designer, I was contacted recently by a national pharmaceutical retail chain to design a store fixture to be located in the front of their stores. The only criteria given was where the

fixture was to be located and the rough shape and dimensions of the space to be occupied. What merchandise was to go on the fixture was left open.

The idea developed into a preliminary presentation for an interactive fixture designed to educate the public about the need to dispose of phar-maceutical waste in an environmentally responsible manner. It incor-porated bins where customers could drop off and separate unused pharmaceuticals.

The idea was pitched to the client and was well received. However, it was eventually turned down on the basis that the infrastructure to support the concept does not exist in Ontario. They were still receptive to the idea pending a paradigm shift in current medical waste collection and disposal practices currently outside their control.

A sense of how this problem is viewed by the government, retailers, industry, and the public emerged almost at once. Absolutely no one wants their name or their organization’s name associ-ated in the media with the problem of what to do with pharmaceutical and medical waste. There’s a sound reason for this: No person or organization contributing medical waste to the disposal system wants to be seen as being part of the problem or an obstacle to the solution (for what is understood as an environmental safety issue that affects every living thing). It’s an issue that has been ignored to the point where the damage done by pharmaceuticals is global in scope.

The potential for a public backlash is a risk no one wants to take. But doing nothing about the problem risks an even greater backlash.

The hospitalsThe idea for the drop-off unit went on the back burner for a while until I had time to discuss the issues with the largest end users: the hospitals. In the hospitals, medical waste disposal is a problem that is on everyone’s mind and again, while no one wanted their names attached to the issue, there was urgency — even eagerness — from everyone I spoke to at every level. They all wanted to make sure my questions were answered.

What came to light was that pharmaceutical and medical waste dis-posal is currently in a state of barely controlled chaos that’s regulated

but not fully enforced due to the lack of realistic legislation, infrastructure, equipment and fund-ing. I got the impression that my contacts at every level were begging me to come up with a cost-effective solution. Everyone is aware that the Ministry of the Environment has created an entity called Waste Diversion Ontario to address such matters but no one knows what’s going on. While the ministry has invited input, many stake holders are afraid to participate for fear of being singled out later.

Where the rubber meets the road in this busi-ness is with what are known as “sharps.” The term refers to the needles and scalpels, etc. that

are part of the waste deposited into the bins. Ontario hospitals are re-quired to use one-way disposal bins but the cost of single-use bins is high (if you multiply how many are needed on a daily basis per floor per hospital). It’s easy to see how the system-wide cost of such bins could alter how medical care is delivered if this policy is allowed to stand without allowances being made for the ability to reuse bins. Con-sequently, the bins are not strictly one-way bins in a number of cases. Rather, they’re lined with plastic bags and the bags go from one bin in,

“No one wants their name associated in the media

with the problem of phar-maceutical waste.”

by John Newell

Profit from our service and know-how!Official distributors of specialized equipment: BalersConveyorsSorting systems (single stream, fiber, OCC)CompactorsOptical sorting Shredders/grindersScrap metal processing equipmentC&D recycling equipmentAnd more!

For state-of-the-art performance, go to the people who know recycling.

• Custom-tailored recycling solutions• 24-hour service by our highly skilled staff• Preventive maintenance program• Extensive parts inventory• Optimization of plant efficiency• Equipment recommendations,

configuration, repair & upgrade

Machinex municipal sorting system

Machinex C&D sorting plant

1-800-463-4298www.machinexrecyclingservices.com R E C Y C L I N G S E R V I C E S

MACHINEX-13369-PubSolidWaste.indd 1 06/10/08 15:29:37

Many consumers are unaware that they can usually return old drugs and medications to

their local pharmacy for safe disposal.

Presents

Coming to March 2009For more details, read: Solid Waste & Recycling & Hazmat Management Magazines

$HazMat M

AN

AG

EM

EN

T

Solutions for the Business of the Environment

An EcoLog Group Publication / CPMP no. 40069240

HazMat Training

Crisis Management

EMS Systems

FALL 2008www.hazmatmag.com

Explosion!What went wrong at Sunrise Propane

BROWNFIELDSBROWNFIELDSMARKETPLACEMARKETPLACE

Canadian Brownfields Network

FALL 2008FALL 2008

P U B L I S H E D I N A S S O C I A T I O N W I T H :

Centre for Sustainable Community Developments

FCMThe Canadian Real EstateAssociation

Centre for Advanced Visualizatin

S P O N S O R E D B Y :

Published by HazMat Management magazine

DOCKSIDEGREENProject restores Victoria waterfront

INSIDE:

Solid Waste&RecyclingSolid Waste&RecyclingCanada’s magazine on collection, hauling, processing and disposalAugust/September 2008 $10.00

CP

MP

No

. 400

6924

0A

n E

coLo

g G

rou

p P

ub

licat

ion

Composting & Organics Recovery Supplement — page 23

Used

Beverage Container

Recovery in Canada

— page 8

Lessons From

Waste Diversion Ideas for Canada— A Special Theme EditionWaste Diversion Ideas for Canada— A Special Theme Edition

EuropeLessons From

Europe

www.hazmatmag.com www.solidwastemag.caWatch for it On-Line on at:

Solid Waste&RecyclingSolid Waste&Recycling HazMatHazMat M

AN

AG

EMEN

TM

AN

AG

EMEN

T

Solutions for the Business of the EnvironmentSolutions for the Business of the Environment

Going Green/AB/HMM 12/5/08 3:34 PM Page 1

fi

swr dec-jan 09 Pack-MedWaste pg 42-45.indd 42 02/11/10 9:01 AM


http://www.machinexrecyclingservices.com

Presents

Coming to March 2009For more details, read: Solid Waste & Recycling & Hazmat Management Magazines

$HazMat M

AN

AG

EM

EN

T

Solutions for the Business of the Environment

An EcoLog Group Publication / CPMP no. 40069240

HazMat Training

Crisis Management

EMS Systems

FALL 2008www.hazmatmag.com

Explosion!What went wrong at Sunrise Propane

BROWNFIELDSBROWNFIELDSMARKETPLACEMARKETPLACE

Canadian Brownfields Network

FALL 2008FALL 2008

P U B L I S H E D I N A S S O C I A T I O N W I T H :

Centre for Sustainable Community Developments

FCMThe Canadian Real EstateAssociation

Centre for Advanced Visualizatin

S P O N S O R E D B Y :

Published by HazMat Management magazine

DOCKSIDEGREENProject restores Victoria waterfront

INSIDE:

Solid Waste&RecyclingSolid Waste&RecyclingCanada’s magazine on collection, hauling, processing and disposalAugust/September 2008 $10.00

CP

MP

No

. 400

6924

0A

n E

coLo

g G

rou

p P

ub

licat

ion

Composting & Organics Recovery Supplement — page 23

Used

Beverage Container

Recovery in Canada

— page 8

Lessons From

Waste Diversion Ideas for Canada— A Special Theme EditionWaste Diversion Ideas for Canada— A Special Theme Edition

EuropeLessons From

Europe

www.hazmatmag.com www.solidwastemag.caWatch for it On-Line on at:

Solid Waste&RecyclingSolid Waste&Recycling HazMatHazMat M

AN

AG

EMEN

TM

AN

AG

EMEN

T

Solutions for the Business of the EnvironmentSolutions for the Business of the Environment

Going Green/AB/HMM 12/5/08 3:34 PM Page 1


http://www.hazmatmag.com



D I V E R S I O N

say, an operating room, to a collection bin and from there into a one-way bin.

In hospitals, no distinction is made between medical waste surgical tools and pharmaceut-icals. This is a crucial point because different types of waste can be treated in different ways with varying levels of cost and infrastructure requirements.

The public doesn’t understand the acute shortage of space in typical medical, dental or pharmaceutical environments. Buildings and business environments are not currently built to manage hazardous wastes because the architects and designers are not made aware of the problems and therefore cannot provide solutions for absent support services.

SaskatchewanA conversation with the owner of the Canadian company that supplies sharps bins to hospitals brought me up to speed on how Saskatchewan deals with its medical waste problem. In that province pharmaceutical waste is disposed of in metal or plastic waste bins provided by municipalities. Information about proper dis-posal is published from time to time in local newspapers. People are told to put the pharma-ceutical disposables in small metal or plastic containers. They are to be taped shut and they go into the bins on the day they’re to be picked up by municipal waste staff.

In addition, there’s a participatory phar-maceutical program that operates under the auspices of the Saskatchewan Pharmaceut-ical Association whereby pharmacists — on a volunteer basis — advise their clients (in-cluding doctors) to return sharps and unused or outdated drugs and prescription medicines to the pharmacy where they were purchased. The used and surplus meds are collected by medical waste specialists and destroyed in a provincially approved manner. The cost of this is borne by the pharmacies.

While pharmacies may provide this service in Ontario, the general public is largely ignor-ant of this opportunity and the hazard of sim-ply flushing unused meds down the toilet or throwing them unprotected into the garbage. Consequently, our waterways and municipal sewage are contaminated with all kinds of drugs that have a negative effect on biota and fish, birds and animals. A partial recovery sys-tem operates in Ontario, wide gaps exist in the system. Some of this waste stream is trucked to Saskatchewan for disposal.

Another weakness in Ontario’s system is the vulnerability of waste collection staff who must pick up household waste at the curb re-gardless of what it might contain.

Is the ministry working on the issue? Yes it is. Does it want to do the right thing? Absolute-ly. But doing the right thing with complex issues like this does take time and the legal implica-tions are formidable. But the clock is ticking and accidents don’t run on schedule. It’s time for the governments in every province to act and introduce a product stewardship program and robust return-to retail system (or something equally effective) for drugs and sharps.

John Newell is with Jondy Retail Interiors Inc. in Pickering, Ontario. Contact John at [email protected]@ARTICLECATEGORY:789; 2243; 10 000

participants400

exhibitors175

conferences60

countries 250

business meetings

8th biennialedition

MaR

CH 17-19, 20

09Pa

lais

des

cong

rès d

e Mon

TrÉa

l ➜

cana

da

initiated and organized by

inteRnational environmentaltechnology tRade SHow and conference

www.americana.org

foR  all  

of the environment industry 

a CoMMeRCialtRade SHow

PRofeSSionalS 

a coMPleTe conference PrograM wiTh More Than

covering various

subjectscovering various

175 PReSentationS

and panels

industrial bioProductsmarket development and business opportunitieswastewater & drinking Waterair Quality and climate ChangeSolid waste managementcontaminated Soils and Groundwateretc.

AM09-PUB BIZINFO.indd 1 11/24/08 9:49:00




http://www.rotobec.com



10 000 participants

400 exhibitors

175conferences

60countries

250business meetings

8th biennialedition

MaR

CH 17-19, 20

09Pa

lais

des

cong

rès d

e Mon

TrÉa

l ➜

cana

da

initiated and organized by

inteRnational environmentaltechnology tRade SHow and conference

www.americana.org

foR  all  

of the environment industry 

a CoMMeRCialtRade SHow

PRofeSSionalS 

a coMPleTe conference PrograM wiTh More Than

covering various

subjectscovering various

175 PReSentationS

and panels

industrial bioProductsmarket development and business opportunitieswastewater & drinking Waterair Quality and climate ChangeSolid waste managementcontaminated Soils and Groundwateretc.

AM09-PUB BIZINFO.indd 1 11/24/08 9:49:00


http://www.americana.org

Terry Barkhouse, EcoLog (left) with Jamie Ross, Advertising Sales, Solid Waste & Recycling

magazine at the magazine’s booth. www.solidwastemag.com

Brad McLellan, Fuel Tax Specialist, Holly Services in Tillsonburg, Ontario. www.hollyservices.ca

Bill Vanderlinden, VP-Sales, VQuip in Burlington, Ontario. www.vquip.com

Mark Hillis, General Manager (left), Molok North America Ltd. in Mount Forest, Ontario with

customer. www.molok.com

Karine Bilodeau (foreground right) IPL Environment, Saint Damien, Quebec. www.ipl-plastics

Keith Lowe, National Sales Manager (left), Roll Rite, LLC in Alger, Michigan. www.rollrite.com

Julie Wilson (middle) and Leah Furey (left) with customer. Waste Services Inc. in Brampton, Ontario.

www.wsii.com

Crystal McMillan, Sales Representative, BearSaver, Ucluelet, BC. www.bearsaver.com

Doug Bundock (left) and Glenn Morato (right) of Purves Redmond in Toronto, Ontario.

www.purvesredmond.com

Tony Mac Donald (left) of T.G. Mac Sales Ltd. in New Glasgow, Nova Scotia and Jean-Sebastian Voghel (right) of Voghel Enviroquip Inc. in Mississauga, Ontario with a customer at the Doppstadt booth. www.voghel.com

Don Holliday (left), Canadian Sales Manager with Van Dyk Baler Corp. in Orangeville, Ontario with

Solid Waste & Recycling magazine Publisher Brad O’Brien. www.vandykbaler.com

Tade Mahoney (left), North East Regional Sales Manager of American Baler in Bellevue, Ohio with Kathlyn Schoon of Machinex Recycling Technolo-

gies in Pickering, Ontario. www.machinex.ca

SHOW HIGHLIGHTS


swr dec-jan 09 cwre pg 46-47.indd 46 02/11/10 9:04 AM


http://www.hollyservices.ca

http://www.vquip.com

http://www.molok.com

http://www.ipl-plastics

http://www.rollrite.com

http://www.wsii.com

http://www.bearsaver.com

http://www.purvesredmond.com

http://www.voghel.com

http://www.vandykbaler.com

http://www.machinex.ca


Canadian Waste & Recycling Expo, November 5-6, 2008

International Centre – Toronto, Ontario

Jason Coleman, Sales Operations Manager with Heil in Chattanooga, Tenessee. www.heil.com

Lorolei Arsenault of MeshWear Technologies Inc. in Jerseyville, Ontario. www.meshwear.com

Captain John Hosty of the Warsash Group in Burlington, Ontario at the Conestoga-Rovers &

Associates booth. www.craworld.com

Jeremy Snow, Territory Manager, Vermeer Canada Inc. in Brampton, Ontario.

www.vermeercanada.com

Luc Lefebvre of Rotek Plastics in Valleyfield, Quebec. www.rotekplastic.com

Maria Frizzell, director, Customer Service & Regional Sales, SSI Schaefer, Brampton, Ontario.

www.ssi-schaefer.ca

Joe Lyng (left), General Manager-Sales & Marketing/Business Development, Walker Environmental

Group in Thorold, Ontario with John Aresnault of Waterloo. www.walkerind.com

Robert Luciani (left) and Mike Samways of Metro Waste Paper Recovery Inc. in Toronto, Ontario.

www.metrowaste.com

Norm Laforet (left), District Manager, and Vince Smith, Sales Representative with Samuel Strapping

Systems in Mississauga, Ontario. www.samuelstrapping.com

Rich Reardon of Bulk Handling Systems in Eugene, Oregon. www.bulkhandlingsystems.com

Al Brodie, President of Brodie TMR & Compost solutions in Ajax, Ontario.

www.tmrandcompostsolutions.com


Next Year’s ShowThe Canadian Waste & Recycling Expo will be held October 28 & 29, 2009 in Vancouver, BC, Canada, Contact:

Arnie Gess, Show ManagerToll Free: 1-877-534-7285Fax: 403-638-4413Email: [email protected]: www.cwre.ca

swr dec-jan 09 cwre pg 46-47.indd 47 02/11/10 9:05 AM

http://www.heil.com

http://www.meshwear.com

http://www.craworld.com

http://www.vermeercanada.com

http://www.rotekplastic.com

http://www.ssi-schaefer.ca

http://www.walkerind.com

http://www.metrowaste.com


http://www.bulkhandlingsystems.com

http://www.tmrandcompostsolutions.com



http://www.cwre.ca


B I O M A S S“GreenField has struck a 25 year feedstock supply agreement with the city to

fuel its ethanol production.”

by Gordon Quaiattini

Cellulosic EthanolWaste and advanced renewable fuels

Energy, the economy, and the environment are the defining issues of our day. Even in the face of the global financial crisis — and perhaps accelerated by it — these forces will shape future public

policy. They will direct commercial trends. And they will dictate a great deal of change in the years ahead.

Consumers know that. Business knows that. And municipalities know that.

Of course, those in the waste management industry know it as well. What may be less well known is how the interests of that industry and the renewable fuels sector are becoming increasingly entwined.

Driven by scientific innovation, there’s an emerging commonality of interest be-tween waste and renewable fuels; an interest that will help meet public and municipal de-mand for economic growth, cleaner energy, and more efficient diversion of waste.

That common interest can be summed up with one term: cellulosic ethanol. Not only does cellulosic ethanol promise cleaner and less expensive transportation fuel, it offers a built-in market for municipal waste.

In recent months, grain-based ethanol has been wrongly accused of nearly every evil under the sun. First, it was blamed for rising crop prices, which experts now agree was always false. Economist Stewart Ramsey of Global Insight went so far as to say flatly that crop prices were a “speculative bubble.” Some argued that ethanol was diverting needed crops from our food chain and creating shortages. The reality, of course, was that food shortages were the consequence of drought and maladministration in the developing world. Corn — the most common grain used for ethanol — is being harvested in record amounts, far outstripping demand generated by either food or fuel.

Finally, there have been a host of questions about the environmental bona fides of grain-based ethanol. On every score, ethanol leaves a light-er carbon footprint than fossil fuels. In fact, new federal regulations for ethanol use will cut greenhouse gases by some 4.2 Megatonnes each and every year. That’s the equivalent of removing one million cars a year from our highways.

Grain-based ethanol brings a wide number of benefits from an eco-nomic and environmental perspective. Of even greater relevance to those in the waste management industry, it has also served to build the founda-tion for the next generation of fuels; cellulosic fuels that can be made from non-recyclable waste products.

Unlike grain based ethanol, cellulosic biofuels can be made from a wide variety of organic stock, including municipal waste. While this technology remains new in terms of commercial applications, that’s changing quickly.

Biomass projectNowhere is that example better on display than in Edmonton, Alberta. Canadian Renewable Fuels Association member GreenField Ethanol has teamed-up with CRFA member Enerkem, a Quebec-based firm that has developed a proprietary technology to convert biomass from municipal waste into biofuels. Together, they’re building a nearly 40 million litre plant to produce cellulosic ethanol using this new technology. It will be among the first of its kind anywhere in the world: a commercial facility producing next-generation biofuels in a way that some critics suggested would never be seen.

Excitingly, that’s not the only way in which this initiative is breaking new ground. How the biofuels are being produced and the partnership underlying that effort is equally innovative.

GreenField has struck a 25 year feed-stock supply agreement with the city to fuel its ethanol production. The supply will be composed from diverted municipal waste.

The benefits of this arrangement are many. First and most important, the plant will show that cellulosic ethanol can be pro-duced on a commercial scale. Second, the Edmonton facility will reduce the province of Alberta’s harmful greenhouse gas emis-sions by more than six million tonnes during the period of the agreement. Third, and of

greatest relevance for the waste management sector, it stands as a model private-public partnership.

Municipalities looking to demonstrate leadership on diversion from landfills will find this an example to be copied. It shows that we can find new ways with new technology to transform waste into a source of rev-enue, energy, and environmental improvement all at once.

A similar plant is being constructed in Varennes, Quebec. It too will produce 40 million litres when it reaches full capacity.

At the end of the day, the true lesson of GreenField and Enerkem’s cellulosic leadership is that it highlights the potential for new partner-ships. Working together, the biofuels industry, municipalities, and the waste management sector can achieve tremendous gains. We can create jobs and economic growth. We can combat climate change. We can prod-uce new cleaner energy alternatives. And we can diminish the burden faced by those in waste management. That’s a winning alternative.

Gordon Quaiattini is President of the Canadian Renewable Fuels Association in Ottawa, Ontario. Contact Gordon at [email protected]@ARTICLECATEGORY:2242;

swr dec-jan 09 w-to-e pg 48-49.indd 48 02/11/10 9:10 AM



Las Vegas Convention Center, South HallsLas Vegas, NV

Exhibits: June 9-11, 2009Conference: June 8-10, 2009

www.wasteexpo.com

Interested in becoming a WasteExpo 2009 Exhibitor?Contact:

Companies A-Eo: Debra Busby 203-358-4153 [email protected]

Companies Ep-Me: Denise LaFlamme [email protected]

Companies Mf-Z: Marc Acampora 203-358-4384 [email protected]

Registration

Now Open!

Free Exhibits Admission

with code VP32

Hotel reservations are now beingaccepted. Visit the “Travel page”

of www.wasteexpo.com

North America’s largesttradeshow serving the$52 billion solid waste

and recycling industries -private sector, public sector,

new start-ups andwaste generators.

• 525 exhibits• 40 conference sessions

• and countless networkingopportunities

Sponsored by: Co-located Conferences: In Association with:

swr dec-jan 09 w-to-e pg 48-49.indd 49 02/11/10 9:10 AM




http://www.wasteexpo.com

http://www.wasteexpo.com


R E C Y C L I N G

The recent global economic upheaval has had a direct, detrimental effect on the value of recycled commodities. Through October and November the price of post consumer fibres, plastics and metals

has plummeted, creating challenges for program operators everywhere.The average “basket of goods” price for Ontario blue box materials

was over $175/tonne in October and less than $40 in December. The initial price drops were felt from the fibre markets. With the econom-ic malaise fewer goods are being produced requiring fewer boxes to package them. Mills have fewer orders to fill. Newspaper companies built large inventories over the summer fearing a price increase from ONP mills. The price of OCC and ONP dropped $80/tonne in just two months. Abitibi-Bowater in Thorold Ontario shut down production for the first two weeks of November. At the same time, demand from China practically ceased. Nine Dragons — a large consumer of North Amer-ican scrap fibres — closed its east coast offices.

The lack of overseas demand has not been restricted to fibres. Plas-tics and metals have few outlets overseas where approximately 20 per cent of blue box items are sold. A glut of domestic tonnage has led municipal and commercial recycling plants to begin stockpiling baled materials onsite or in warehouses.

Unfortunately this does not seem to be a minor hiccup. Speculation is rampant as to when a rebound may occur, with guesses ranging from mid-February (after the Chinese New Year) to as far off as the beginning of 2010. Regardless, a few things are worth knowing.

Longstanding relationships with the end markets are more import-ant than ever. The spot market is essentially gone. Unless tonnes were contracted to a mill you’ll find yourself at the bottom of the list to get in. The old practice of jumping from one buyer to another for a quarter cent a pound is probably costing you any gains you made in the past.

Quality is paramount. With the oversupply mills will first choose the material that returns the greatest yield. Some municipalities have already experienced this at aluminum and newsprint mills. Abitibi-Bo-water and Atlantic Packaging state they won’t accept ONP from single-stream MRFs unless quality improves drastically. Dual-stream quality is not necessarily better; however, the majority of tonnages are generated by single-stream operations. The Novelis aluminum plant in Oswego, New York previously indicated a preference for deposit-refund over curbside-collected material; they now refuse to take materials from sev-eral Ontario MRFs.

Materials by typeOCC: Continues to move slowly. Mills indicate two-week shutdowns over Christmas. MRF stockpiles will increase.ONP: Some relief with Abitibi-Bowater back on line and a few orders trickling in from China; however, this is only for #8 grade. Lower grade

#6 paper is no longer being sought by mills. MRFs producing this grade relied on overseas markets; now they’re stuck with material that’s home-less. Talk of landfilling runs into the fact that permitted space is limited. Boxboard is experiencing the same issues as ONP#6Plastics: #1 PET buyers are offering to pick up loads at no charge, in stark contrast with the $400+ everyone received a few months ago. HDPE #2 has swung $700/tonne in six weeks. At least these materials are still moving and Coca Cola’s new bottle-to-bottle recycling facility for PET in the US may increase demand. The bad news is that the price of prime or virgin material is more affordable than ever (the reduced price of oil being the main factor). Tubs and lids or #3 thru #7 mixed plastic is a different story. Demand for these marginal materials is al-most gone. They still have a few homes but soon buyers charge to take them. Mixed plastic only had an outlet overseas. This is gone. The only option for this grade may be landfill or incineration unless new pro-cessing technologies come online. This, however, will cost substantial money.

Plastic film is stagnant as well. The quality that traditionally comes from MRFs is poor at best. Most film processors are interested in plastic bags but it has to be clean. Return-to-vendor film seems to have a better chance of being recycled than MRF film.Metal:Steel cans continue to move but at a fraction of the summer high. Local mills may go into prolonged shutdowns during the holidays, with no price increases for months. Aluminum cans remain difficult to move. Orders for January are few and far between. One of the problems here may be the credit crunch. The price has fallen and there’s still an ap-petite for the material — unfortunately financing is hampering this mar-ket. Looming on the horizon is the fact that Chinese mills are producing aluminum at record rates. The Chinese government had imposed a 15 per cent tariff on the export of aluminum to protect essentially the sell-ing of its electricity. With an oversupply in the country, the Chinese government is being pressured to remove the tariff which will result in the world market being flooded with aluminum.Glass:Clear and coloured glass continues to move with relative ease. Mixed broken glass (prevalent in most MRFs) is a different story. Fibre-glass insulation is the main use for mixed broken glass and demand has dropped along with housing starts in the United States.

Difficulty moving recyclables has happened in the past but never to this degree. It’s obvious that some creative solutions will be required to get through this turmoil. See next page for analysis of problem materials at the MRF.

Phil Zigby is Marketing and Procurement Coordinator — Solid Waste Resources, for the City of Guelph, Ontario. Contact Phil at [email protected]

“The average ‘basket of goods’ price for Ontario

blue box materials was over $175/tonne in October and less than $40 in December.”

by Phil Zigby

A Bit of Gloom and DoomStraight talk on the current depressed commodity market

swr dec-jan 09 Recycling pg 50-52.indd 50 02/11/10 9:11 AM




R E C Y C L I N G

The Dirty DozenTwelve materials that create problems for recycling plants

With the current economic downturn and the collapse of commodity prices, it’s time to get serious about keeping problem packaging materials out of recycling plants.

Certain packaging types need to be redesigned for recyclability or not introduced in the first place, as they gum up the works in material recovery facilities (MRFs) and create problems in collection, processing and marketing of finished materials (creating so-called “contaminated” bales).

Packaging continues to find exciting new shapes, designs and composition, but MRF operators are left handling a diversity of materials without the proper tools. There’s a disconnect between the people choosing the package and the people entrusted with diverting it

from disposal. Either the packaging has to change, or new technology has to be invented to sort this stuff.

Perhaps tighter regulations could keep these materials out of the blue box, or steward fees could be raised for “problem materials.” We must engage the brand owners, packaging manufacturers and marketing experts for a joint solution. Perhaps if producers were made wholly responsible for the cost of end-of-life management, they’d change their packaging choices. — ed. (See Cover Story, page 8.)

NOTE: This article is based on a presentation Phil Zigby made at the AMRC fall conference in Niagara-on-the-Lake. For more information about the AMRC and it’s new name, see the Up Front section, pages 6-7.

Here are 12 problem materials, our “dirty dozen.”

1. OPAQUE PET

Unwanted in the PET mix; contaminated loads

end up in landfill. Who needs this stuff anyway?

4. UV-LINED BARRIER BOTTLES

Current contamination is low but rising. Optical

sorting cannot always distinguish the barrier. Bar-

riers not limited to PET bottles.

2. POLYCOATED BEVERAGE CUPS

Doesn’t belong with traditional fibre mixes, but

could potentially be considered with the aseptics.

High probability of having a lid attached (and trash

inside).

5. NEWSPAPER IN PLASTIC BAGS

Residents generally throw them in the blue box

with the paper. No viable reuse options. Difficult to

sort (hides very well with the paper)

3. RESIN LOOK-A-LIKES

Polypropylene resembles high density. PVC and

PS mimic PET -- sorters have difficulty telling the

difference. High risk of quality issues.

6. WAXED CARBOARD

Undesirable at regular board mills. Does it even

have a place in the blue box?

X

... continues on next page




7. COMPOSITE CONTAINERSPlease explain the benefit -- we still don’t see it.

Cannot separate the different materials.

10. PLA BOTTLES AND TRAYSLooks just like PET. Optical cannot separate it out. Takes miniscule amount to cause product

rejection.

8. PUMP BOTTLESHandles get caught in the machinery and other bottles. Can become a health and safety issue.

11. PLASTIC BAGSExpensive to collect and process. Better markets exist for clean material from return-to-retail pro-grams, as opposed to not curbside collection.

9. PLASTIC TRAYSComposition ranges from PET, PP, PE, PS, and PLA. Can be clear or opaque. Manual sorting

unreliable. Material landfilled.

12. OVERSIZED WATER BOTTLESThese fill up blue boxes and cube out collection trucks quickly. MRF machinery cannot handle

these. Place them on deposit, please.



http://www.wheel-check.com

http://www.protainer.com


“Solid waste professionals realize that a mix of treatment/disposal options are available,

depending on the waste stream.”

by John Nicholson, P.Eng.

IWMFinding the solution to waste management in your community

Although some individuals would believe that one is either for or against landfilling, for or against incineration, and for or against Zero Waste initiatives, many waste professionals recognize no

single universal waste management practice is preferable to all others. These experienced waste management professionals understand the concept of integrated waste management (IWM).

Proponents of IWM do not see the world in black and white. They understand that there is a range of waste streams to be managed and a menu of treatment/disposal practices from which to choose. The pre-ferred waste management option for a community depends on how en-vironmental, economic and social considerations are prioritized.

What is IWM?Simply put, IWM is the coordination of different waste treatment and disposal options: recycling, organics treatment, energy-from-waste, and landfilling. Solid waste professionals realize that a mix of treatment/dis-posal options are available, depend-ing on the waste stream.

IWM is defined by the appli-ca tion of the waste management hierarchy (1. Reduce, 2. Reuse, 3. Recycle, 4. Recover energy, and 5. Re sidual management) with local priorities (social, environmental, economic). The best IWM plan for one community may not be the best for another due to local priorities and conditions coupled with regional and national requirements results.

Konrad Fichtner, a consultant for AECOM in Burnaby, British Columbia, believes communities should involve their citizens in the process of finding waste management solutions so that the final solution is one that is acceptable to the majority.

“By involving residents in developing an IWM plan, the needs of residents wanting no new taxes are balanced with eco-activist citizens that want a green solution at whatever cost,” Fichtner states.Economic priority: Some municipalities may be only interested in a low cost, short-term waste disposal solution. For those municipalities, landfilling is likely the preferred choice. These cost-conscious com-munities will only recycle if there are strong end markets and organics diversion may only consist of composting leaf & yard waste. For an IWM plan focused solely on economics, very little public education or community involvement is needed.

The main advantages of an economics-only approach are (0bvious-ly) the low cost to taxpayers, the simplicity in implementation, and the convenience for consumers and industry. On the downside, valuable re-

sources may not be utilized and future liabilities are often unaccounted. Also, there is no consideration of greenhouse gas emissions.Environmental priority: For communities that place the environment as the main priority in IWM planning, there will be a major focus on maximizing waste avoidance and a high degree of source separation of all waste streams. In an environment-first community, recycling is man-datory, material bans exist and there are tax penalties on certain wastes. Every effort is made to maximize the recycling of organics and other materials regardless of market value. Mechanical-biological treatment is preferred over thermal treatment.

With an environment first approach, there are low GHG emissions, reduced demand for primary resources, a high number of “green col-lar” jobs, reduced long-term liability associated with waste disposal, and a highly educated and involved public. The disadvantage of focusing solely on the environment is the cost, complexity, and inconvenience of

the IWM system.An example of where the en-

vironment is a priority can be found in Swe den. In some municipalities, households are expected to separate waste into eight separate streams. A landfill tax of $65 per tonne deters this cost-effective yet environment-ally damaging waste management option.Societal priority: When a com-munity places social issues as a priority, IWM programs are put in

place that maximize community benefits and minimize negative im-pacts. Issues related to odor, noise, visual impact, convenience, and traf-fic all receive a high priority. The location and distribution of the IWM system is carefully considered as well as the employment quality and quantity from the system.

Society-first communities exhibit a sense of responsibility and be-lieve waste should be management within their borders. The good news for society-first communities is that it supports local businesses, pro-vides local employment. On the downside, there are no economies of scale for small communities that focus on a society-first IWM plan.Full integration: A fully integrated IWM balances all three priorities — the environment, the economy and society. For many communities in Canada, balancing all three is tricky but can be made easier by engaging the public on the costs, benefits, and consequences of choosing specific options.

John Nicholson, M.Sc., P.Eng., is a consultant based in Toronto, Ontario. Contact John at [email protected]@ARTICLECATEGORY:798;

W A S T E B U S I N E S S

“On the downside, there are no economies of scale for

small communities that focus on a society-first IWM plan.”

swr dec-jan 09 Waste Bus pg 53.indd 53 02/11/10 9:14 AM




I C & I W A S T E

Building PolicyAlberta first province to start recycling C&D waste

Alberta is drafting plans to start recycling construction and demo-lition (C&D) waste -- refuse that fills up nearly a quarter of the province’s landfills.

The Alberta Construction Association and the Canadian Home Builders’ Association of Alberta have partnered with the government and expect the program to be up and running by 2010.

Although Alberta Environment hasn’t decided exactly how the sys-tem will work, one option might be a deposit-refund program, says Chris Boudreau, a spokesperson with the ministry.

Under the program, industry would be reimbursed for a deposit on materials provided it meets whatever criteria the province lays out. The money generated would fund the program, as would any unredeemed funds. There would be no cost to taxpayers or municipalities. In a sense, this would be a product stewardship program for C&D materials. (See cover story, page 8.)

“Only 10 per cent of what we could recycle is actually being recycled right now,” Boudreau says. “We needed to do something about the vol-ume of waste that is being created.”

Christina Seidel, executive director of the Recycling Council of Alberta, says economic and population growth generated a massive in-crease in housing and commercial construction projects throughout the province.

“Fort McMurray is certainly one of the cities that has undergone a large boom but the biggest problem areas are the largest populated areas — Edmonton and Calgary,” she says.

Despite the economic downturn, a recent report from the Royal Bank of Canada indicates construction in Alberta isn’t likely to slow down.

The RBC Renovations Survey found 74 per cent of Albertans plan to renovate their homes in the next 12 months and that homeowner construction plans rose by five percentage points — the highest in the country.

While the thriving construction industry is creating 23 per cent of landfill waste, Seidel says it has managed to fly under the radar for some time. “It’s almost a bit of a hidden waste stream,” she says.

“The average person doesn’t see it because it’s in unique places, only on construction sites and then it goes to construction landfills. “Most people have no idea,” she adds.

But it was public concern over construction waste that, in part, got

the Alberta Construction Association (ACA) on board with the govern-ment’s plans.

Ken Gibson, executive director of ACA, says contractors have been receiving more and more requests from owners to recycle construction waste. “It’s a need driven by society’s expectations,” he says.

Indeed, many materials can be recycled.“Concrete, brick, stone. Most of this can be reused on new roads,”

Gibson says. He says there are also well-developed markets for steel and copper recycling, as well as drywall, which can go back into the manu-facturing of new drywall or used as compost in soil.

Wood is also recyclable, although demand fluctuates with the market. “Right now with the reduction in the U.S. housing market… the demand for lumber has gone down,” he says.

Since the government announced its plans, Gibson has already start-ed to see more interest and investment in the recycling industry, where he says environmental groups could also make a profit.

“There’s already one fellow setting up a transfer station down in southern Alberta,” says Gibson. “That’s the kind of experimentation that’s going on.”

Alberta would be the only Canadian province to make C&D waste recycling mandatory, although not everyone may be pleased by it.

Michael Nyikes, director of Safety and Technical Services for the Canadian Home Builders’ Association of Alberta, says forcing the in-dustry to recycle could pose problems for less developed parts of the province.

“In some of the smaller, rural communities, they don’t have the same facilities or infrastructure to handle these materials. It’s more prevalent in larger centers,” he says.

Still, Nyikes sees the need for such a program. “The average resident single family house puts approximately four to seven tonnes of construc-tion waste into the landfill through the construction process,” he says.

By diverting 50 per cent of construction and demolitions debris, Al-berta Environment estimates the program would reduce the amount of waste it sends to landfills by 130 kilograms for each Albertan, every year.

Erika Beauchesne is Web Reporter for our affiliate online news service EcoLog.com where this article first appeared. Contact Erika at [email protected]@ARTICLECATEGORY:2241;

487, rue Principale, Ste-Dorothée, Laval Qc (Canada) H7X 1C4Tel: 450•689•1962 Fax: 450•689•2527

240 MacDonald Blvd. Alexandria, On (Canada) K0C 1A0Tel: 613•525•1627 Fax: 613•525•4385

The Canadian Leader in the Manufacturingand Design of Environmental Equipment

Laurin VC2350 2/6/03 10:09 AM Page 1

“The average resident single family house puts approxi-

mately four to seven tonnes of construction waste into

the landfill through the con-struction process.”

by Erika Beauchesne

swr dec-jan 09 ICI&W pp 54-55.indd 54 02/11/10 9:15 AM



http://www.laurin-inc.com

We protect our citizens and we protect our environment. The fire stations in our department recycle the used

rechargeable batteries in their mission-critical equipment such as two-way radios, cell phones, portable

defibrillators and cordless power tools. With RBRC as our partner, recycling is easy and free! RBRC has enrolled more

than 5,400 public agencies and recycled millions of pounds of rechargeable batteries and cell phones since 1996.

Get started today at www.call2recycle.org or call toll free 1-877-723-1297. RBRC. Responsible Recycling.

Pierrette PlanteCaptain of Fire Station #71Montreal, Quebec

“Our fire department recycles used rechargeablebatteries and cell phones. So should you.”

©2007 Rechargeable Battery Recycling Corporation. RBRC is a non-profit public service organization dedicated to recyclingrechargeable batteries and cellular phones. For more information: www.rbrc.org or 1-800-8-BATTERY

Anthony PelusoLieutenant of Fire Station #79

Montreal, Quebec

RC980 SW+R 06-07.07 Two Firefighters R1 Af 5/23/07 2:40 PM Page 1

swr dec-jan 09 pg 55 AD.indd 55 02/11/10 9:17 AM

http://www.call2recycle.org

http://www.rbrc.org


“The Bill is intended to ensure that carriers who remove waste and parties that own or operate

waste disposal sites keep regular, accurate records.”

by Rosalind CooperR E G U L A T I O N R O U N D U P

Waste Initiatives across CanadaOntario private members’ waste reduction billsPrivate Member’s Bill 105 — An Act respecting the reporting of indus-trial, commercial, and institutional waste to facilitate the establishment of waste reduction targets and to promote recycling — received first reading on September 30, 2008 and proceeded to second reading on Oc-tober 16, 2008. The Bill is intended to ensure that carriers who remove waste and parties that own or operate waste disposal sites keep regular, accurate records of waste quantities and submit these to the Minister of the Environment on a quarterly basis. The Bill creates an offence for failing to comply with these requirements, or falsifying information at any point in the reporting process.

Private Member’s Bill 112 — Single-Use Bottled Water Ban Act, 2008 — received first reading on October 21, 2008 and proposes a ban on disposable water bottles. The Bill aims to reduce the amount of waste and lower energy consumption associated with the production of recyc-ling of single-use water bottles.

Saskatchewan consults on WEEE Phase IIThe Saskatchewan Waste Electronic Equipment Program (SWEEP) cur-rently provides province-wide collection and recycling of designated electronic products such as televisions, desktops and notebook comput-ers (including keyboards, mice and cables), monitors and desktop print-ers, and fax machines. The province is now consulting with stakehold-ers to determine which additional electronic products are best suited for inclusion in Phase II of its recycling program.

In considering the inclusion of electronic products for Phase II, SWEEP is considering: the capacity of and ability for collection through the existing collection network; opportunities for collection through an expanded collection network; ability for recycling in an environmentally sound manner; existing recycling capacity for the products; estimated volume of product currently available for collection; and existing prod-uct recycling and/or diversion opportunities. SWEEP is also considering electronic products that are currently regulated or will be regulated in other jurisdictions, such as floor standing printers (copiers), personal computers (handheld), computer flatbed scanners, land-line telephones, cell phones and other wireless devices, answering machines, electronic games, and cameras.

BC guide for dismantling vehiclesThe Vehicle Dismantling and Recycling Industry Environmental Plan-ning Regulation was enacted on September 1, 2007 and is the final re-sult of the consultations conducted by the BC Ministry of Environment based on a policy intentions paper released in October of 2005.

The Regulation requires individual operators or industry asso-ciations (acting on behalf of their members) to develop environmental management plans to demonstrate how they intend to comply with the Regulation. All operators that dismantle five or more wet vehicles in a

calendar year must have registered with the ministry by September 1, 2008 and state that their operation has an environmental management plan in place. The Regulation also requires a system of monitoring and reporting to keep operators in compliance with their plans.

In order to assist those affected by the Regulation, the ministry has released a guide book entitled Guide Book for the Vehicle Dismantling and Recycling Industry Environmental Planning Regulation. The guide provides background information on the Regulation and summarizes the requirements in simple language; it provides information on legal and compliance requirements, and discusses best management practices for hazardous liquids, solids, refrigerants and work areas.

Ontario reviews WDAOn October 16 the Ontario Ministry of the Environment released a dis-cussion paper entitled “Review of Ontario’s Waste Diversion Act, 2002: Discussion Paper for Public Consultation” on October 16, 2008. The purpose of the discussion paper is to facilitate public and stakeholder consultations on the ministry’s review of the Waste Diversion Act, 2002, which came into force on June 27, 2002 and requires a review to be undertaken after the fifth year.

Ontario is currently proposing the adoption of a zero waste policy, focusing on redesigning products and processes to reduce waste before it is created, as well as designing products for greater reuse. The cur-rent review of the legislation provides the ministry with an opportunity to improve its waste diversion framework, and promote its objective of zero waste. (For details, see Cover Story, page 8.)

Toronto reduces packaging wasteThe City of Toronto has prepared a proposal regarding the reduction of packaging waste entitled “Proposed Measures to Reduce In-Store Packaging Waste and Litter, Municipal Hazardous and Special Waste and Plastic Water Bottles.” The various measures proposed are intend-ed to reduce 10,000 tonnes of in-store packaging, including hot drink cups, plastic retail shopping bags and single-use plastic food packaging. These initiatives are part of a larger strategy to achieve the city’s 70 per cent waste reduction target (Target 70).

The shopping bag proposal was pre-empted by an announcement from Mayor David Miller and the association representing the grocers that supermarkets will voluntarily begin charging customers five cents for every plastic shopping bag, unless they bring their own reusable bag. The city has decided to allow residents to place polystyrene (foam pack-aging) and plastic grocery bags in their blue bin collection carts. (For details, see News, page 60.)

Rosalind Cooper, LL.B., is a partner with Fasken Martineau DuMoulin LLP, with offices across Canada. Ms. Cooper is based in Toronto, Ontario. Contact Rosalind at [email protected]@ARTICLECATEGORY:800;

swr dec-jan 09 RegRdup pg 56-57.indd 56 02/11/10 9:18 AM



46 sherbourne street floor 3 toronto on m5a 2p7 canada t 416 214 9998 f 416 214 2229 © copyright 2007 - elemental inc. all rights reserved. this is a contract prooF.

client job# job title

securit sec15401 solid waste & recycling

account executive project manager notes

jennifer pilon michelle toomey purge message ad

date print specs revision # trim size (in) scale

2008/10/03 4/0 3 8.125” w x10.875” h 100%

c m y k 0000 0000 0000 0000 0000

approval section client signature dateapproved approved with changes new proof required

swr dec-jan 09 RegRdup pg 56-57.indd 57 02/11/10 9:19 AM

Ph: 613-538-2776 www.laflecheenvironmental.com

Reduce - Reuse - ReplenishReduce - Reuse - ReplenishPutting waste to work!

BIO REACTOR AD 8/2/06 3:25 PM Page 1

Baycon Environmental offers personalized, responsiveservice, budget sensitive project solutions and years ofinvaluable project management experience.

www.Baycon.caTelephone: 416.405.8880 • Fax: 416.405.8830

BAYCON ENVIRONMENTALCONSULTING

• Site Remediation• Site Services & Site Clearing• Mold Abatement• Asbestos Abatement

• Phase I, II, III env. assessments• Demolition• Licensed under M.O.E.E• Licensed under T.S.S.A

Baycon-HMM 12/1/08 3:12 PM Page 1

Continuous Clean Energy Power Plant

Greey EnWasteunit of Greey CTS Inc.

David Greey, P.Eng

EMail:[email protected]

416-595-0535

GREEYENWASTE/MC7562/SWR.indd 1 12/2/08 9:32:53 AM


N E W S

EcoMedia taps CNE as new venueEcoMedia has penned a three-year deal with the Canadian National Exhibition in Toronto that will give advertisers further access to the approximately 1.2 million visitors who pass under the Prince’s Gates. EcoMedia will grad-ually replace the 45-gallon garbage bins dot-

If you aren't a member - Joinmwin and become a leader!For further information about how you can join mwin:Contact: Maryanne Hill, Executive DirectorP.O. Box #1116, 704 Glen Morris Road W., Ayr, ON N0B 1E0Tel: (519) 620-9654 Fax: (519) 620-9678

Let us help you win the waste game200 . Get involved! If you are a

member - become active - make a difference!

E-mail: [email protected] Website: www.mwin.org

Winning the Waste Game!

MWIN-SV029-SWR 12/12/06 10:38 AM Page 1

9

swr dec-jan 09 News pg 58-60.indd 58 02/11/10 9:20 AM

http://www.laflecheenvironmental.com

http://www.Baycon.ca




http://www.mwin.org

http://www.amtruck.com

http://www.adlprocess.com


N E W S

ting the Exhibition grounds with branded re-cycling units. More advertisers will be able to gain access to EcoMedia’s units at next year’s CNE, as the company plans to expand the fair-ground fleet to over 200 units, and over 300 the following year.Visit www.eco-media.ca

OVWRC programs win awards

Waste Reduction Week proved to be a re-warding experience for the Ottawa Valley Waste Recovery Centre (OVWRC) in more ways than one. Recently, two of the Centre’s programs were recognized by provincial or-ganizations at award ceremonies held during Waste Reduction Week. At its annual annual Waste Minimization Awards the OVWRC was awarded a bronze recognition by the Recyc-ling Council of Ontario (RCO) in the Waste Diversion Program Operator category for the work done implementing an integrated waste management program with Algonquin Park using MOLOK bins. The OVWRC was also recognized by the Municipal Waste Associa-tion (MWA, formerly the AMRC, see page 6) at MWA’s annual Promotion and Education Awards. This year, the centre’s sustainable garden was recognized by MWA as one of the top three in the Promotional Tool “Other” cat-egory.Visit www.ovwrc.com NOTE: The Febru-ary/March edition of this magazine will fea-ture an in-depth look at the OVWRC’s award-winning programs.

Lafarge loses legal battle to stop hearing tire proposalLafarge has lost its legal battle at the Ontario Court of Appeal to stop an independent hear-ing from scrutinizing a controversial incin-eration proposal at its plant west of Kingston, Ontario. A spokesperson for Lafarge said the defeat means that the cement producer will scrap its plans to burn tires as fuel. A coalition of concerned citizens and environmental advo-cates applauded the decision that will have im-

plications for environmental decision-making across the province. The ruling rejected the company’s attempt to shut down public hear-ings into the cement manufacturer’s proposal to burn millions of kilograms of tires, plas-tics, bone meal and other waste in its kiln in Bath, Ontario. The Court of Appeal rejected, without reasons, Lafarge’s attempt to appeal the Divisional Court’s decision of last June, which had dismissed last-ditch efforts by La-farge to shut down an Environmental Review Tribunal (ERT) hearing over the controversial proposal.Visit www.ecojustice.ca

Republic-Allied deal cleared with conditionsThe US Department of Justice announced De-cember 3, 2008 that it has reached a settlement that will require Republic Services Inc. and Allied Waste Industries Inc. to divest commer-cial waste collection and disposal assets, serv-ing 15 metropolitan areas, in order to proceed with Republic’s proposed $4.5 billion acquisi-tion of Allied. The settlement requires Repub-lic and Allied to divest 87 commercial waste collection routes, nine landfills and 10 transfer stations, together with ancillary assets and, in three cases, access to landfill disposal cap-



http://www.eco-media.ca

http://www.ovwrc.com

http://www.ecojustice.ca

http://www.trux.com

http://www.amrc.ca

http://www.batterybroker.on.ca



http://www.carriervibrating.com


Project1 11/13/06 10:28 AM Page 1

N E W S

acity. The department said that the transaction, as originally proposed, would have resulted in higher prices for collection of municipal solid waste from commercial businesses or disposal of waste, or both, in these areas.

Glass container industry sets goalIn an announcement that can be read as a veiled

endorsement of deposit-refund systems for bev-erage containers, the Glass Packaging Institute (GPI) has agreed to the goal of using at least 50 per cent recycled glass in the manufacture of new glass bottles and jars by 2013. Using the US EPA’s benefits calculator, GPI estimates energy savings from using 50 per cent recycled content in all glass packages manufactured in

the U.S. could save enough energy to power over 45,000 households for a year. GPI plans to accelerate support of legislative and regulatory measures that will dramatically improve glass recycling systems in order to reach these en-vironmental goals. In related news, the Alum-inum Association similarly pledged to support initiatives to increase collection of its valuable material, recognizing that billions of cans end up in landfill each year.Visit www.gpi.org

Toronto in-store packagingThis fall the City of Toronto prepared a paper entitled “Proposed Measures to Reduce In-Store Packaging Waste and Litter, Municipal Hazardous and Special Waste and Plastic Water Bottles.” The measures described were intended to reduce 10,000 tonnes of in-store packaging, including hot drink cups, plastic retail shopping bags and single-use plastic food packaging. After negotiations between the city and industry, and separate discus-sions between Mayor David Miller and the grocers, various compromises were hashed out. The grocers agreed that supermarkets will voluntarily charge customers five cents for plastic shopping bags, unless they bring their own reusable bags. The city agreed to collect polystyrene foam packaging and also plastic grocery bags that it will now allow residents to place in their blue recycling carts. The city would like to divert plastic take-out food con-tainers and has given industry until 2011 to come up with a solution. It will go ahead with ban on the sale of water in plastic bottles in its own buildings.

Quebec brewers announce inventive to recover bottlesThe Quebec Brewers Association (QBA) and its members Labatt and Molson breweries, along with their partner, l’Association des dé-taillants en alimentation du Québec (ADAQ) have announced the implementation of an En-vironmental Incentive Premium that will pro-mote the recuperation of the refillable glass 341 ml standard bottle. This new measure will come into effect on April 1, 2009.

The will be implemented in two phases. First, a premium of $0.10 per metric case (a case of 24 refillable 341 ml standard glass beer bottles) will be paid to all Quebec re-tailers who hold beer vendor permits up until January 31, 2012. Second, effective February 1, 2012, the premium will increase to $0.24 per metric case. Overall, the implementation of the new incentive premium will entail an annual investment of more than $15 million by Quebec’s large brewers.Visit www.brasseurs.qc.ca



http://www.gpi.org

http://www.brasseurs.qc.ca

http://www.ebccanada.com

http://www.mmm.ca

http://www.2cg.ca

http://www.fastpacesoftware.com


Advertisers’ Index December/January 2009

Company Page # Company Page #

ADL Process . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58

AET Consultants . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .11

Air Weigh-Tronix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .21

Americana . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45

AMRC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59

Amtruck . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58

Bandag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63

Battery Broker Environmental Services Inc . The . . . . . . . . . . . . . . . . . . . . . . . . . . .59

Baycon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58

Borden Ladner . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .15

Carrier . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59

Canadian Waste & Recycling Expo . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2

Continental Biomass . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5

EMF Containers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16

Environmental Business Consultants (J . Nicholson) . . . . . . . . . . . . . . . . . . . . . . . 60

Eriez Magnetics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61

Fast Pace Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .60

Going Green for Green . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41

Golder Associates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18

Greey EnWaste . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58

Groundworx . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .19

Hallco Mfg . Co . Inc . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .15

I .W . Kuhn . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .20

Lafleche . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58

Laurin Inc . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .54

Machinex . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .43

Mack Truck . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64

MMM Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .60

Metro Waste Paper . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10

MWIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58

Norseman Plastics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23

OWMA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .61

Paradigm Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .21

Paul Van der Werf (2CG) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .60

Protainer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52

RBRC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55

Rotobec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .44

Samuel Strapping . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .17

Schuyler Rubber . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10

Sebright . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .13

Shred-It . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57

Sims Cab Depot . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22

Trux Route Management Systems Inc . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59

Van Dyk Baler Corp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42

Walinga . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .12

Waste Expo . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .49

WheelChek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52

FREE Brochure

& DVDWatch it operate!

Online at

www.eriez.com

Take the AIR out of your metal sorting,Call 888-300-3743or visit www.eriez.com

THE AIRLESS METAL RECOVERY SYSTEMIdeal for the scrap metals market, the patent-pending ProSort airless metal recovery system uses high sensitivity metal sensors aligned with low energy electro-magnetically drivenpaddles to separate valuable metals from waste material.

®

ProSort_SolidWaste10_07.qxd 9/25/07 11:02 AM Page 1

Who’s standingup for YourBusiness?

Ontario Waste Management AssociationOntario Waste Management Association

If you own or manage aprivate sector wastemanagement companyinvolved in any facet ofsolid or hazardous wastemanagement – let us standup for you …join OWMAtoday!

OWMA has a primarymission to support a strongand viable waste serviceindustry and to ensure thatOWMA member companiesare recognized as industryleaders.

If you own or manage aprivate sector wastemanagement companyinvolved in any facet ofsolid or hazardous wastemanagement – let us standup for you …join OWMAtoday!

OWMA has a primarymission to support a strongand viable waste serviceindustry and to ensure thatOWMA member companiesare recognized as industryleaders.

Contact: Michele Goulding(905) 791-9500 www.owma.org

OWMA AD 6/5/07 7:33 AM Page 1

swr dec-jan 09 ad idx pg 61.indd 61 02/11/10 9:22 AM


http://www.eriez.com

http://www.owma.org


“We feel strongly that all LCA studies should met

ISO standards and be peer reviewed by independent

experts.”

by John MullinderB L O G

GreenwashThe frustrating and dirty world of propaganda

Everybody’s done it: selectively use information, put the best shine on a résumé, gloss over or omit stuff that might raise questions. It’s the same with environmental claims and labeling, lifecycle

analysis (LCA), and the latest buzzword, sustainability. Let me some-what generally typecast the offenders as the “ignorant,” the “academic-ally sloppy,” the “selective fact portrayers” and the “downright dirty.” Readers would be well-advised to beware of such misinformation when attempting to formulate rational decisions. Here are some examples.

The ignorant: Toronto councilor Glenn De Baeremaeker was re-cently reported publicly as saying that paper grocery bags and telephone books were the result of “ripping down thousand-year-old trees in British Columbia to use once… and then throwing (them) in the gar-bage.” Sorry councilor, but most paper grocery bags used in Canada come not from BC but from renewable US plantation forests that have been third-party certified as being sustain-ably managed. The minority that come from renewable Canadian managed forests (again certified) are made from wood chips, shav-ings and sawdust left over from harvesting trees for lumber (to make hospitals, univer-sities and De Baeremaeker’s house). As for telephone books, most are made from 100 per cent recycled paper materials (old news-papers and egg cartons). And while he’s checking his facts, De Baeremaeker could maybe find time to investigate the latest residential recovery rates for Ontario: 72 per cent for paper overall and 88 per cent for telephone books.

The academically sloppy: These are the people who quote “life-cycle” studies without even reading the original works (one downfall of the Internet) or taking any notice of the carefully worded disclaimers of the authors of those studies (sometimes as broad as the exclusion clauses of an insurance policy). They don’t dig behind who commissioned and funded the studies (sometimes obscured) and they quote studies that are up to 20 years old as if they were relevant today. They make assumptions that raw materials are supplied by the country of destination and that the energy grid of one country is roughly equivalent to that of another. For example, all kraft paper producing mills in Canada generate steam and electricity for their own paper production from wood and process wastes (chips, shavings, sawdust). They do not use 100 per cent purchased pet-roleum-based energy, as many European-based LCAs assume.

The selective fact portrayers: These seize on information that promotes their cause and neglect to mention other factors that, put to-gether, perhaps would tell an entirely different story. For example, a recent study commissioned by a section of the European paper industry (performed and backed by exactly the same independent parties that participated in an earlier plastics-funded study) found that five environ-mental indicators were systematically favorable to paper carrier bags

and two indicators systematically favorable to plastic carrier bags. Does that justify saying that one is better than the other? No. The study also found that it’s not enough to simply base comparisons on the ability to transport goods (carrying capacity). Protection, advertising support, strength, stiffness and print quality should also be taken into account in any comparative LCA.

A particular concern of the paper industry is that renewable resour-ces and the carbon cycle be fairly incorporated into any comparisons be-tween materials. This is why we have objected to parts of the Wal-Mart scorecard (which promotes renewable energy while barely recognizing renewable resources) and to the Packaging Association of Canada’s proposed S-PAC model which doesn’t recognize renewable resources at all. Better news on the horizon is the emergence of the COMPASS tool being developed by the US-based Sustainable Packaging Coalition.

It focuses on eight separate environmental indicators and treats each on its own merits rather than the S-PAC model that wants to condense all indicators into a single “sus-tainable packaging” number (so brand-owners can be charged for the right to put a logo or a statement on their packages).

The downright dirty: We would clas-sify these as those who should know better but who deliberately smear a competitor or a competing packaging material through simplistic stereotyping and myth-making (“tree-hungry paper bags,” etc.).We find this particularly offensive given the facts, but let’s move on.

SolutionsWe’re encouraged that the CSA and the federal Competitions Bureau are recommending the term “environmentally friendly” not be used as it’s extremely misleading. We feel strongly that all LCA studies should met ISO standards and be peer reviewed by independent experts, and that European lifecycle studies have little relevance to Canadian cir-cumstances. In fact, a peer-reviewed LCA of the average US corrugated box is about to be released and a boxboard one is following it. Where possible, we hope to “Canadianize” this data at some point. Almost 90 per cent of Canada’s managed forests are now third-party certified to one of three internationally recognized sustainable forest management standards. Check for yourself by reading Natural Resources Canada’s annual report The State of Canada’s Forests at http://canadaforests.nrcan.gc.ca/rpt

John Mullinder is Executive Director of the Paper & Paperboard Packaging Environmental Council (PPEC). Contact John at [email protected]. See announcement, page XX.@ARTICLECATEGORY:788;

swr dec-jan 09 Blog pg 62.indd 62 02/11/10 9:25 AM


http://canadaforests


CLI

ENT:

BAN

DAG

JOB

#:BA

N70

025-

Bras

s-PG

US-

Mst

rVE

RSI

ON

:U

S EN

GLI

SH

SIZE

:LI

VE: 7

.375

" X 1

0"TR

IM: 7

.875

" X10

.5"

BLEE

D: 8

.125

" X 1

0.75

"

CO

LOR

:4/

CPU

B:IS

SUE

DAT

E:

921

Wa

shin

gto

n A

ven

ue

So

uth

Min

ne

ap

olis

, M

N 5

54

15

61

2. 3

99

. 05

00

How do you thrive despite hostile driving environments and brutal economic conditions? Get a smarter

tire program. With premium, best-in-class retreads. Backed by legendary service. Bandag. The

company that has been leading the precured retreading industry for 50 years. ROLL SMART.

X FIND OUT HOW BANDAG COULD SAVE YOU 10% OR MORE ON TIRE COSTS. SEE BANDAG.COM/SAVE.

©2007 BANDAG — ALL RIGHTS RESERVED

ESTABLISHED 1957

BAN70025-Brass-PGUS-Mstr 3/12/08 2:50 PM Page 1


http://www.bandag.com/save

STOP AND GO – ON YOUR OWN TERMS

Never having to stop to clean your Diesel Particulate Filter is the competitive advantage you get with the new Mack® TerraPro™ Cabover.

Our solution automatically initiates thermal regeneration while you work, cleaning the soot that collects in the DPF. This saves you time and

money, and improves the efficiency of your workforce. And with its powerful, fuel-efficient MP7 engine – it’s clear the TerraPro is engineered

to keep you moving forward.

MACKTRUCKS.COM©2008 Mack Trucks, Inc. All rights reserved.

MCKTRK_4599_TProMRPg_SWR.indd 1 10/13/08 10:50:24 AM


http://www.macktrucks.com

solid waste & recycling dec/jan 2009

Documents

waste business

ici waste

waste future

demolition waste

waste stream

chaotic pharma waste

materials page

cover pg